DOCSLIB.ORG

Supplementary Information for the Crebbp Acetyltransferase Is A

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Supplementary Information for the Crebbp Acetyltransferase Is A Supplementary Information for The Crebbp acetyltransferase is a haploinsufficient tumor suppressor in B cell lymphoma Jiyuan Zhang1, Sofija Vlasevska1, Victoria A. Wells1, Sarah Nataraj1, Antony B. Holmes1, Romain Duval1, Stefanie N. Meyer1, Tongwei Mo1, Katia Basso1,2, Paul K Brindle3, Shafinaz Hussein4, Riccardo Dalla-Favera1,2,5,6,7 and Laura Pasqualucci1,2,7* 1 Institute for Cancer Genetics, Columbia University, New York, NY 10032, USA 2 Department of Pathology and Cell Biology, Columbia University, New York, NY, 10032, USA 3 Department of Biochemistry, St. Jude Children’s Research Hospital, Memphis, TN 4 Department of Pathology and Laboratory Medicine, NorthWell Health, Staten Island University Hospital, Staten Island, New York, USA 5 Department of Genetics & Development, Columbia University, New York, NY, 10032, USA 6 Department of Microbiology & Immunology, Columbia University, New York, NY, 10032, USA 7 Herbert Irving Comprehensive Cancer Center, Columbia University, New York, NY, 10032, USA *Correspondence: [email protected] SI Guide Supplementary Figure S1. CREBBP binds to GC-specific super-enhancers Supplementary Figure S2. Crebbp and EP300 expression in the B cell lineage Supplementary Figure S3. GSEA of Crebbp-conditional knock-out GC B cells and human DZ vs LZ B cells Supplementary Figure S4. Analysis of GC B cell responses in Crebbpfl/fl Cγ1-Cre and CD19-Cre cohorts Supplementary Figure S5. Analysis of plasma cell differentiation in Crebbpfl/fl Cγ1-Cre and CD19-Cre cohorts Supplementary Figure S6. Distribution pattern of CREBBP mutations in FL and de novo DLBCL Supplementary Figure S7. Analysis of Crebbp conditional knock-out tumor cohorts Supplementary Table S1. Overlap between CREBBP bound regions and predicted super- enhancers in GC B cells Supplementary Table S2. Genes differentially expressed in Crebbpfl/fl vs Crebbp+/+ GC B cells Supplementary Table S3. List of CREBBP “core target” genes (bound by CREBBP in human GC B cells and downregulated in Crebbpfl/fl Cγ1-Cre GC B cells) Supplementary Table S4. Pathway enrichment analysis of CREBBP "core target" genes Supplementary Table S5. Leading edge associated with GSEA of CREBBP core target genes in the rank of genes differentially expressed in DZ vs LZ GC B cells Supplementary Table S6. Pathway enrichment analysis of genes co-bound by CREBBP and BCL6 in human GC B cells Supplementary Table S7. V gene rearrangement analysis of B-cell lymphomas in the Crebbpfl/+/ Cγ1-Cre /VavP-BCL2 conditional knock-out mouse model Supplementary Table S8. List of antibodies used in FACS analysis 2 SUPPLEMENTARY FIGURE LEGENDS Supplementary Figure S1. CREBBP binds to GC-specific super-enhancers. ChIP-seq plots of CREBBP and H3K27Ac binding at genes associated with GC-specific super-enhancers (SE), as predicted by the ROSE algorithm. Read density tracks of BCL6, H3K4me1, H3K4me3 and H3K27me3 ChIP-Seq enrichment are also shown. Supplementary Figure S2. CREBBP and EP300 expression in the B cell lineage. A, CREBBP and EP300 mRNA expression levels in naive, GC and memory B cells purified from reactive human tonsils, measured by RNA-seq (n = 3 donors each, representing 3 biological replicates; mean ± SD). Data were normalized to the total number of mapped reads in each sample and to the transcript size, and are expressed as reads per kilobase per million mapped reads (RPKM). B, CREBBP and EP300 protein expression in human naive, GC and memory B cells. BCL6 controls for the identity of the populations and tubulin serves as loading control. C, CREBBP and EP300 mRNA expression in GC dark zone (DZ) and light zone (LZ) B cells sorted from reactive human tonsils (left bars) or from the spleen of immunized mice (right bars), and analyzed by gene expression profiling using Affymetrix HG U133_plus 2 (human) or MG 430_2.0 (mouse) arrays (Accession No: