ZHX2 Polyclonal Antibody Purified Rabbit Polyclonal Antibody (Pab) Catalog # AP58684
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Mouse Germ Line Mutations Due to Retrotransposon Insertions Liane Gagnier1, Victoria P
Gagnier et al. Mobile DNA (2019) 10:15 https://doi.org/10.1186/s13100-019-0157-4 REVIEW Open Access Mouse germ line mutations due to retrotransposon insertions Liane Gagnier1, Victoria P. Belancio2 and Dixie L. Mager1* Abstract Transposable element (TE) insertions are responsible for a significant fraction of spontaneous germ line mutations reported in inbred mouse strains. This major contribution of TEs to the mutational landscape in mouse contrasts with the situation in human, where their relative contribution as germ line insertional mutagens is much lower. In this focussed review, we provide comprehensive lists of TE-induced mouse mutations, discuss the different TE types involved in these insertional mutations and elaborate on particularly interesting cases. We also discuss differences and similarities between the mutational role of TEs in mice and humans. Keywords: Endogenous retroviruses, Long terminal repeats, Long interspersed elements, Short interspersed elements, Germ line mutation, Inbred mice, Insertional mutagenesis, Transcriptional interference Background promoter and polyadenylation motifs and often a splice The mouse and human genomes harbor similar types of donor site [10, 11]. Sequences of full-length ERVs can TEs that have been discussed in many reviews, to which encode gag, pol and sometimes env, although groups of we refer the reader for more in depth and general infor- LTR retrotransposons with little or no retroviral hom- mation [1–9]. In general, both human and mouse con- ology also exist [6–9]. While not the subject of this re- tain ancient families of DNA transposons, none view, ERV LTRs can often act as cellular enhancers or currently active, which comprise 1–3% of these genomes promoters, creating chimeric transcripts with genes, and as well as many families or groups of retrotransposons, have been implicated in other regulatory functions [11– which have caused all the TE insertional mutations in 13]. -
Integrating Single-Step GWAS and Bipartite Networks Reconstruction Provides Novel Insights Into Yearling Weight and Carcass Traits in Hanwoo Beef Cattle
animals Article Integrating Single-Step GWAS and Bipartite Networks Reconstruction Provides Novel Insights into Yearling Weight and Carcass Traits in Hanwoo Beef Cattle Masoumeh Naserkheil 1 , Abolfazl Bahrami 1 , Deukhwan Lee 2,* and Hossein Mehrban 3 1 Department of Animal Science, University College of Agriculture and Natural Resources, University of Tehran, Karaj 77871-31587, Iran; [email protected] (M.N.); [email protected] (A.B.) 2 Department of Animal Life and Environment Sciences, Hankyong National University, Jungang-ro 327, Anseong-si, Gyeonggi-do 17579, Korea 3 Department of Animal Science, Shahrekord University, Shahrekord 88186-34141, Iran; [email protected] * Correspondence: [email protected]; Tel.: +82-31-670-5091 Received: 25 August 2020; Accepted: 6 October 2020; Published: 9 October 2020 Simple Summary: Hanwoo is an indigenous cattle breed in Korea and popular for meat production owing to its rapid growth and high-quality meat. Its yearling weight and carcass traits (backfat thickness, carcass weight, eye muscle area, and marbling score) are economically important for the selection of young and proven bulls. In recent decades, the advent of high throughput genotyping technologies has made it possible to perform genome-wide association studies (GWAS) for the detection of genomic regions associated with traits of economic interest in different species. In this study, we conducted a weighted single-step genome-wide association study which combines all genotypes, phenotypes and pedigree data in one step (ssGBLUP). It allows for the use of all SNPs simultaneously along with all phenotypes from genotyped and ungenotyped animals. Our results revealed 33 relevant genomic regions related to the traits of interest. -
