A Sequence Alignment and Analysis of SARS-Cov-2 Spike Glycoprotein
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
T-Coffee Documentation Release Version 13.45.47.Aba98c5
T-Coffee Documentation Release Version_13.45.47.aba98c5 Cedric Notredame Aug 31, 2021 Contents 1 T-Coffee Installation 3 1.1 Installation................................................3 1.1.1 Unix/Linux Binaries......................................4 1.1.2 MacOS Binaries - Updated...................................4 1.1.3 Installation From Source/Binaries downloader (Mac OSX/Linux)...............4 1.2 Template based modes: PSI/TM-Coffee and Expresso.........................5 1.2.1 Why do I need BLAST with T-Coffee?.............................6 1.2.2 Using a BLAST local version on Unix.............................6 1.2.3 Using the EBI BLAST client..................................6 1.2.4 Using the NCBI BLAST client.................................7 1.2.5 Using another client.......................................7 1.3 Troubleshooting.............................................7 1.3.1 Third party packages......................................7 1.3.2 M-Coffee parameters......................................9 1.3.3 Structural modes (using PDB)................................. 10 1.3.4 R-Coffee associated packages................................. 10 2 Quick Start Regressive Algorithm 11 2.1 Introduction............................................... 11 2.2 Installation from source......................................... 12 2.3 Examples................................................. 12 2.3.1 Fast and accurate........................................ 12 2.3.2 Slower and more accurate.................................... 12 2.3.3 Very Fast........................................... -
How to Generate a Publication-Quality Multiple Sequence Alignment (Thomas Weimbs, University of California Santa Barbara, 11/2012)
Tutorial: How to generate a publication-quality multiple sequence alignment (Thomas Weimbs, University of California Santa Barbara, 11/2012) 1) Get your sequences in FASTA format: • Go to the NCBI website; find your sequences and display them in FASTA format. Each sequence should look like this (http://www.ncbi.nlm.nih.gov/protein/6678177?report=fasta): >gi|6678177|ref|NP_033320.1| syntaxin-4 [Mus musculus] MRDRTHELRQGDNISDDEDEVRVALVVHSGAARLGSPDDEFFQKVQTIRQTMAKLESKVRELEKQQVTIL ATPLPEESMKQGLQNLREEIKQLGREVRAQLKAIEPQKEEADENYNSVNTRMKKTQHGVLSQQFVELINK CNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEI QQLERSIRELHEIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKIALENQKKARKKKVMIAICV SVTVLILAVIIGITITVG 2) In a text editor, paste all your sequences together (in the order that you would like them to appear in the end). It should look like this: >gi|6678177|ref|NP_033320.1| syntaxin-4 [Mus musculus] MRDRTHELRQGDNISDDEDEVRVALVVHSGAARLGSPDDEFFQKVQTIRQTMAKLESKVRELEKQQVTIL ATPLPEESMKQGLQNLREEIKQLGREVRAQLKAIEPQKEEADENYNSVNTRMKKTQHGVLSQQFVELINK CNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEI QQLERSIRELHEIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKIALENQKKARKKKVMIAICV SVTVLILAVIIGITITVG >gi|151554658|gb|AAI47965.1| STX3 protein [Bos taurus] MKDRLEQLKAKQLTQDDDTDEVEIAVDNTAFMDEFFSEIEETRVNIDKISEHVEEAKRLYSVILSAPIPE PKTKDDLEQLTTEIKKRANNVRNKLKSMERHIEEDEVQSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVD FRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSGIIDSQISKQALSEIEGRHKDIVRLESSIKE LHDMFMDIAMLVENQGEMLDNIELNVMHTVDHVEKAREETKRAVKYQGQARKKLVIIIVIVVVLLGILAL IIGLSVGLK -
Bioinformatics Study of Lectins: New Classification and Prediction In