GSE38697 and GSE38696, respectively). Data (MAS5- normalized) are expressed as linear absolute levels, and the probe ID is provided for each transcript (n = 3 donors/subset, representing biological replicates; mean ± SD). * P < 0.05, ** P < 0.01, Student’s t-test. Only statistically significant differences are indicated. D, CREBBP and EP300 mRNA expression levels during hematopoietic development in the mouse, as obtained from the Immgen.org database at https://www.immgen.org/. All data were generated on the Affymetrix Mouse Gene 1.0ST array. Supplementary Figure S3. GSEA of Crebbp-conditional knockout GC B cells and human GC DZ vs LZ cells. A, Enrichment plots of selected gene sets in the rank of genes differentially expressed between Crebbpfl/fl Cγ1-Cre (KO) and Crebbp+/+ Cγ1-Cre (WT) GC B cells. The preferential enrichment of previously identified FOXO1-bound genes in the Crebbp-proficient cells may reflect subtle changes imposed by Crebbp loss on transcription, which were not detected in the less sensitive, supervised gene expression analysis. B, Enrichment plots of the top 500 CREBBP-bound genes in the rank of genes differentially expressed between GC DZ and LZ cells (left panel). The analysis was performed separately with the top 500 genes bound by CREBBP at promoter regions (middle panel) or at TSS-distal, putative enhancer regions (right panel). Bound genes were identified as described in Methods and were ranked based on increasing P value. Supplementary Figure S4. Analysis of GC B cell responses in Crebbpfl/fl Cγ1-Cre and CD19- Cre cohorts. A, Immunofluorescence staining of CREBBP and EP300 in representative spleen sections from SRBC immunized Cγ1-Cre mice. PNA (green) identifies the GC area (outlined). B, Representative flow cytometric analysis of splenic B220+ cells from 12-16 week-old Crebbp+/+ (WT), Crebbpfl/+ (HET), and Crebbpfl/fl (KO) Cγ1-Cre mice analyzed 10 days after SRBC immunization. GC B cells are identified as CD95+PNAhi cells, and numbers in each panel indicate the percentage in the gate. C, Percentage of GC B cells in mice from the indicated genotypes, analyzed at 3 months of age, 10 days after SRBC immunization. D, Representative contour plots of GC B cell DZ (CXCR4hiCD86lo) and LZ (CXCR4loCD86hi) populations in Cγ1- 3 Cre mice of the indicated genotypes, analyzed 10 days after SRBC immunization according to an established gating strategy (1-3); cells are gated on the B220+CD95+PNAhi population, and numbers in each panel indicate the percentage in the DZ and LZ gates. E, Western blot analysis of Crebbp and Ep300 in sorted GC B cells from Crebbp+/+ (WT), Crebbpfl/+ (HET), and Crebbpfl/fl (KO) CD19-Cre mice. The relative intensity of the bands is quantified below the image after normalization for the loading control, with the wild type band arbitrarily set as 1. Bcl6 serves as control for the identity of the population. F, Representative flow cytometric analysis of splenic B220+ cells from 12-16 week-old mice of the indicated genotypes in the CD19-Cre cohort, analyzed 10 days after SRBC immunization. G, Percentage of GC B cells in mice from the indicated genotypes, analyzed at 3 months of age, 10 days after SRBC immunization. H, Analysis of DZ and LZ GC B cells in the CD19-Cre cohort. In all panels, ns denotes not significant, as calculated by one-way ANOVA. Supplementary Figure S5. Analysis of plasma cell differentiation in Crebbpfl/fl Cγ1-Cre and CD19 cohorts. A, Representative flow cytometric analysis of splenic plasma cells and surface IgG1+ B cells in Crebbp+/+ (WT), Crebbpfl/+ (HET), and Crebbpfl/fl (KO) Cγ1-Cre mice. Numbers denote the percentage of cells within the gate, relative to total lymphocytes. B, Percentage (top) and absolute number (bottom) of bone marrow (BM) plasma cells in 12-16 week-old mice of the indicated genotypes, analyzed 10 days after SRBC immunization. Each symbol represents one mouse, and the horizontal bar denotes the mean. C, Quantification of frequencies (top) and absolute numbers (bottom) of splenic plasma cells, BM plasma