2Ecb Lichtarge Lab 2006
Pages 1–5 2ecb Evolutionary trace report by report maker September 17, 2010 4.3.3 DSSP 4 4.3.4 HSSP 4 4.3.5 LaTex 4 4.3.6 Muscle 4 4.3.7 Pymol 4 4.4 Note about ET Viewer 4 4.5 Citing this work 4 4.6 About report maker 5 4.7 Attachments 5 1 INTRODUCTION From the original Protein Data Bank entry (PDB id 2ecb): Title: The solution structure of the third homeobox domain of human zinc fingers and homeoboxes protein Compound: Mol id: 1; molecule: zinc fingers and homeoboxes protein 1; chain: a; fragment: homeobox domain; engineered: yes Organism, scientific name: Homo Sapiens; 2ecb contains a single unique chain 2ecbA (89 residues long). This is an NMR-determined structure – in this report the first model in the file was used. CONTENTS 2 CHAIN 2ECBA 2.1 Q9UKY1 overview 1 Introduction 1 From SwissProt, id Q9UKY1, 80% identical to 2ecbA: 2 Chain 2ecbA 1 Description: Zinc fingers and homeoboxes protein 1. 2.1 Q9UKY1 overview 1 Organism, scientific name: Homo sapiens (Human). 2.2 Multiple sequence alignment for 2ecbA 1 Taxonomy: Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; 2.3 Residue ranking in 2ecbA 1 Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; 2.4 Top ranking residues in 2ecbA and their position on Catarrhini; Hominidae; Homo. the structure 2 Function: Acts as a transcriptional repressor. 2.4.1 Clustering of residues at 25% coverage. 2 Subunit: Forms homodimers. Also forms heterodimers with ZHX3 2.4.2 Possible novel functional surfaces at 25% which is a prerequisite for repressor activity and with ZHX2. -
ZHX2 Promotes Hif1α Oncogenic Signaling in Triple-Negative Breast
bioRxiv preprint doi: https://doi.org/10.1101/2021.05.27.445959; this version posted May 28, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 1 ZHX2 Promotes HIF1 Oncogenic Signaling in Triple-Negative Breast Cancer 2 Wentong Fang,1,2* Chengheng Liao, 3* Rachel Shi, 3 Jeremy M. Simon, 2,4,5 Travis S. 3 Ptacek, 2,5 Giada Zurlo, 3 Youqiong Ye, 6,7 Leng Han, 7 Cheng Fan, 2 Christopher Llynard 4 Ortiz, 8,9,10 Hong-Rui Lin, 8 Ujjawal Manocha, 2 Weibo Luo, 3 William Y. Kim, 2 Lee-Wei Yang, 5 8,9,11 and Qing Zhang3* 6 7 1 Department of Pharmacy, The First Affiliated Hospital of Nanjing Medical University, 8 Nanjing, Jiangsu 210029, China 9 2 Lineberger Comprehensive Cancer Center, University of North Carolina School of 10 Medicine, Chapel Hill, NC 27599, USA 11 3 Department of Pathology, University of Texas Southwestern Medical Center, Dallas, TX 12 75390, USA 13 4 Department of Genetics, Neuroscience Center, University of North Carolina, Chapel Hill, 14 NC 27599, USA 15 5 UNC Neuroscience Center, Carolina Institute for Developmental Disabilities, University of 16 North Carolina, Chapel Hill, NC 27599, USA 17 6 Shanghai Institute of Immunology, Faculty of Basic Medicine, Shanghai Jiao Tong 18 University School of Medicine, Shanghai, 200025, China 19 7 Department of Biochemistry and Molecular Biology, The University of Texas Health 20 Science Center at Houston McGovern Medical School, Houston, TX, 77030, USA 21 8 Institute of Bioinformatics and Structural Biology, National Tsing Hua University, Hsinchu 22 300, Taiwan bioRxiv preprint doi: https://doi.org/10.1101/2021.05.27.445959; this version posted May 28, 2021. -
