DOCSLIB.ORG

Generating and Characterising Knockout and Transgenic Mouse Models of Frontotemporal Dementia Caused by CHMP2B Mutation

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Generating and Characterising Knockout and Transgenic Mouse Models of Frontotemporal Dementia Caused by CHMP2B Mutation Generating and Characterising Knockout and Transgenic Mouse Models of Frontotemporal Dementia Caused by CHMP2B Mutation This thesis is submitted in fulfilment of the requirements for the degree of Doctor of Philosophy to University College London By Shabnam Ghazi-Noori MRC Prion Unit and Department of Neurodegenerative Disease Institute of Neurology University College London Declaration I hereby declare that this thesis is my work and effort, and that it has not been submitted anywhere for any award. Wherever contributions of others are involved, every effort is made to indicate this clearly, with due reference to the literature, and acknowledgement of collaborative research and discussions. 2 Abstract A mutation in the charged multivesicular body protein 2B (CHMP2B) gene, identified in a kindred from the Jutland region of Denmark, segregates with affected family members with clinical presentations of frontotemporal dementia (FTD) and is absent in control populations (Gydesen et al., 1987; Gydesen et al., 2002; Skibinski et al., 2005). The mutation is a G>C transition in the splice acceptor site of exon 6 resulting in two novel splice variants CHMP2BInt5 and CHMP2B10 leading to C-terminal truncation of the CHMP2B protein (Skibinski et al., 2005). Chmp2b knockout (Chmp2b-/-) mice and transgenic mice expressing either wild-type or C-terminally truncated mutant CHMP2B splice variants CHMP2BInt5 and CHMP2B10 were generated with the aims of examining the normal function of Chmp2b and the effect of mutant CHMP2B species in vivo, as well as providing insight into a potential common FTD mechanism of disease. Quantification of Chmp2b protein in Chmp2b-/- mice demonstrates a significant (85%) depletion of endogenous Chmp2b in the mouse brain. No pathology is identified in the CNS or muscle tissue of these mice however, they do demonstrate significant motor and behavioural abnormalities. CHMP2BInt5 transgenic mice demonstrate neurodegenerative changes including progressive gliosis, accumulation of CHMP2B, p62 and ubiquitin inclusions which are negative for TDP-43 and FUS proteins, consistent with the inclusion pathology observed in patients with CHMP2B mutation. Furthermore, these mice have reduced survival and develop progressive axonopathy characterized by axonal swellings and accumulation of mitochondria and vesicles likely from the endosome- lysosome and autophagy pathway, implicating altered axonal function in disease pathogenesis. This thesis describes the first mouse models of FTD-3 caused by CHMP2B mutation and presents evidence consistent with a gain-of-function effect unique to the CHMP2BInt5 isoform and provides new insights into the mechanisms of CHMP2B- induced neurodegeneration. 3 Table of contents Declaration ----------------------------------------------------------------------------------------------------------------------- 2 Abstract --------------------------------------------------------------------------------------------------------------------------- 3 List of tables-------------------------------------------------------------------------------------------------------------------- 10 List of figures ------------------------------------------------------------------------------------------------------------------ 11 List of film clips ---------------------------------------------------------------------------------------------------------------- 15 Abbreviations ------------------------------------------------------------------------------------------------------------------ 16 Antigen retrieval abbreviations ------------------------------------------------------------------------------------------ 18 Researcher initials ------------------------------------------------------------------------------------------------------------ 18 Dedication ---------------------------------------------------------------------------------------------------------------------- 19 Acknowledgments ----------------------------------------------------------------------------------------------------------- 20 1 Introduction ------------------------------------------------------------------------------------------------------------ 21 1.1 Project Overview -------------------------------------------------------------------------------------------------- 21 1.1.1 A brief history of clinical understanding of FTD -------------------------------------------------- 21 1.1.2 Frontotemporal dementia linked to chromosome 3 in a Danish family- Historical perspectives ------------------------------------------------------------------------------------------------------------ 24 1.2 Clinical Presentation and Classification --------------------------------------------------------------------- 27 1.2.1 Behavioural variant frontotemporal dementia --------------------------------------------------- 29 1.2.2 Semantic dementia --------------------------------------------------------------------------------------- 30 1.2.3 Primary non-fluent aphasia ---------------------------------------------------------------------------- 31 1.3 FTD Clinical Variation -------------------------------------------------------------------------------------------- 32 1.3.1 FTDP-17 ------------------------------------------------------------------------------------------------------ 32 1.3.2 FTD-3 --------------------------------------------------------------------------------------------------------- 32 1.3.3 FTD-MND ---------------------------------------------------------------------------------------------------- 