cells, and IgG1+ B cells in the CD19-Cre cohort, illustrated as in B (cumulative data from at least two independent experiments performed on 3-4 mice each, 10 days after SRBC immunization; data for BM plasma cells are also provided at day 7 post-secondary immunization in the far right panels). As reported, Crebbpfl/fl CD19-Cre mice show reduced percentages and numbers of B220+ cells (not shown) (4), impacting on the number of all mature B cell subsets. * P < 0.05, *** P < 0.005, one-way ANOVA. D, Antibody titers in the serum of 12-16 week-old Crebbp- floxed CD19-Cre mice, measured before (top) and 14 days after (bottom) immunization with the T-cell specific NP-KLH hapten. IgG3 and IgA titers were only obtained from 5 of the 6, Crebbp KO animals, due to insufficient amounts of serum. * P < 0.05, ** P < 0.01, Student’s t-test. Only statistically significant differences are highlighted in the figure. Supplementary Figure S6. Distribution pattern of CREBBP mutations in FL and de novo DLBCL. A, Percentage of CREBBP mutated samples showing monoallelic (red) vs biallelic (grey) mutations in DLBCL and FL/transformed FL (tFL). The total number of cases analyzed is given below the pie. B, Overall percentage of CREBBP/EP300 mutated cases harboring concurrent chromosomal translocations of BCL2 in FL, GCB-DLBCL and ABC-DLBCL. Data in the left panel refer to CREBBP mutated/deleted cases, while data in the right panel also include EP300 mutated cases. C, Distribution of CREBBP mutations, EP300 mutations and BCL2 chromosomal translocations in FL, GCB-DLBCL and ABC-DLBCL samples. In the heatmap, each column represents one case, and color codes denote the presence (red) or absence (white) of the genetic lesion. Tx, translocation; M, mutation; D, deletion. Only cases with available information for all indicated lesions were included in the analysis displayed in panels B and C. DLBCL data integrate published studies by our group, while data on FL cases derive from Morin et al., Nature 2011.
Load more

Recommended publications
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Genome-Wide Analysis of Androgen Receptor Binding and Gene Regulation in Two CWR22-Derived Prostate Cancer Cell Lines
    Endocrine-Related Cancer (2010) 17 857–873 Genome-wide analysis of androgen receptor binding and gene regulation in two CWR22-derived prostate cancer cell lines Honglin Chen1, Stephen J Libertini1,4, Michael George1, Satya Dandekar1, Clifford G Tepper 2, Bushra Al-Bataina1, Hsing-Jien Kung2,3, Paramita M Ghosh2,3 and Maria Mudryj1,4 1Department of Medical Microbiology and Immunology, University of California Davis, 3147 Tupper Hall, Davis, California 95616, USA 2Division of Basic Sciences, Department of Biochemistry and Molecular Medicine, Cancer Center and 3Department of Urology, University of California Davis, Sacramento, California 95817, USA 4Veterans Affairs Northern California Health Care System, Mather, California 95655, USA (Correspondence should be addressed to M Mudryj at Department of Medical Microbiology and Immunology, University of California, Davis; Email: [email protected]) Abstract Prostate carcinoma (CaP) is a heterogeneous multifocal disease where gene expression and regulation are altered not only with disease progression but also between metastatic lesions. The androgen receptor (AR) regulates the growth of metastatic CaPs; however, sensitivity to androgen ablation is short lived, yielding to emergence of castrate-resistant CaP (CRCaP). CRCaP prostate cancers continue to express the AR, a pivotal prostate regulator, but it is not known whether the AR targets similar or different genes in different castrate-resistant cells. In this study, we investigated AR binding and AR-dependent transcription in two related castrate-resistant cell lines derived from androgen-dependent CWR22-relapsed tumors: CWR22Rv1 (Rv1) and CWR-R1 (R1). Expression microarray analysis revealed that R1 and Rv1 cells had significantly different gene expression profiles individually and in response to androgen.