CREB-Dependent Transcription in Astrocytes: Signalling Pathways, Gene Profiles and Neuroprotective Role in Brain Injury
CREB-dependent transcription in astrocytes: signalling pathways, gene profiles and neuroprotective role in brain injury. Tesis doctoral Luis Pardo Fernández Bellaterra, Septiembre 2015 Instituto de Neurociencias Departamento de Bioquímica i Biologia Molecular Unidad de Bioquímica y Biologia Molecular Facultad de Medicina CREB-dependent transcription in astrocytes: signalling pathways, gene profiles and neuroprotective role in brain injury. Memoria del trabajo experimental para optar al grado de doctor, correspondiente al Programa de Doctorado en Neurociencias del Instituto de Neurociencias de la Universidad Autónoma de Barcelona, llevado a cabo por Luis Pardo Fernández bajo la dirección de la Dra. Elena Galea Rodríguez de Velasco y la Dra. Roser Masgrau Juanola, en el Instituto de Neurociencias de la Universidad Autónoma de Barcelona. Doctorando Directoras de tesis Luis Pardo Fernández Dra. Elena Galea Dra. Roser Masgrau In memoriam María Dolores Álvarez Durán Abuela, eres la culpable de que haya decidido recorrer el camino de la ciencia. Que estas líneas ayuden a conservar tu recuerdo. A mis padres y hermanos, A Meri INDEX I Summary 1 II Introduction 3 1 Astrocytes: physiology and pathology 5 1.1 Anatomical organization 6 1.2 Origins and heterogeneity 6 1.3 Astrocyte functions 8 1.3.1 Developmental functions 8 1.3.2 Neurovascular functions 9 1.3.3 Metabolic support 11 1.3.4 Homeostatic functions 13 1.3.5 Antioxidant functions 15 1.3.6 Signalling functions 15 1.4 Astrocytes in brain pathology 20 1.5 Reactive astrogliosis 22 2 The transcription -
Supplementary File Table S1
Supplementary file Table S1 Grouping of Homeobox genes according to their main known function. Anatomical Structure Morphogenesis EN1, HOXC10, HOXC13, HOXD3, LBX1, SIX2, SIX4 Organ Morphogenesis CDX1, CDX2, HOXA11, HOXA13, ISL1, LHX1, PAX3, PDHX, PITX2, PITX3, PROX1, SIX6 Body Pattern Formation ALX3, EMX2, HHEX, HOXA11, HOXA2, HOXA4, HOXA5, HOXA6, HOXB1, HOXB5, HOXB6, HOXC5, HOXD10, HOXD8, LMX1B, PITX2 Ectoderm Development PROX1, VAX2 Endoderm Development HOXC11 Brain & Nervous System Development Brain Development ALX1, DLX2, EMX2 Nervous System Development: ARX, DLX5, DLX6, HOXD10, LBX1, LHX1, OTP, PAX3, PHOX2A, PHOX2B Skeletal Development: ALX3, ALX4, DLX3, DLX5, DLX6, EN1, HOXA11, HOXA13, HOXA2, HOXB6, HOXD10, HOXD13, MSX2 Muscle Development: BARX2, MKX, SIRT1, SIRT2, SIX1 Other Homeobox Genes Involved In BARX1, CDX4, CUX1, DLX1, EMX1, EN2, Multicellular Organismal HOXA1, HOXA7, HOXA9, HOXB13, HOXB2, Development: HOXB3, HOXB4, HOXB7, HOXB8, HOXB9, HOXC12, HOXC8, HOXC9, HOXD1, HOXD11, HOXD12, HOXD9, ISL2, LBX2, LMX1A, MEIS1, NKX3-1, OTX1, TLX1, VAX1, VSX1, VSX2 Homeobox Genes Involved In Cell ARX, EMX2, HHEX, HLX, HOPX, LBX1, LHX1, Differentiation: LMX1B, MIXL1, OTP, PHOX2A, SIRT1, VSX2 Other Genes: PHTF1, SIRT3, SIRT6, SIRT7, ZHX1, ZHX2 Homeobox genes include two subsets of genes coding for transcription factors involved in multiple functions. The clustered HOX genes are indicated in bold. Supplementary file Figure S2 5’ Spatial collinearity 3’ HOXA Chr. 7p15.3 HOXB Chr. 17q21.3 HOXC Chr. 12q13.3 HOXD Chr. 2q31 13 12 11 10 9 8 7 6 5 4 3 2 1 Paralogous HOX groups Distribution of the 39 human HOX genes in four clusters located in different chromosomal regions*. Blue indicates anterior HOX genes. Yellow, paralogy group 3 Hox genes, green and purple indicatete central HOX genes and Red the posterior HOX genes. -