34 1.4 Epidemiology ------------------------------------------------------------------------------------------------------- 35 1.5 Genetics ------------------------------------------------------------------------------------------------------------- 38 4 1.5.1 CHMP2B ----------------------------------------------------------------------------------------------------- 38 1.6 Neuropathology --------------------------------------------------------------------------------------------------- 44 1.6.1 FTLD-tau ----------------------------------------------------------------------------------------------------- 46 1.6.2 FTLD-TDP ---------------------------------------------------------------------------------------------------- 47 1.6.2.1 FTLD-TDP Clinical and Genetic Associations ----------------------------------------------- 48 1.6.3 FTLD-FUS ---------------------------------------------------------------------------------------------------- 49 1.6.4 FTLD-Other ------------------------------------------------------------------------------------------------- 50 1.6.5 FTD-3 Neuropathology ---------------------------------------------------------------------------------- 50 1.7 Endosomal Sorting Complex Required for Transport Proteins and Multivesicular Bodies ---- 53 1.7.1 Human homologues of yeast ESCRT III proteins -------------------------------------------------- 54 1.7.2 Mutant CHMP2B Causes dendritic spine and late endosome pathology ------------------ 56 1.7.3 Mutant CHMP2B impairs the endosome-lysosome pathway --------------------------------- 58 1.7.4 Mutant CHMP2B impairs autophagy ---------------------------------------------------------------- 59 1.8 Mouse Models of FTD -------------------------------------------------------------------------------------------- 61 1.8.1 ESCRT subunit mouse models ------------------------------------------------------------------------- 62 1.8.2 CHMP2B mouse models--------------------------------------------------------------------------------- 64 1.9 Project Aims -------------------------------------------------------------------------------------------------------- 64 2 MATERIALS AND METHODS --------------------------------------------------------------------------------------- 65 2.1 Equipment and Reagents --------------------------------------------------------------------------------------- 65 2.1.1 Equipment -------------------------------------------------------------------------------------------------- 65 2.1.2 Plastic and glassware ------------------------------------------------------------------------------------ 66 2.1.3 Commercial kits ------------------------------------------------------------------------------------------- 66 2.1.4 Antibodies -------------------------------------------------------------------------------------------------- 67 2.1.5 Reagents----------------------------------------------------------------------------------------------------- 71 2.1.6 Prepared solutions---------------------------------------------------------------------------------------- 73 2.2 Mouse Strains ------------------------------------------------------------------------------------------------------ 75 2.2.1 CHMP2B transgenic mouse colony ------------------------------------------------------------------- 75 2.2.2 Chmp2b knockout mouse colony --------------------------------------------------------------------- 75 2.3 Animal Husbandry and Ethical Approval ------------------------------------------------------------------- 75 2.4 Molecular Methods ----------------------------------------------------------------------------------------------- 76 2.4.1 Primer design ---------------------------------------------------------------------------------------------- 76 2.4.1.1 Primer sequences --------------------------------------------------------------------------------- 76 5 2.4.2 Tissue digestion and DNA extraction ---------------------------------------------------------------- 77 2.4.3 RNA extraction and reverse
Load more

Recommended publications
  • Mutations in CHMP2B in Lower Motor Neuron Predominant Amyotrophic Lateral Sclerosis (ALS)
    This is a repository copy of Mutations in CHMP2B in lower motor neuron predominant amyotrophic lateral sclerosis (ALS). White Rose Research Online URL for this paper: http://eprints.whiterose.ac.uk/10846/ Article: Cox, L.E., Ferraiuolo, L., Goodall, E.F. et al. (13 more authors) (2010) Mutations in CHMP2B in lower motor neuron predominant amyotrophic lateral sclerosis (ALS). Plos One, 5 (3). Art no.e9872. ISSN 1932-6203 https://doi.org/10.1371/journal.pone.0009872 Reuse Unless indicated otherwise, fulltext items are protected by copyright with all rights reserved. The copyright exception in section 29 of the Copyright, Designs and Patents Act 1988 allows the making of a single copy solely for the purpose of non-commercial research or private study within the limits of fair dealing. The publisher or other rights-holder may allow further reproduction and re-use of this version - refer to the White Rose Research Online record for this item. Where records identify the publisher as the copyright holder, users can verify any specific terms of use on the publisher’s website. Takedown If you consider content in White Rose Research Online to be in breach of UK law, please notify us by emailing [email protected] including the URL of the record and the reason for the withdrawal request. [email protected] https://eprints.whiterose.ac.uk/ Mutations in CHMP2B in Lower Motor Neuron Predominant Amyotrophic Lateral Sclerosis (ALS) Laura E. Cox1, Laura Ferraiuolo1, Emily F. Goodall1, Paul R. Heath1, Adrian Higginbottom1, Heather Mortiboys1, Hannah C. Hollinger1, Judith A. Hartley1, Alice Brockington1, Christine E.