    [Show full text]
  • UNIVERSITY of CALIFORNIA RIVERSIDE Investigations Into The
    UNIVERSITY OF CALIFORNIA RIVERSIDE Investigations into the Role of TAF1-mediated Phosphorylation in Gene Regulation A Dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Cell, Molecular and Developmental Biology by Brian James Gadd December 2012 Dissertation Committee: Dr. Xuan Liu, Chairperson Dr. Frank Sauer Dr. Frances M. Sladek Copyright by Brian James Gadd 2012 The Dissertation of Brian James Gadd is approved Committee Chairperson University of California, Riverside Acknowledgments I am thankful to Dr. Liu for her patience and support over the last eight years. I am deeply indebted to my committee members, Dr. Frank Sauer and Dr. Frances Sladek for the insightful comments on my research and this dissertation. Thanks goes out to CMDB, especially Dr. Bachant, Dr. Springer and Kathy Redd for their support. Thanks to all the members of the Liu lab both past and present. A very special thanks to the members of the Sauer lab, including Silvia, Stephane, David, Matt, Stephen, Ninuo, Toby, Josh, Alice, Alex and Flora. You have made all the years here fly by and made them so enjoyable. From the Sladek lab I want to thank Eugene, John, Linh and Karthi. Special thanks go out to all the friends I’ve made over the years here. Chris, Amber, Stephane and David, thank you so much for feeding me, encouraging me and keeping me sane. Thanks to the brothers for all your encouragement and prayers. To any I haven’t mentioned by name, I promise I haven’t forgotten all you’ve done for me during my graduate years.
    [Show full text]
  • Differential Regulation of Estrogen Receptor Α Expression in Breast
    Author Manuscript Published OnlineFirst on January 10, 2014; DOI: 10.1158/0008-5472.CAN-13-2020 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. CAN-13-2020R Differential Regulation of Estrogen Receptor α Expression in Breast Cancer Cells by Metastasis-Associated Protein 1 Hyun-Jin Kang1, Min-Ho Lee1, Hae-Lim Kang1, Sung-Hae Kim1, Jung-Ranh Ahn1, Hyelin Na1, Tae-Young Na1, Yona Kim2, Je Kyung Seong2, and Mi-Ock Lee1 1College of Pharmacy and Bio-MAX institute, Research Institute of Pharmaceutical Sciences; and 2College of Veterinary Medicine, BK21 Plus Program for Veterinary Science, Seoul National University, Seoul, Korea; Keywords: Estrogen receptor α; MTA1; IFI16; epigenetics, hormone sensitivity Hyun-Jin Kang, Min-Ho Lee, and Hae-Lim Kang contributed equally to this work. Corresponding Authors: Mi-Ock Lee Ph. D., College of Pharmacy, Seoul National University, 1 Gwanak-ro, Gwanak-gu, Seoul 151-742, Korea. Phone: 82-2-880-9331; Fax: 82-2-887-2692; E-mail: [email protected] Downloaded from cancerres.aacrjournals.org on September 29, 2021. © 2014 American Association for Cancer Research. Author Manuscript Published OnlineFirst on January 10, 2014; DOI: 10.1158/0008-5472.CAN-13-2020 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. ABSTRACT Metastasis-associated protein 1 (MTA1) is a component of the nucleosome remodeling and histone deacetylase (HDAC) complex, which plays an important role in progression of breast cancer. Although MTA1 is known as a repressor of the transactivation function of estrogen receptor (ER)α, its involvement in the epigenetic control of transcription of the ERα gene ESR1 has not been studied.
    [Show full text]
  • PRODUCT SPECIFICATION Prest Antigen PNRC1 Product
    PrEST Antigen PNRC1 Product Datasheet PrEST Antigen PRODUCT SPECIFICATION Product Name PrEST Antigen PNRC1 Product Number APrEST77609 Gene Description proline-rich nuclear receptor coactivator 1 Alternative Gene B4-2, PROL2, PRR2 Names Corresponding Anti-PNRC1 (HPA029839) Antibodies Description Recombinant protein fragment of Human PNRC1 Amino Acid Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: QLVHGIHLYEQPKINRQKSKYNLPLTKITSAKRNENNFWQDSVSSDRIQK QEKKPFKNTENIKNSHLKKSAFLTEVSQKENYAGAKFSDPPSPSVLPK Fusion Tag N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) Expression Host E. coli Purification IMAC purification Predicted MW 29 kDa including tags Usage Suitable as control in WB and preadsorption assays using indicated corresponding antibodies. Purity >80% by SDS-PAGE and Coomassie blue staining Buffer PBS and 1M Urea, pH 7.4. Unit Size 100 µl Concentration Lot dependent Storage Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. Atlas Antibodies AB's sole liability is limited to replacement of the product or refund of the purchase price.