Zhx2 Regulation of Lipid Metabolism and the Balance Between Cardiovascular and Hepatic Health
University of Kentucky UKnowledge Theses and Dissertations--Pharmacology and Nutritional Sciences Pharmacology and Nutritional Sciences 2015 ZHX2 REGULATION OF LIPID METABOLISM AND THE BALANCE BETWEEN CARDIOVASCULAR AND HEPATIC HEALTH Kate Townsend Creasy University of Kentucky, [email protected] Right click to open a feedback form in a new tab to let us know how this document benefits ou.y Recommended Citation Creasy, Kate Townsend, "ZHX2 REGULATION OF LIPID METABOLISM AND THE BALANCE BETWEEN CARDIOVASCULAR AND HEPATIC HEALTH" (2015). Theses and Dissertations--Pharmacology and Nutritional Sciences. 10. https://uknowledge.uky.edu/pharmacol_etds/10 This Doctoral Dissertation is brought to you for free and open access by the Pharmacology and Nutritional Sciences at UKnowledge. It has been accepted for inclusion in Theses and Dissertations--Pharmacology and Nutritional Sciences by an authorized administrator of UKnowledge. For more information, please contact [email protected]. STUDENT AGREEMENT: I represent that my thesis or dissertation and abstract are my original work. Proper attribution has been given to all outside sources. I understand that I am solely responsible for obtaining any needed copyright permissions. I have obtained needed written permission statement(s) from the owner(s) of each third-party copyrighted matter to be included in my work, allowing electronic distribution (if such use is not permitted by the fair use doctrine) which will be submitted to UKnowledge as Additional File. I hereby grant to The University of Kentucky and its agents the irrevocable, non-exclusive, and royalty-free license to archive and make accessible my work in whole or in part in all forms of media, now or hereafter known. -
UC San Diego Electronic Theses and Dissertations
UC San Diego UC San Diego Electronic Theses and Dissertations Title Cardiac Stretch-Induced Transcriptomic Changes are Axis-Dependent Permalink https://escholarship.org/uc/item/7m04f0b0 Author Buchholz, Kyle Stephen Publication Date 2016 Peer reviewed|Thesis/dissertation eScholarship.org Powered by the California Digital Library University of California UNIVERSITY OF CALIFORNIA, SAN DIEGO Cardiac Stretch-Induced Transcriptomic Changes are Axis-Dependent A dissertation submitted in partial satisfaction of the requirements for the degree Doctor of Philosophy in Bioengineering by Kyle Stephen Buchholz Committee in Charge: Professor Jeffrey Omens, Chair Professor Andrew McCulloch, Co-Chair Professor Ju Chen Professor Karen Christman Professor Robert Ross Professor Alexander Zambon 2016 Copyright Kyle Stephen Buchholz, 2016 All rights reserved Signature Page The Dissertation of Kyle Stephen Buchholz is approved and it is acceptable in quality and form for publication on microfilm and electronically: Co-Chair Chair University of California, San Diego 2016 iii Dedication To my beautiful wife, Rhia. iv Table of Contents Signature Page ................................................................................................................... iii Dedication .......................................................................................................................... iv Table of Contents ................................................................................................................ v List of Figures ................................................................................................................... -
ZHX2 Polyclonal Antibody - Classic