    [Show full text]
  • Genetic Screen Identifies Serpin5 As a Regulator of the Toll Pathway and CHMP2B Toxicity Associated with Frontotemporal Dementia
    Genetic screen identifies serpin5 as a regulator of the toll pathway and CHMP2B toxicity associated with frontotemporal dementia S. Tariq Ahmada, Sean T. Sweeneyb, Jin-A Leea, Neal T. Sweeneya,c,1, and Fen-Biao Gaoa,c,2 aGladstone Institute of Neurological Disease, San Francisco, CA 94158; bDepartment of Biology, University of York, P.O. Box 373, York YO10 5YW, United Kingdom; and cNeuroscience Graduate Program, University of California, San Francisco, CA 94158 Edited by Yuh Nung Jan, University of California School of Medicine, San Francisco, CA, and approved May 18, 2009 (received for review March 23, 2009) Frontotemporal dementia (FTD) is the most common form of demen- gain-of-function mechanism. However, animal models of FTD3 tia before 60 years of age. Rare pathogenic mutations in CHMP2B, have not been reported, and the signaling pathways that are which encodes a component of the endosomal sorting complex misregulated in vivo remain to be identified. required for transport (ESCRT-III), are associated with FTD linked to In recent years, Drosophila models have been instrumental in chromosome 3 (FTD3). Animal models of FTD3 have not yet been uncovering molecular pathways that contribute to the pathogenesis reported, and what signaling pathways are misregulated by mutant of neurodegenerative diseases (17, 18). In this study, we modeled CHMP2B in vivo is unknown. Here we report the establishment of a the effect of CHMP2B in human FTD3 using a gain-of-function Drosophila model of FTD3 and show the genetic interactions between approach, which is similar to the approach that gives effects in mutant CHMP2B and other components of ESCRT.
    [Show full text]
  • Progranulin Mutations in Dutch Familial Frontotemporal Lobar Degeneration
    European Journal of Human Genetics (2007) 15, 369–374 & 2007 Nature Publishing Group All rights reserved 1018-4813/07 $30.00 www.nature.com/ejhg ARTICLE Progranulin mutations in Dutch familial frontotemporal lobar degeneration Iraad F Bronner1,2,4, Patrizia Rizzu*,1,2,4, Harro Seelaar3, Saskia E van Mil1,2, Burcu Anar1,2, Asma Azmani3, Laura Donker Kaat3, Sonia Rosso3, Peter Heutink1,2 and John C van Swieten3 1Department of Human Genetics, Section Medical Genomics, VU University Medical Center and VU University, Amsterdam, The Netherlands; 2Center for Neurogenomics and Cognitive Research, VU University Medical Center and VU University, Amsterdam, The Netherlands; 3Department of Neurology, Erasmus MC University Medical Center, Rotterdam, The Netherlands Mutations in the progranulin (PGRN) gene have recently been identified in frontotemporal lobar degeneration with ubiquitin inclusions linked to chromosome 17q21. We report here the finding of two novel frameshift mutations and three possible pathogenic missense mutations in the PGRN gene. Furthermore, we determined the frequency of PGRN mutations in familial cases recruited from a large population-based study of frontotemporal lobar degeneration carried out in The Netherlands. European Journal of Human Genetics (2007) 15, 369–374. doi:10.1038/sj.ejhg.5201772; published online 17 January 2007 Keywords: PGRN; FTLD; mutations; neurodegeneration Introduction dentate gyrus of the hippocampus and in the superficial The term frontotemporal lobar degeneration (FTLD) refers layers of the frontal
