Anti-HSD17B1 Monoclonal Antibody, Clone 3F6 (DMABT-H13936) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Anti-HSD17B1 monoclonal antibody, clone 3F6 (DMABT-H13936) This product is for research use only and is not intended for diagnostic use.

PRODUCT INFORMATION

Product Overview Mouse Anti-HSD17B1 Monoclonal Antibody

Target HSD17B1

Immunogen HSD17B1 (NP_000404, 189 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Isotype IgG1

Source/Host Mouse

Species Reactivity Human

Clone 3F6

Conjugate Unconjugated

Applications WB, IHC, sELISA, ELISA

Sequence Similarities VHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTL RYFTTERFLPL LRMRLDDPSGSNYVTAMHREVF

Size 1 ea

Buffer In 1x PBS, pH 7.2

Preservative None

Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

GENE INFORMATION

Gene Name HSD17B1 hydroxysteroid (17-beta) dehydrogenase2[ Homo sapiens ]

Official Symbol HSD17B1

Synonyms HSD17B1; hydroxysteroid (17-beta) dehydrogenase 1; EDH17B2, EDHB17; estradiol 17-beta- dehydrogenase 1; Estradiol 17 beta dehydrogenase 1; HSD17; MGC138140; SDR28C1; short

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]

Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved chain dehydrogenase/reductase family 28CE; member 1; E2DH; 20-alpha-HSD; 17-beta-HSD 1; estradiol 17-beta-dehydrogenase-1; 20 alpha-hydroxysteroid dehydrogenase; 17-beta- hydroxysteroid dehydrogenase type 1; placental 17-beta-hydroxysteroid dehydrogenase; hydroxysteroid (17-beta) dehydrogenase2isoform; short chain dehydrogenase/reductase family 28CE, member 1; EDHB17; EDH17B2;

Entrez Gene ID 3292

Protein Refseq NP_000404

UniProt ID P14061

Chromosome Location 17q11-q21

Pathway Estrogen biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism- specific biosystem; Steroid Biosynthesis, organism-specific biosystem; Steroid hormone biosynthesis, organism-specific biosystem.

Function catalytic activity; estradiol 17-beta-dehydrogenase activity; nucleotide binding; oxidoreductase activity;

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]