TECHNICAL DATASHEET ZHX2 polyclonal antibody - Classic Other name: AFR1, RAF Cat. No. C15410260 Specificity: Human: positive Type: Polyclonal ChIP-grade, ChIP-seq grade Purity: Affinity purified polyclonal antibody in 0.1 M Tris-HCl Source: Rabbit containing 0.1 M Glycine, 10% glycerol and 0.01% thimerosal. Lot #: 40107 Storage: Store at -20°C; for long storage, store at -80°C. Avoid multiple freeze-thaw cycles. Size: 25 µl/100 µl Precautions: This product is for research use only. Not for Concentration: 0.86 µg/µl use in diagnostic or therapeutic procedures. Description: Polyclonal antibody raised in rabbit against ZHX2 (Zinc Fingers And Homeoboxes 2), using a recombinant protein. Applications Suggested dilution* Results ChIP* 2 - 5 µg per ChIP Fig 1, 2 Western blotting 1:500 - 1:3,000 Fig 3 Immunofluorescence 1:100 - 1:1,000 Fig 4 Immunohistochemistry 1:100 - 1:1,000 Fig 5 * Please note that the optimal antibody amount per IP should be determined by the end-user. We recommend testing 1-5 µg per IP. Target description ZHX2 (UniProt/Swiss-Prot entry Q9Y6X8) is a transcriptional repressor that interacts with the A subunit of nuclear factor-Y (NF- YA). ZHX2 represses the promoter activity of the CDC25C gene. 1 Figure 1. ChIP results obtained with the Diagenode antibody directed against ZHX2 ChIP assays were performed using HepG2 cells, the Diagenode antibody against ZHX2 (Cat. No. TECHNICALC15410260) and optimized DATASHEET primer sets for qPCR. ChIP was performed with the “iDeal ChIP-seq” kit (Cat. No. C01010055), using sheared chromatin from 4 million cells. A titration of the antibody consisting of 1, 2 and 5 µg per ChIP experiment was analysed. -
PP1-Associated Signaling and − B/AP-1 Κ Inhibition of NF- Tolerance
Downloaded from http://www.jimmunol.org/ by guest on October 3, 2021 is online at: average * and − B/AP-1 κ The Journal of Immunology published online 26 February 2014 from submission to initial decision 4 weeks from acceptance to publication http://www.jimmunol.org/content/early/2014/02/26/jimmun ol.1301610 Identification of Two Forms of TNF Tolerance in Human Monocytes: Differential Inhibition of NF- PP1-Associated Signaling Johannes Günther, Nico Vogt, Katharina Hampel, Rolf Bikker, Sharon Page, Benjamin Müller, Judith Kandemir, Michael Kracht, Oliver Dittrich-Breiholz, René Huber and Korbinian Brand J Immunol Submit online. Every submission reviewed by practicing scientists ? is published twice each month by Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts http://jimmunol.org/subscription Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html http://www.jimmunol.org/content/suppl/2014/02/26/jimmunol.130161 0.DCSupplemental Information about subscribing to The JI No Triage! Fast Publication! Rapid Reviews! 30 days* Why • • • Material Permissions Email Alerts Subscription Supplementary The Journal of Immunology The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2014 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. This information is current as of October 3, 2021. Published February 26, 2014, doi:10.4049/jimmunol.1301610 The Journal of Immunology Identification of Two Forms of TNF Tolerance in Human Monocytes: Differential Inhibition of NF-kB/AP-1– and PP1-Associated Signaling Johannes Gunther,*€ ,1 Nico Vogt,*,1 Katharina Hampel,*,1 Rolf Bikker,* Sharon Page,* Benjamin Muller,*€ Judith Kandemir,* Michael Kracht,† Oliver Dittrich-Breiholz,‡ Rene´ Huber,* and Korbinian Brand* The molecular basis of TNF tolerance is poorly understood. -
Expression of Zinc Fingers and Homeoboxes 2 (Zhx2) and Zhx2 Target Genes in Multiple Tissues of Wild-Type and Zhx2 Knockout Mice