    [Show full text]
  • CHMP2B Regulates TDP-43 Phosphorylation and Proteotoxicity Via Modulating
    bioRxiv preprint doi: https://doi.org/10.1101/2020.06.04.133546; this version posted June 5, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Linking CHMP2B to pTDP-43 via CK1_Sun et al 1 CHMP2B regulates TDP-43 phosphorylation and proteotoxicity via modulating 2 CK1 turnover independent of the autophagy-lysosomal pathway 3 Xing Sun1,2,5, Xue Deng1,2,5, Rirong Hu1,2, Yongjia Duan1, Kai Zhang1,2, Jihong Cui1, Jiangxia Ni1,2, 4 Qiangqiang Wang1, Yelin Chen1,2, Ang Li3,4*, and Yanshan Fang1,2*. 5 1Interdisciplinary Research Center on Biology and Chemistry, Shanghai Institute of Organic 6 Chemistry, Chinese Academy of Sciences, Shanghai 201210, China 7 2University of Chinese Academy of Sciences, Beijing 100049, China 8 3Guangdong-Hong Kong-Macau Institute of CNS Regeneration, Joint International Research 9 Laboratory of CNS Regeneration Ministry of Education, Jinan University, Guangzhou 510632, 10 China 11 4Guangzhou Regenerative Medicine and Health Guangdong Laboratory, Guangzhou 510005, 12 China 13 5These authors contributed equally 14 *Correspondence to: 15 Ang Li: [email protected] 16 Yanshan Fang: [email protected] 17 Tel: +86-21-6858.2510 18 ORCID: https://orcid.org/0000-0002-4123-0174 19 Short title: Linking CHMP2B to pTDP-43 via CK1 20 Keywords (5~10): ALS, FTD, ESCRT, CHMP2B, TDP-43, phosphorylation, CK1, UPS 21 This PDF file includes: 22 Main text: ~7,500 words (excluding the title page and references) 23 Figures 1 to 6 24 Supplemental Figures S1 to S6 25 Page 1 / 34 bioRxiv preprint doi: https://doi.org/10.1101/2020.06.04.133546; this version posted June 5, 2020.
    [Show full text]
  • Supp Material.Pdf
    Supplementary Information Estrogen-mediated Epigenetic Repression of Large Chromosomal Regions through DNA Looping Pei-Yin Hsu, Hang-Kai Hsu, Gregory A. C. Singer, Pearlly S. Yan, Benjamin A. T. Rodriguez, Joseph C. Liu, Yu-I Weng, Daniel E. Deatherage, Zhong Chen, Julia S. Pereira, Ricardo Lopez, Jose Russo, Qianben Wang, Coral A. Lamartiniere, Kenneth P. Nephew, and Tim H.-M. Huang S1 Method Immunofluorescence staining Approximately 2,000 mammosphere-derived epithelial cells (MDECs) cells seeded collagen I-coated coverslips were fixed with methanol/acetone for 10 min. After blocking with 2.5% bovine serum albumin (Sigma) for 1 hr, these cells were incubated with anti-ESR1 antibody (Santa Cruz) overnight at 4˚C. The corresponding secondary FITC-conjugated antibody was applied followed by DAPI staining (Molecular Probes) for the nuclei. Photographs were captured by Zeiss fluorescence microscopy (Zeiss). The percentages of ESR1 subcellular localization were calculated in ten different optical fields (~10 cells per field) by two independent researchers. References Carroll, J.S., Meyer, C.A., Song, J., Li, W., Geistlinger, T.R., Eeckhoute, J., Brodsky, A.S., Keeton, E.K., Fertuck, K.C., Hall, G.F., et al. 2006. Genome-wide analysis of estrogen receptor binding sites. Nat. Genet. 38: 1289-1297. Neve, R.M., Chin, K., Fridlyand, J., Yeh, J., Baehner, F.L., Fevr, T., Clark, L., Bayani, N., Coppe, J.P., Tong, F., et al. 2006. A collection of breast cancer cell lines for the study of functionally distinct cancer subtypes. Cancer Cell 10: 515-527. S2 Hsu et al. Supplementary Information A Figure S1. Integrative mapping of large genomic regions subjected to ERα-mediated epigenetic repression.