Bioinformatics study of lectins : new classification and prediction in genomes François Bonnardel To cite this version: François Bonnardel. Bioinformatics study of lectins : new classification and prediction in genomes. Structural Biology [q-bio.BM]. Université Grenoble Alpes [2020-..]; Université de Genève, 2021. En- glish. NNT : 2021GRALV010. tel-03331649 HAL Id: tel-03331649 https://tel.archives-ouvertes.fr/tel-03331649 Submitted on 2 Sep 2021 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. THÈSE Pour obtenir le grade de DOCTEUR DE L’UNIVERSITE GRENOBLE ALPES préparée dans le cadre d’une cotutelle entre la Communauté Université Grenoble Alpes et l’Université de Genève Spécialités: Chimie Biologie Arrêté ministériel : le 6 janvier 2005 – 25 mai 2016 Présentée par François Bonnardel Thèse dirigée par la Dr. Anne Imberty codirigée par la Dr/Prof. Frédérique Lisacek préparée au sein du laboratoire CERMAV, CNRS et du Computer Science Department, UNIGE et de l’équipe PIG, SIB Dans les Écoles Doctorales EDCSV et UNIGE Etude bioinformatique des lectines: nouvelle classification et prédiction dans les génomes Thèse soutenue publiquement le 8 Février 2021, devant le jury composé de : Dr. Alexandre de Brevern UMR S1134, Inserm, Université Paris Diderot, Paris, France, Rapporteur Dr. -
Introduction to Linux for Bioinformatics – Part II Paul Stothard, 2006-09-20
Introduction to Linux for bioinformatics – part II Paul Stothard, 2006-09-20 In the previous guide you learned how to log in to a Linux account, and you were introduced to some basic Linux commands. This section covers some more advanced commands and features of the Linux operating system. It also introduces some command-line bioinformatics programs. One important aspect of using a Linux system from a Windows or Mac environment that was not discussed in the previous section is how to transfer files between computers. For example, you may have a collection of sequence records on your Windows desktop that you wish to analyze using a Linux command-line program. Alternatively, you may want to transfer some sequence analysis results from a Linux system to your Mac so that you can add them to a PowerPoint presentation. Transferring files between Mac OS X and Linux Recall that Mac OS X includes a Terminal application (located in the Applications >> Utilities folder), which can be used to log in to other systems. This terminal can also be used to transfer files, thanks to the scp command. Try transferring a file from your Mac to your Linux account using the Terminal application: 1. Launch the Terminal program. 2. Instead of logging in to your Linux account, use the same basic commands you learned in the previous section (pwd, ls, and cd) to navigate your Mac file system. 3. Switch to your home directory on the Mac using the command cd ~ 4. Create a text file containing your home directory listing using ls -l > myfiles.txt 5. -
Trichoderma Reesei Complete Genome Sequence, Repeat-Induced Point
Li et al. Biotechnol Biofuels (2017) 10:170 DOI 10.1186/s13068-017-0825-x Biotechnology for Biofuels RESEARCH Open Access Trichoderma reesei complete genome sequence, repeat‑induced point mutation, and partitioning of CAZyme gene clusters Wan‑Chen Li1,2,3†, Chien‑Hao Huang3,4†, Chia‑Ling Chen3, Yu‑Chien Chuang3, Shu‑Yun Tung3 and Ting‑Fang Wang1,3* Abstract Background: Trichoderma reesei (Ascomycota, Pezizomycotina) QM6a is a model fungus for a broad spectrum of physiological phenomena, including plant cell wall degradation, industrial production of enzymes, light responses, conidiation, sexual development, polyketide biosynthesis, and plant–fungal interactions. The genomes of QM6a and its high enzyme-producing mutants have been sequenced by second-generation-sequencing methods and are pub‑ licly available from the Joint Genome Institute. While these genome sequences have ofered useful information for genomic and transcriptomic studies, their limitations and especially their short read lengths make them poorly suited for some particular biological problems, including assembly, genome-wide determination of chromosome architec‑ ture, and genetic modifcation or engineering. Results: We integrated Pacifc Biosciences and Illumina sequencing platforms for the highest-quality genome assem‑ bly yet achieved, revealing seven telomere-to-telomere chromosomes (34,922,528 bp; 10877 genes) with 1630 newly predicted genes and >1.5 Mb of new sequences. Most new sequences are located on AT-rich blocks, including 7 centromeres, 14 subtelomeres, and 2329 interspersed AT-rich blocks. The seven QM6a centromeres separately consist of 24 conserved repeats and 37 putative centromere-encoded genes. These fndings open up a new perspective for future centromere and chromosome architecture studies. -