    [Show full text]
  • Molecular Interactions Underpinning the Phenotype of Hibernation in Mammals Matthew T
    © 2019. Published by The Company of Biologists Ltd | Journal of Experimental Biology (2019) 222, jeb160606. doi:10.1242/jeb.160606 REVIEW Molecular interactions underpinning the phenotype of hibernation in mammals Matthew T. Andrews* ABSTRACT most mammals. This Review covers recent advances in the Mammals maintain a constant warm body temperature, facilitating a molecular biology of hibernation, with a focus on molecular wide variety of metabolic reactions. Mammals that hibernate have the interactions underpinning the hibernation phenotype. Specific – ability to slow their metabolism, which in turn reduces their body topics include the torpor arousal cycle, the role of small temperature and leads to a state of hypothermic torpor. For this molecules, changes in gene expression, cold-inducible RNA- metabolic rate reduction to occur on a whole-body scale, molecular binding proteins, the somatosensory system and emerging interactions that change the physiology of cells, tissues and organs information on hibernating primates. This new information not are required, resulting in a major departure from normal mammalian only is beginning to explain how natural hibernators survive homeostasis. The aim of this Review is to cover recent advances in the physiological extremes that would be lethal to most mammals, but molecular biology of mammalian hibernation, including the role of also identifies molecular mechanisms that may prove useful to small molecules, seasonal changes in gene expression, cold- human medicine. inducible RNA-binding proteins,
    [Show full text]
  • Expression Analysis of Genes Located Within the Common Deleted Region
    Leukemia Research 84 (2019) 106175 Contents lists available at ScienceDirect Leukemia Research journal homepage: www.elsevier.com/locate/leukres Research paper Expression analysis of genes located within the common deleted region of del(20q) in patients with myelodysplastic syndromes T ⁎ Masayuki Shiseki , Mayuko Ishii, Michiko Okada, Mari Ohwashi, Yan-Hua Wang, Satoko Osanai, Kentaro Yoshinaga, Naoki Mori, Toshiko Motoji, Junji Tanaka Department of Hematology, Tokyo Women’s Medical University, 8-1 Kawada-cho, Shinjuku-ku, Tokyo, 162-8666, Japan ARTICLE INFO ABSTRACT Keywords: Deletion of the long arm of chromosome 20 (del(20q)) is observed in 5–10% of patients with myelodysplastic Deletion 20q syndromes (MDS). We examined the expression of 28 genes within the common deleted region (CDR) of del Common deleted region (20q), which we previously determined by a CGH array using clinical samples, in 48 MDS patients with (n = 28) Myelodysplastic syndromes or without (n = 20) chromosome 20 abnormalities and control subjects (n = 10). The expression level of 8 of 28 genes was significantly reduced in MDS patients with chromosome 20 abnormalities compared to that of control subjects. In addition, the expression of BCAS4, ADA, and YWHAB genes was significantly reduced in MDS pa- tients without chromosome 20 abnormalities, which suggests that these three genes were commonly involved in the molecular pathogenesis of MDS. To evaluate the clinical significance, we analyzed the impact of the ex- pression level of each gene on overall survival (OS). According to the Cox proportional hazard model, multi- variate analysis indicated that reduced BCAS4 expression was associated with inferior OS, but the difference was not significant (HR, 3.77; 95% CI, 0.995-17.17; P = 0.0509).
    [Show full text]
  • Bioinformatics Analysis for the Identification of Differentially Expressed Genes and Related Signaling Pathways in H
    Bioinformatics analysis for the identification of differentially expressed genes and related signaling pathways in H. pylori-CagA transfected gastric cancer cells Dingyu Chen*, Chao Li, Yan Zhao, Jianjiang Zhou, Qinrong Wang and Yuan Xie* Key Laboratory of Endemic and Ethnic Diseases , Ministry of Education, Guizhou Medical University, Guiyang, China * These authors contributed equally to this work. ABSTRACT Aim. Helicobacter pylori cytotoxin-associated protein A (CagA) is an important vir- ulence factor known to induce gastric cancer development. However, the cause and the underlying molecular events of CagA induction remain unclear. Here, we applied integrated bioinformatics to identify the key genes involved in the process of CagA- induced gastric epithelial cell inflammation and can ceration to comprehend the potential molecular mechanisms involved. Materials and Methods. AGS cells were transected with pcDNA3.1 and pcDNA3.1::CagA for 24 h. The transfected cells were subjected to transcriptome sequencing to obtain the expressed genes. Differentially expressed genes (DEG) with adjusted P value < 0.05, | logFC |> 2 were screened, and the R package was applied for gene ontology (GO) enrichment and the Kyoto Encyclopedia of Genes and Genomes (KEGG) pathway analysis. The differential gene protein–protein interaction (PPI) network was constructed using the STRING Cytoscape application, which conducted visual analysis to create the key function networks and identify the key genes. Next, the Submitted 20 August 2020 Kaplan–Meier plotter survival analysis tool was employed to analyze the survival of the Accepted 11 March 2021 key genes derived from the PPI network. Further analysis of the key gene expressions Published 15 April 2021 in gastric cancer and normal tissues were performed based on The Cancer Genome Corresponding author Atlas (TCGA) database and RT-qPCR verification.