    [Show full text]
  • Association of Imputed Prostate Cancer Transcriptome with Disease Risk Reveals Novel Mechanisms
    Corrected: Author Correction ARTICLE https://doi.org/10.1038/s41467-019-10808-7 OPEN Association of imputed prostate cancer transcriptome with disease risk reveals novel mechanisms Nima C. Emami1,2, Linda Kachuri2, Travis J. Meyers2, Rajdeep Das3,4, Joshua D. Hoffman2, Thomas J. Hoffmann 2,5, Donglei Hu 5,6,7, Jun Shan8, Felix Y. Feng3,4,7, Elad Ziv5,6,7, Stephen K. Van Den Eeden 3,8 & John S. Witte1,2,3,5,7 1234567890():,; Here we train cis-regulatory models of prostate tissue gene expression and impute expression transcriptome-wide for 233,955 European ancestry men (14,616 prostate cancer (PrCa) cases, 219,339 controls) from two large cohorts. Among 12,014 genes evaluated in the UK Biobank, we identify 38 associated with PrCa, many replicating in the Kaiser Permanente RPGEH. We report the association of elevated TMPRSS2 expression with increased PrCa risk (independent of a previously-reported risk variant) and with increased tumoral expression of the TMPRSS2:ERG fusion-oncogene in The Cancer Genome Atlas, suggesting a novel germline-somatic interaction mechanism. Three novel genes, HOXA4, KLK1, and TIMM23, additionally replicate in the RPGEH cohort. Furthermore, 4 genes, MSMB, NCOA4, PCAT1, and PPP1R14A, are associated with PrCa in a trans-ethnic meta-analysis (N = 9117). Many genes exhibit evidence for allele-specific transcriptional activation by PrCa master-regulators (including androgen receptor) in Position Weight Matrix, Chip-Seq, and Hi-C experimental data, suggesting common regulatory mechanisms for the associated genes. 1 Program in Biological and Medical Informatics, University of California San Francisco, San Francisco, CA 94158, USA.
    [Show full text]
  • Frontotemporal Dementia Caused by CHMP2B Mutation Is Characterised by Neuronal Lysosomal Storage Pathology
    Acta Neuropathol (2015) 130:511–523 DOI 10.1007/s00401-015-1475-3 ORIGINAL PAPER Frontotemporal dementia caused by CHMP2B mutation is characterised by neuronal lysosomal storage pathology Emma L. Clayton1 · Sarah Mizielinska1 · James R. Edgar3 · Troels Tolstrup Nielsen4 · Sarah Marshall1 · Frances E. Norona1 · Miranda Robbins1 · Hana Damirji1 · Ida E. Holm5,6 · Peter Johannsen7 · Jørgen E. Nielsen4,7,8 · Emmanuel A. Asante2 · John Collinge1,2 · The FReJA consortium · Adrian M. Isaacs1 Received: 7 July 2015 / Revised: 1 September 2015 / Accepted: 2 September 2015 / Published online: 10 September 2015 © The Author(s) 2015. This article is published with open access at Springerlink.com Abstract Mutations in the charged multivesicular body controls, indicating that they are a specific pathology protein 2B (CHMP2B) cause frontotemporal dementia caused by mutant CHMP2B. Ultrastructural analysis and (FTD). We report that mice which express FTD-causative immuno-gold labelling confirmed that they are derived mutant CHMP2B at physiological levels develop a novel from the endolysosomal system. Consistent with these lysosomal storage pathology characterised by large neu- findings, CHMP2B mutation patient brains contain mor- ronal autofluorescent aggregates. The aggregates are an phologically similar autofluorescent aggregates. These early and progressive pathology that occur at 3 months aggregates occur significantly more frequently in human of age and increase in both size and number over time. CHMP2B mutation brain than in neurodegenerative disease These autofluorescent aggregates are not observed in or age-matched control brains. These data suggest that lys- mice expressing wild-type CHMP2B, or in non-transgenic osomal storage pathology is the major neuronal pathology in FTD caused by CHMP2B mutation.