Introduction to Bioinformatics (Elective) – SBB1609
SCHOOL OF BIO AND CHEMICAL ENGINEERING DEPARTMENT OF BIOTECHNOLOGY Unit 1 – Introduction to Bioinformatics (Elective) – SBB1609 1 I HISTORY OF BIOINFORMATICS Bioinformatics is an interdisciplinary field that develops methods and software tools for understanding biologicaldata. As an interdisciplinary field of science, bioinformatics combines computer science, statistics, mathematics, and engineering to analyze and interpret biological data. Bioinformatics has been used for in silico analyses of biological queries using mathematical and statistical techniques. Bioinformatics derives knowledge from computer analysis of biological data. These can consist of the information stored in the genetic code, but also experimental results from various sources, patient statistics, and scientific literature. Research in bioinformatics includes method development for storage, retrieval, and analysis of the data. Bioinformatics is a rapidly developing branch of biology and is highly interdisciplinary, using techniques and concepts from informatics, statistics, mathematics, chemistry, biochemistry, physics, and linguistics. It has many practical applications in different areas of biology and medicine. Bioinformatics: Research, development, or application of computational tools and approaches for expanding the use of biological, medical, behavioral or health data, including those to acquire, store, organize, archive, analyze, or visualize such data. Computational Biology: The development and application of data-analytical and theoretical methods, mathematical modeling and computational simulation techniques to the study of biological, behavioral, and social systems. "Classical" bioinformatics: "The mathematical, statistical and computing methods that aim to solve biological problems using DNA and amino acid sequences and related information.” The National Center for Biotechnology Information (NCBI 2001) defines bioinformatics as: "Bioinformatics is the field of science in which biology, computer science, and information technology merge into a single discipline. -
A Comprehensive Review and Performance Evaluation of Sequence Alignment Algorithms for DNA Sequences
International Journal of Advanced Science and Technology Vol. 29, No. 3, (2020), pp. 11251 - 11265 A Comprehensive Review and Performance Evaluation of Sequence Alignment Algorithms for DNA Sequences Neelofar Sohi1 and Amardeep Singh2 1Assistant Professor, Department of Computer Science & Engineering, Punjabi University Patiala, Punjab, India 2Professor, Department of Computer Science & Engineering, Punjabi University Patiala, Punjab, India [email protected],[email protected] Abstract Background: Sequence alignment is very important step for high level sequence analysis applications in the area of biocomputing. Alignment of DNA sequences helps in finding origin of sequences, homology between sequences, constructing phylogenetic trees depicting evolutionary relationships and other tasks. It helps in identifying genetic variations in DNA sequences which might lead to diseases. Objectives: This paper presents a comprehensive review on sequence alignment approaches, methods and various state-of-the-art algorithms. Performance evaluation and comparison of few algorithms and tools is performed. Methods and Results: In this study, various tools and algorithms are studied, implemented and their performance is evaluated and compared using Identity Percentage is used as the main metric. Conclusion: It is observed that for pairwise sequence alignment, Clustal Omega Emboss Matcher outperforms other tools & algorithms followed by Clustal Omega Emboss Water further followed by Blast (Needleman-Wunsch algorithm for global alignment). Keywords: sequence alignment; DNA sequences; progressive alignment; iterative alignment; natural computing approach; identity percentage. 1. Brief History Sequence alignment is very important area in the field of Biocomputing and Bioinformatics. Sequence alignment aims to identify the regions of similarity between two or more sequences. Alignment is also termed as ‘mapping’ that is done to identify and compare the nucleotide bases i.e. -