    [Show full text]
  • A Peripheral Blood Gene Expression Signature to Diagnose Subclinical Acute Rejection
    CLINICAL RESEARCH www.jasn.org A Peripheral Blood Gene Expression Signature to Diagnose Subclinical Acute Rejection Weijia Zhang,1 Zhengzi Yi,1 Karen L. Keung,2 Huimin Shang,3 Chengguo Wei,1 Paolo Cravedi,1 Zeguo Sun,1 Caixia Xi,1 Christopher Woytovich,1 Samira Farouk,1 Weiqing Huang,1 Khadija Banu,1 Lorenzo Gallon,4 Ciara N. Magee,5 Nader Najafian,5 Milagros Samaniego,6 Arjang Djamali ,7 Stephen I. Alexander,2 Ivy A. Rosales,8 Rex Neal Smith,8 Jenny Xiang,3 Evelyne Lerut,9 Dirk Kuypers,10,11 Maarten Naesens ,10,11 Philip J. O’Connell,2 Robert Colvin,8 Madhav C. Menon,1 and Barbara Murphy1 Due to the number of contributing authors, the affiliations are listed at the end of this article. ABSTRACT Background In kidney transplant recipients, surveillance biopsies can reveal, despite stable graft function, histologic features of acute rejection and borderline changes that are associated with undesirable graft outcomes. Noninvasive biomarkers of subclinical acute rejection are needed to avoid the risks and costs associated with repeated biopsies. Methods We examined subclinical histologic and functional changes in kidney transplant recipients from the prospective Genomics of Chronic Allograft Rejection (GoCAR) study who underwent surveillance biopsies over 2 years, identifying those with subclinical or borderline acute cellular rejection (ACR) at 3 months (ACR-3) post-transplant. We performed RNA sequencing on whole blood collected from 88 indi- viduals at the time of 3-month surveillance biopsy to identify transcripts associated with ACR-3, developed a novel sequencing-based targeted expression assay, and validated this gene signature in an independent cohort.
    [Show full text]
  • Supp Table 6.Pdf
    Supplementary Table 6. Processes associated to the 2037 SCL candidate target genes ID Symbol Entrez Gene Name Process NM_178114 AMIGO2 adhesion molecule with Ig-like domain 2 adhesion NM_033474 ARVCF armadillo repeat gene deletes in velocardiofacial syndrome adhesion NM_027060 BTBD9 BTB (POZ) domain containing 9 adhesion NM_001039149 CD226 CD226 molecule adhesion NM_010581 CD47 CD47 molecule adhesion NM_023370 CDH23 cadherin-like 23 adhesion NM_207298 CERCAM cerebral endothelial cell adhesion molecule adhesion NM_021719 CLDN15 claudin 15 adhesion NM_009902 CLDN3 claudin 3 adhesion NM_008779 CNTN3 contactin 3 (plasmacytoma associated) adhesion NM_015734 COL5A1 collagen, type V, alpha 1 adhesion NM_007803 CTTN cortactin adhesion NM_009142 CX3CL1 chemokine (C-X3-C motif) ligand 1 adhesion NM_031174 DSCAM Down syndrome cell adhesion molecule adhesion NM_145158 EMILIN2 elastin microfibril interfacer 2 adhesion NM_001081286 FAT1 FAT tumor suppressor homolog 1 (Drosophila) adhesion NM_001080814 FAT3 FAT tumor suppressor homolog 3 (Drosophila) adhesion NM_153795 FERMT3 fermitin family homolog 3 (Drosophila) adhesion NM_010494 ICAM2 intercellular adhesion molecule 2 adhesion NM_023892 ICAM4 (includes EG:3386) intercellular adhesion molecule 4 (Landsteiner-Wiener blood group)adhesion NM_001001979 MEGF10 multiple EGF-like-domains 10 adhesion NM_172522 MEGF11 multiple EGF-like-domains 11 adhesion NM_010739 MUC13 mucin 13, cell surface associated adhesion NM_013610 NINJ1 ninjurin 1 adhesion NM_016718 NINJ2 ninjurin 2 adhesion NM_172932 NLGN3 neuroligin