    [Show full text]
  • Exploring Autophagy with Gene Ontology
    Autophagy ISSN: 1554-8627 (Print) 1554-8635 (Online) Journal homepage: https://www.tandfonline.com/loi/kaup20 Exploring autophagy with Gene Ontology Paul Denny, Marc Feuermann, David P. Hill, Ruth C. Lovering, Helene Plun- Favreau & Paola Roncaglia To cite this article: Paul Denny, Marc Feuermann, David P. Hill, Ruth C. Lovering, Helene Plun- Favreau & Paola Roncaglia (2018) Exploring autophagy with Gene Ontology, Autophagy, 14:3, 419-436, DOI: 10.1080/15548627.2017.1415189 To link to this article: https://doi.org/10.1080/15548627.2017.1415189 © 2018 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. View supplementary material Published online: 17 Feb 2018. Submit your article to this journal Article views: 1097 View Crossmark data Full Terms & Conditions of access and use can be found at https://www.tandfonline.com/action/journalInformation?journalCode=kaup20 AUTOPHAGY, 2018 VOL. 14, NO. 3, 419–436 https://doi.org/10.1080/15548627.2017.1415189 RESEARCH PAPER - BASIC SCIENCE Exploring autophagy with Gene Ontology Paul Denny a,†,§, Marc Feuermann b,§, David P. Hill c,f,§, Ruth C. Lovering a,§, Helene Plun-Favreau d and Paola Roncaglia e,f,§ aFunctional Gene Annotation, Institute of Cardiovascular Science, University College London, London, UK; bSIB Swiss Institute of Bioinformatics, Geneva, Switzerland; cThe Jackson Laboratory, Bar Harbor, ME, USA; dDepartment of Molecular Neuroscience, UCL Institute of Neurology, London, UK; eEuropean Bioinformatics Institute (EMBL-EBI), European Molecular Biology Laboratory, Wellcome Genome Campus, Hinxton, Cambridge, UK; fThe Gene Ontology Consortium ABSTRACT ARTICLE HISTORY Autophagy is a fundamental cellular process that is well conserved among eukaryotes. It is one of the Received 18 May 2017 strategies that cells use to catabolize substances in a controlled way.
    [Show full text]
  • The Genetics of Bipolar Disorder
    Molecular Psychiatry (2008) 13, 742–771 & 2008 Nature Publishing Group All rights reserved 1359-4184/08 $30.00 www.nature.com/mp FEATURE REVIEW The genetics of bipolar disorder: genome ‘hot regions,’ genes, new potential candidates and future directions A Serretti and L Mandelli Institute of Psychiatry, University of Bologna, Bologna, Italy Bipolar disorder (BP) is a complex disorder caused by a number of liability genes interacting with the environment. In recent years, a large number of linkage and association studies have been conducted producing an extremely large number of findings often not replicated or partially replicated. Further, results from linkage and association studies are not always easily comparable. Unfortunately, at present a comprehensive coverage of available evidence is still lacking. In the present paper, we summarized results obtained from both linkage and association studies in BP. Further, we indicated new potential interesting genes, located in genome ‘hot regions’ for BP and being expressed in the brain. We reviewed published studies on the subject till December 2007. We precisely localized regions where positive linkage has been found, by the NCBI Map viewer (http://www.ncbi.nlm.nih.gov/mapview/); further, we identified genes located in interesting areas and expressed in the brain, by the Entrez gene, Unigene databases (http://www.ncbi.nlm.nih.gov/entrez/) and Human Protein Reference Database (http://www.hprd.org); these genes could be of interest in future investigations. The review of association studies gave interesting results, as a number of genes seem to be definitively involved in BP, such as SLC6A4, TPH2, DRD4, SLC6A3, DAOA, DTNBP1, NRG1, DISC1 and BDNF.