University of Kentucky UKnowledge Theses and Dissertations--Microbiology, Microbiology, Immunology, and Molecular Immunology, and Molecular Genetics Genetics 2016 Expression of Zinc Fingers and Homeoboxes 2 (Zhx2) and Zhx2 Target Genes in Multiple Tissues of Wild-Type and Zhx2 Knockout Mice Minen Al-Kafajy University of Kentucky, [email protected] Author ORCID Identifier: http://orcid.org/0000-0003-3217-848X Digital Object Identifier: https://doi.org/10.13023/ETD.2016.515 Right click to open a feedback form in a new tab to let us know how this document benefits ou.y Recommended Citation Al-Kafajy, Minen, "Expression of Zinc Fingers and Homeoboxes 2 (Zhx2) and Zhx2 Target Genes in Multiple Tissues of Wild-Type and Zhx2 Knockout Mice" (2016). Theses and Dissertations--Microbiology, Immunology, and Molecular Genetics. 11. https://uknowledge.uky.edu/microbio_etds/11 This Doctoral Dissertation is brought to you for free and open access by the Microbiology, Immunology, and Molecular Genetics at UKnowledge. It has been accepted for inclusion in Theses and Dissertations--Microbiology, Immunology, and Molecular Genetics by an authorized administrator of UKnowledge. For more information, please contact [email protected]. STUDENT AGREEMENT: I represent that my thesis or dissertation and abstract are my original work. Proper attribution has been given to all outside sources. I understand that I am solely responsible for obtaining any needed copyright permissions. I have obtained needed written permission statement(s) from the owner(s) of each third-party copyrighted matter to be included in my work, allowing electronic distribution (if such use is not permitted by the fair use doctrine) which will be submitted to UKnowledge as Additional File. -
ZHX2 Monoclonal Antibody (M01), Clone 5E2
ZHX2 monoclonal antibody (M01), clone 5E2 Catalog # : H00022882-M01 規格 : [ 100 ug ] List All Specification Application Image Product Mouse monoclonal antibody raised against a partial recombinant ZHX2. Western Blot (Transfected lysate) Description: Immunogen: ZHX2 (NP_055758, 691 a.a. ~ 788 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: MEQYQHQPMADDHGYDAVARKATKPMAESPKNGGDVVPQYYKDPKKL CEEDLEKLVTRVKVGSEPAKDCLPAKPSEATSDRSEGSSRDGQGSDEN EES enlarge Western Blot (Recombinant Host: Mouse protein) Reactivity: Human Immunohistochemistry (Formalin/PFA-fixed paraffin- Isotype: IgG2b Kappa embedded sections) Quality Control Antibody Reactive Against Recombinant Protein. Testing: enlarge Immunofluorescence enlarge Western Blot detection against Immunogen (36.52 KDa) . ELISA Storage Buffer: In 1x PBS, pH 7.4 RNAi Knockdown (Antibody Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. validated) Instruction: MSDS: Download Datasheet: Download enlarge Applications Western Blot (Transfected lysate) Page 1 of 3 2016/5/23 Western Blot analysis of ZHX2 expression in transfected 293T cell line by ZHX2 monoclonal antibody (M01), clone 5E2. Lane 1: ZHX2 transfected lysate(92.307 KDa). Lane 2: Non-transfected lysate. Protocol Download Western Blot (Recombinant protein) Protocol Download Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlarge this image Immunoperoxidase of monoclonal antibody to ZHX2 on formalin-fixed paraffin-embedded human smooth muscle. [antibody concentration 3 ug/ml] Protocol Download Immunofluorescence enlarge this image Immunofluorescence of monoclonal antibody to ZHX2 on HeLa cell. [antibody concentration 10 ug/ml] Protocol Download ELISA RNAi Knockdown (Antibody validated) Page 2 of 3 2016/5/23 Western blot analysis of ZHX2 over-expressed 293 cell line, cotransfected with ZHX2 Validated Chimera RNAi ( Cat # H00022882-R01V ) (Lane 2) or non-transfected control (Lane 1).