    [Show full text]
  • Integrative Clinical Sequencing in the Management of Refractory Or
    Supplementary Online Content Mody RJ, Wu Y-M, Lonigro RJ, et al. Integrative Clinical Sequencing in the Management of Children and Young Adults With Refractory or Relapsed CancerJAMA. doi:10.1001/jama.2015.10080. eAppendix. Supplementary appendix This supplementary material has been provided by the authors to give readers additional information about their work. © 2015 American Medical Association. All rights reserved. Downloaded From: https://jamanetwork.com/ on 09/29/2021 SUPPLEMENTARY APPENDIX Use of Integrative Clinical Sequencing in the Management of Pediatric Cancer Patients *#Rajen J. Mody, M.B.B.S, M.S., *Yi-Mi Wu, Ph.D., Robert J. Lonigro, M.S., Xuhong Cao, M.S., Sameek Roychowdhury, M.D., Ph.D., Pankaj Vats, M.S., Kevin M. Frank, M.S., John R. Prensner, M.D., Ph.D., Irfan Asangani, Ph.D., Nallasivam Palanisamy Ph.D. , Raja M. Rabah, M.D., Jonathan R. Dillman, M.D., Laxmi Priya Kunju, M.D., Jessica Everett, M.S., Victoria M. Raymond, M.S., Yu Ning, M.S., Fengyun Su, Ph.D., Rui Wang, M.S., Elena M. Stoffel, M.D., Jeffrey W. Innis, M.D., Ph.D., J. Scott Roberts, Ph.D., Patricia L. Robertson, M.D., Gregory Yanik, M.D., Aghiad Chamdin, M.D., James A. Connelly, M.D., Sung Choi, M.D., Andrew C. Harris, M.D., Carrie Kitko, M.D., Rama Jasty Rao, M.D., John E. Levine, M.D., Valerie P. Castle, M.D., Raymond J. Hutchinson, M.D., Moshe Talpaz, M.D., ^Dan R. Robinson, Ph.D., and ^#Arul M. Chinnaiyan, M.D., Ph.D. CORRESPONDING AUTHOR (S): # Arul M.
    [Show full text]
  • Human Induced Pluripotent Stem Cell–Derived Podocytes Mature Into Vascularized Glomeruli Upon Experimental Transplantation
    BASIC RESEARCH www.jasn.org Human Induced Pluripotent Stem Cell–Derived Podocytes Mature into Vascularized Glomeruli upon Experimental Transplantation † Sazia Sharmin,* Atsuhiro Taguchi,* Yusuke Kaku,* Yasuhiro Yoshimura,* Tomoko Ohmori,* ‡ † ‡ Tetsushi Sakuma, Masashi Mukoyama, Takashi Yamamoto, Hidetake Kurihara,§ and | Ryuichi Nishinakamura* *Department of Kidney Development, Institute of Molecular Embryology and Genetics, and †Department of Nephrology, Faculty of Life Sciences, Kumamoto University, Kumamoto, Japan; ‡Department of Mathematical and Life Sciences, Graduate School of Science, Hiroshima University, Hiroshima, Japan; §Division of Anatomy, Juntendo University School of Medicine, Tokyo, Japan; and |Japan Science and Technology Agency, CREST, Kumamoto, Japan ABSTRACT Glomerular podocytes express proteins, such as nephrin, that constitute the slit diaphragm, thereby contributing to the filtration process in the kidney. Glomerular development has been analyzed mainly in mice, whereas analysis of human kidney development has been minimal because of limited access to embryonic kidneys. We previously reported the induction of three-dimensional primordial glomeruli from human induced pluripotent stem (iPS) cells. Here, using transcription activator–like effector nuclease-mediated homologous recombination, we generated human iPS cell lines that express green fluorescent protein (GFP) in the NPHS1 locus, which encodes nephrin, and we show that GFP expression facilitated accurate visualization of nephrin-positive podocyte formation in
    [Show full text]