    [Show full text]
  • CHMP2B (NM 001244644) Human Tagged ORF Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC231958 CHMP2B (NM_001244644) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: CHMP2B (NM_001244644) Human Tagged ORF Clone Tag: Myc-DDK Symbol: CHMP2B Synonyms: ALS17; CHMP2.5; DMT1; FTDALS7; VPS2-2; VPS2B Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC231958 representing NM_001244644 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAATTAGAAATTAAGAAAATGGCCAAGATTGGTAATAAGGAAGCTTGCAAAGTTTTAGCCAAACAAC TTGTGCATCTACGGAAACAGAAGACGAGAACTTTTGCTGTAAGTTCAAAAGTTACTTCTATGTCTACACA AACAAAAGTGATGAATTCCCAAATGAAGATGGCTGGAGCAATGTCTACTACAGCAAAAACAATGCAGGCA GTTAACAAGAAGATGGATCCACAAAAGACATTACAAACAATGCAGAATTTCCAGAAGGAAAACATGAAAA TGGAAATGACTGAAGAAATGATCAATGATACACTTGATGACATCTTTGACGGTTCTGATGACGAAGAAGA AAGCCAGGATATTGTGAATCAAGTTCTTGATGAAATTGGAATTGAAATTTCTGGAAAGATGGCCAAAGCT CCATCAGCTGCTCGAAGCTTACCATCTGCCTCTACTTCAAAGGCTACAATCTCAGATGAAGAGATTGAAC GGCAACTCAAGGCTTTAGGAGTAGAT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC231958 representing NM_001244644 Red=Cloning site Green=Tags(s) MELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQA VNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKA
    [Show full text]
  • 1 Supplementary Materials: Fig
    Supplementary Materials: Fig. S1. Supplemental Figure S1. Related to Figure 1. Antibiotic-treated mice do not accumulate extramedullary myeloid progenitors downstream of repeated TLR9 activation in vivo. C57BL/6 mice were pretreated with antibiotic (ABX) or control water ad libitum for 3 weeks and continued throughout the course of the experiment. Five doses of PBS or the TLR9 agonist CpG1826 (50 g/injection) were subsequently administered intraperitoneally to antibiotic-treated and control mice over the course of 10 days. Mice were sacrificed twenty- four hours after the fifth injection. Numbers of spleen (left), liver (middle), and bone marrow (right) myeloid progenitors were enumerated [A - granulocyte-monocyte progenitors (GMPs); B – Monocyte-Dendritic cell Progenitors (MDP); C – committed Monocyte Progenitor (cMoP)]. Each graph displays representative data from one of three independent experiments (N=4 mice per group). Individual symbols represent one mouse and the horizontal lines represent mean values. Analysis was performed by two-way ANOVA (P values are denoted as follows: * Interaction term; + control vs. antibiotic-treated; # PBS vs. CpG in vivo treatments; NS = not significant). 1 Fig S2. Supplemental Figure S2. Related to Figure 2. Germ-free mice do not accumulate extramedullary myeloid progenitors downstream of repeated TLR9 activation in vivo. Conventionally-housed and germ- free C57BL/6 mice were treated with five doses of PBS or CpG1826 over the course of 10 days. Mice were sacrificed twenty-four hours after the fifth injection. Numbers of spleen (left) and bone marrow (right) myeloid progenitors were enumerated [A - granulocyte-monocyte progenitors (GMPs); B – Monocyte-Dendritic cell Progenitors (MDP); C – committed Monocyte Progenitor (cMoP)].
    [Show full text]
  • 76173 CHMP2B (D4G3K) Rabbit Mab
    Revision 1 C 0 2 - t CHMP2B (D4G3K) Rabbit mAb a e r o t S Orders: 877-616-CELL (2355) [email protected] 3 Support: 877-678-TECH (8324) 7 1 Web: [email protected] 6 www.cellsignal.com 7 # 3 Trask Lane Danvers Massachusetts 01923 USA For Research Use Only. Not For Use In Diagnostic Procedures. Applications: Reactivity: Sensitivity: MW (kDa): Source/Isotype: UniProt ID: Entrez-Gene Id: WB, IP H M R Endogenous 28 Rabbit IgG Q9UQN3 25978 Product Usage Information 5. Skibinski, G. et al. (2005) Nat Genet 37, 806-8. 6. Lee, J.A. et al. (2007) Curr Biol 17, 1561-7. Application Dilution 7. Filimonenko, M. et al. (2007) J Cell Biol 179, 485-500. 8. Han, J.H. et al. (2012) Biochem Biophys Res Commun 421, 544-9. Western Blotting 1:1000 9. Urwin, H. et al. (2010) Hum Mol Genet 19, 2228-38. Immunoprecipitation 1:100 Storage Supplied in 10 mM sodium HEPES (pH 7.5), 150 mM NaCl, 100 µg/ml BSA, 50% glycerol and less than 0.02% sodium azide. Store at –20°C. Do not aliquot the antibody. Specificity / Sensitivity CHMP2B (D4G3K) Rabbit mAb recognizes endogenous levels of total CHMP2B protein. Species Reactivity: Human, Mouse, Rat Source / Purification Monoclonal antibody is produced by immunizing animals with a synthetic peptide corresponding to residues surrounding Glu171 of human CHMP2B protein. Background CHMP2B is a component of the ESCRT III (endosomal sorting required for transport complex III) complex (1, 2). The ESCRT system is composed of the ESCRT-0, -I, -II, and -III complexes, which function sequentially to direct the transport of ubiquitinated transmembrane proteins into the intralumenal vesicles (ILVs), which will eventually mature into multivesicular bodies (MVBs).
    [Show full text]