GPS@: Bioinformatics Grid Portal for Protein Sequence Analysis on EGEE Grid
Enabling Grids for E-sciencE GPS@: Bioinformatics grid portal for protein sequence analysis on EGEE grid Blanchet, C., Combet, C., Lefort, V. and Deleage, G. Pôle BioInformatique de Lyon – PBIL Institut de Biologie et Chimie des Protéines IBCP – CNRS UMR 5086 Lyon-Gerland, France [email protected] www.eu-egee.org INFSO-RI-508833 TOC Enabling Grids for E-sciencE • NPS@ Web portal – Online since 1998 – Production mode • Gridification of NPS@ • Bioinformatics description with XML-based Framework • Legacy mode for application file access • GPS@ Web portal for Bioinformatics on Grid INFSO-RI-508833 GPS@ Bioinformatics Grid Portal, EGEE User Forum, March 1st, 2006, Cern 2 Institute of Biology and Enabling Grids for E-sciencE Chemistry of Proteins • French CNRS Institute, associated to Univ. Lyon1 – Life Science – About 160 people – http://www.ibcp.fr – Located in Lyon, France • Study of proteins in their biological context ♣ Approaches used include integrative cellular (cell culture, various types of microscopies) and molecular techniques, both experimental (including biocrystallography and nuclear magnetic resonance) and theoretical (structural bioinformatics). • Three main departments, bringing together 13 groups ♣ topics such as cancer, extracellular matrix, tissue engineering, membranes, cell transport and signalling, bioinformatics and structural biology INFSO-RI-508833 GPS@ Bioinformatics Grid Portal, EGEE User Forum, March 1st, 2006, Cern 3 EGEE Biomedical Activity Enabling Grids for E-sciencE • Chair: ♣ Johan Montagnat ♣ Christophe -
A Tool to Sanity Check and If Needed Reformat FASTA Files
bioRxiv preprint doi: https://doi.org/10.1101/024448; this version posted August 13, 2015. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. Fasta-O-Matic: a tool to sanity check and if needed reformat FASTA files Jennifer Shelton Kansas State University August 11, 2015 Abstract As the shear volume of bioinformatic sequence data increases the only way to take advantage of this content is to more completely automate ro- bust analysis workflows. Analysis bottlenecks are often mundane and overlooked processing steps. Idiosyncrasies in reading and/or writing bioinformatics file formats can halt or impair analysis workflows by in- terfering with the transfer of data from one informatics tools to another. Fasta-O-Matic automates handling of common but minor format issues that otherwise may halt pipelines. The need for automation must be balanced by the need for manual confirmation that any formatting error is actually minor rather than indicative of a corrupt data file. To that end Fasta-O-Matic reports any issues detected to the user with optionally color coded and quiet or verbose logs. Fasta-O-Matic can be used as a general pre-processing tool in bioin- formatics workflows (e.g. to automatically wrap FASTA files so that they can be read by BioPerl). It was also developed as a sanity check for bioinformatic core facilities that tend to repeat common analysis steps on FASTA files received from disparate sources. -
A Tool to Sanity Check and If Needed Reformat FASTA Files
