Anti-RDBP Polyclonal Antibody (CABT-BL5525) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Anti-RDBP polyclonal antibody (CABT-BL5525) This product is for research use only and is not intended for diagnostic use.

PRODUCT INFORMATION

Product Overview Rabbit Anti-RDBP polyclonal Antibody

Target RDBP

Immunogen Recombinant protein corresponding to amino acids of human RDBP.

Isotype IgG

Source/Host Rabbit

Species Reactivity Human

Purification Antigen affinity purification

Conjugate Unconjugated

Sequence Similarities LLALKKQSSSSTTSQGGVKRSLSEQPVMDTATATEQAKQLVKSGAISAIKAETKNSGFKRSRTLE GKLKDPEKGP VPTFQPFQRSISADDDLQESSRRPQRKSLYESFVSSSDRLRELGPDG

Format Liquid

Buffer In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)

Preservative 0.02% Sodium Azide

Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.

BACKGROUND

Introduction The protein encoded by this gene is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins; however, it has not been demonstrated that this protein binds RNA. The protein contains a tract of alternating basic and acidic residues, largely arginine (R) and aspartic acid (D). The gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. [provided by RefSeq, Jul 2008]

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]

Entrez Gene ID 7936

Protein Refseq NP_002895

UniProt ID P18615

Chromosome Location 6p21.3

Pathway Abortive elongation of HIV-1 transcript in the absence of Tat, organism-specific biosystem; Disease, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV- 1 Tat, organism-specific biosystem; Formation of RNA Pol II elongation complex, organism- specific biosystem; Formation of the Early Elongation Complex, organism-specific biosystem; Formation of the HIV-1 Early Elongation

Function RNA binding; nucleotide binding;

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]