KIAA0515 antibody - N-terminal region (ARP47973_P050) Data Sheet
Product Number ARP47973_P050 Product Name KIAA0515 antibody - N-terminal region (ARP47973_P050) Size 50ug Gene Symbol PRRC2B Alias Symbols RP11-334J6.1; DKFZp781F05101; DKFZp781K12107; LQFBS-1; MGC10526; BAT2L; BAT2L1; KIAA0515 Protein Size (# AA) 444 amino acids Molecular Weight 48kDa Product Format Lyophilized powder NCBI Gene Id 84726 Host Rabbit Clonality Polyclonal Official Gene Full Name Proline-rich coiled-coil 2B This is a rabbit polyclonal antibody against KIAA0515. It was validated on Western Blot using a cell lysate as a Description positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: ATASQPPESLPQPGLQKSVSNLQKPTQSISQENTNSVPGGPKSWAQLNGK Description of Target The function remains unknown. ACSL3, ACTG1, AP1M2, AP2M1, ARL4D, ATP1A1, CANX, CDH1, CLTC, CNDP2, COPB2, CTNNB1, Partner Proteins DDX1, DDX5, DLST, EEF1G, EEF2, EIF2S3, EIF3E, EWSR1, FASN, HNRNPF, HNRNPH1, HNRNPU, HSD17B4, HSP90AA1, HSPA5, ILF3, KIF5B, LDHA, MAOA, MME, NCL, PABPC1, PHYHIP, PKM2, PPP2R2A, PRKACA, PSMC2, PSMC3, PSMD2, RPL24, RP Reconstitution and Add 50 ul of distilled water. Final anti-KIAA0515 antibody concentration is 1 mg/ml in PBS buffer with 2% Storage sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-KIAA0515 antibody is Catalog # AAP47973 (Previous Catalog # AAPS20001) Immunogen The immunogen for anti-KIAA0515 antibody: synthetic peptide directed towards the N terminal of human KIAA0515 Sample Type Confirmation PRRC2B is supported by BioGPS gene expression data to be expressed in HepG2 Protein Accession # EAW87968 Purification Affinity Purified Species Reactivity Bovine, Mouse, Horse, Guinea pig, Human, Rabbit, Rat, Dog Application WB Predicted Homology Based on Immunogen Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%; Rabbit: 93%; Dog: 86% Sequence Human HepG2
WB Suggested Anti-KIAA0515 Antibody Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysate Image 1 PRRC2B is supported by BioGPS gene expression data to be expressed in HepG2
______
This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.