Aviva Systems Biology EPB41 antibody - middle region (ARP42186_P050) Product Number ARP42186_P050 Product Page http://www.avivasysbio.com/epb41-antibody-middle-region-arp42186-p050.html Product Name EPB41 antibody - middle region (ARP42186_P050) Size 100 ul Symbol EPB41 Alias Symbols 4.1R, EL1, HE Size (# AA) 588 amino acids Molecular Weight 66kDa Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. NCBI Gene Id 2035 Host Rabbit Clonality Polyclonal Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml Official Gene Full Erythrocyte membrane protein band 4.1 (elliptocytosis 1, RH-linked) Name Description This is a rabbit polyclonal antibody against EPB41. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire ([email protected]). Peptide Sequence Synthetic peptide located within the following region: QVAEGGVLDASAKKTVVPKAQKETVKAEVKKEDEPPEQAEPEPTEAWKKK Description of Elliptocytosis is a hematologic disorder characterized by elliptically shaped erythrocytes Target and a variable degree of hemolytic anemia. Inherited as an autosomal dominant, elliptocytosis results from mutation in any one of several encoding of Protein Interactions CLNS1A; ZCCHC10; RWDD2B; CALM; UBC; FN1; Htt; MACROD1; C2CD2L; CENPJ; TJP2; EIF3G; SMAD3; SEC14L1; YWHAB; DLG1; KPNA2; CASK; GDI1; U2AF2; U2AF1; TUBA4A; TPM1; FKBP2; SPTB; SPTAN1; SPTBN1; EPB42; PRKCB; NUMA1; MYL1; YWHAQ; EGFR; DRD3; DRD2; CRYAB; BCAM; GY Reconstitution and For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in Storage small aliquots to prevent freeze-thaw cycles. Lead Time Domestic: within 6-8 weeks delivery International: 6-8 weeks *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges Blocking Peptide For anti-EPB41 (ARP42186_P050) antibody is Catalog # AAP42186 (Previous Catalog # AAPS13901) Immunogen The immunogen is a synthetic peptide directed towards the middle region of human EPB41

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 1 Complete Anti-EPB41 (ARP42186_P050) computational species homology data Tissue Tool Find tissues and cell lines supported by DNA array analysis to express EPB41. Swissprot Id P11171 Protein Name Protein 4.1 Protein Accession NP_004428 # Purification Affinity Purified RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express EPB41. Nucleotide NM_004437 Accession # Conjugation ARP42186_P050-FITC Conjugated Options ARP42186_P050-HRP Conjugated ARP42186_P050-Biotin Conjugated Species Reactivity Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast Application WB Predicted Cow: 83%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 100%; Homology Based Rabbit: 79%; Rat: 93%; Yeast: 75% on Immunogen Sequence

Image 1: Human Thymus WB Suggested Anti-EPB41 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Thymus

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins. This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 2