ManuscriptbioRxiv preprint doi: https://doi.org/10.1101/024448; this version posted August 21, 2015. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under Click here to download Manuscript: bmc_article.tex aCC-BY 4.0 International license. Click here to view linked References Shelton and Brown 1 2 3 4 5 RESEARCH 6 7 8 9 Fasta-O-Matic: a tool to sanity check and if 10 11 needed reformat FASTA files 12 13 Jennifer M Shelton1 and Susan J Brown1* 14 15 *Correspondence: [email protected] 16 1KSU/K-INBRE Bioinformatics Abstract 17 Center, Division of Biology, 18 Kansas State University, Background: As the sheer volume of bioinformatic sequence data increases, the 19 Manhattan, KS, USA only way to take advantage of this content is to more completely automate Full list of author information is 20 available at the end of the article robust analysis workflows. Analysis bottlenecks are often mundane and 21 overlooked processing steps. Idiosyncrasies in reading and/or writing 22 bioinformatics file formats can halt or impair analysis workflows by interfering 23 with the transfer of data from one informatics tools to another. 24 Results: Fasta-O-Matic automates handling of common but minor formatissues 25 that otherwise may halt pipelines. The need for automation must be balanced by 26 the need for manual confirmation that any formatting error is actually minor 27 28 rather than indicative of a corrupt data file. -
Software List for Biology, Bioinformatics and Biostatistics CCT
Software List for biology, bioinformatics and biostatistics v CCT - Delta Software Version Application short read assembler and it works on both small and large (mammalian size) ALLPATHS-LG 52488 genomes provides a fast, flexible C++ API & toolkit for reading, writing, and manipulating BAMtools 2.4.0 BAM files a high level of alignment fidelity and is comparable to other mainstream Barracuda 0.7.107b alignment programs allows one to intersect, merge, count, complement, and shuffle genomic bedtools 2.25.0 intervals from multiple files Bfast 0.7.0a universal DNA sequence aligner tool analysis and comprehension of high-throughput genomic data using the R Bioconductor 3.2 statistical programming BioPython 1.66 tools for biological computation written in Python a fast approach to detecting gene-gene interactions in genome-wide case- Boost 1.54.0 control studies short read aligner geared toward quickly aligning large sets of short DNA Bowtie 1.1.2 sequences to large genomes Bowtie2 2.2.6 Bowtie + fully supports gapped alignment with affine gap penalties BWA 0.7.12 mapping low-divergent sequences against a large reference genome ClustalW 2.1 multiple sequence alignment program to align DNA and protein sequences assembles transcripts, estimates their abundances for differential expression Cufflinks 2.2.1 and regulation in RNA-Seq samples EBSEQ (R) 1.10.0 identifying genes and isoforms differentially expressed EMBOSS 6.5.7 a comprehensive set of sequence analysis programs FASTA 36.3.8b a DNA and protein sequence alignment software package FastQC -
The FASTA Program Package Introduction
fasta-36.3.8 December 4, 2020 The FASTA program package Introduction This documentation describes the version 36 of the FASTA program package (see W. R. Pearson and D. J. Lipman (1988), “Improved Tools for Biological Sequence Analysis”, PNAS 85:2444-2448, [17] W. R. Pearson (1996) “Effective protein sequence comparison” Meth. Enzymol. 266:227- 258 [15]; and Pearson et. al. (1997) Genomics 46:24-36 [18]. Version 3 of the FASTA packages contains many programs for searching DNA and protein databases and for evaluating statistical significance from randomly shuffled sequences. This document is divided into four sections: (1) A summary overview of the programs in the FASTA3 package; (2) A guide to using the FASTA programs; (3) A guide to installing the programs and databases. Section (4) provides answers to some Frequently Asked Questions (FAQs). In addition to this document, the changes v36.html, changes v35.html and changes v34.html files list functional changes to the programs. The readme.v30..v36 files provide a more complete revision history of the programs, including bug fixes. The programs are easy to use; if you are using them on a machine that is administered by someone else, you can focus on sections (1) and (2) to learn how to use the programs. If you are installing the programs on your own machine, you will need to read section (3) carefully. FASTA and BLAST – FASTA and BLAST have the same goal: to identify statistically signifi- cant sequence similarity that can be used to infer homology. The FASTA programs offer several advantages over BLAST: 1.