CKMT2 purified MaxPab rabbit Gene Summary: Mitochondrial creatine kinase (MtCK) polyclonal antibody (D01P) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It Catalog Number: H00001160-D01P belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous Regulatory Status: For research use only (RUO) MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: Product Description: Rabbit polyclonal antibody raised dimers and octamers, in contrast to the exclusively against a full-length human CKMT2 protein. dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% Immunogen: CKMT2 (AAH29140.1, 1 a.a. ~ 419 a.a) homology with the coding exons of ubiquitous full-length human protein. mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared Sequence: among some nuclear genes encoding mitochondrial MASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVC proteins and thus may be essential for the coordinated AEVREQPRLFPPSADYPDLRKHNNCMAECLTPAIYAK activation of these genes during mitochondrial LRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGD biogenesis. Three transcript variants encoding the same EESYEVFADLFDPVIKLRHNGYDPRVMKHTTDLDASKI protein have been found for this gene. [provided by TQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERRE RefSeq] VENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDH FLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWI NEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQE RGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLS KDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRI GRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLP QFGKK
Host: Rabbit
Reactivity: Human
Applications: WB-Tr (See our web site product page for detailed applications information)
Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols
Storage Buffer: In 1x PBS, pH 7.4
Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Entrez GeneID: 1160
Gene Symbol: CKMT2
Gene Alias: SMTCK
Page 1/1
Powered by TCPDF (www.tcpdf.org)