Good to the last bite WEEKEND | P.17

OCTOBER 22, 2010 VOLUME 18, NO. 42 INSIDE: MOVIES | PAGE 20 650.964.6300 MountainViewOnline.com Measure T campaign raises questions FORMER COUNCILMAN SUSPECTS CITY’S INVOLVEMENT IN PHONE TAX MEASURE

By Daniel DeBolt “We need to get as many folks there as possible” to a meeting n the campaign to update the at the Chamber of Commerce, city’s phone tax, Mountain Woodhouse writes. The e-mail IView officials are dismissing lists key community leaders concerns about the city staff’s that City Council members are involvement in the campaign. A targeting to recruit for the cam- former councilman has raised paign, which had yet to begin questions about the appear- when the e-mail was written. ance of taking campaign funds I used “my time and my from housing developers and the resources completely indepen- appropriateness of using of city dent from city time and city funds on a mailer. resources,” Woodhouse said. Measure T would extend the Councilman Mike Kasperzak,

MICHELLE LE city’s phone tax to broadband who is the spokesman for the John Rios, the store manager, has worked for Minton’s for more than 21 years. The lumber supply store phone services as well as interna- Yes on Measure T campaign, is closing after a century in business. tional and out-of-state calls. The vouched for Woodhouse, say- tax itself is expected to raise the ing the two always met away average resident’s phone bill by from city hall and communi- Final cut coming soon for Minton’s about 15 cents a month. cated through personal e-mail The tax is currently bring- addresses and phone numbers. CITY’S OLDEST BUSINESS CLOSING TO MAKE WAY FOR HOUSING DEVELOPMENT ing the city’s general fund $1.9 By Daniel DeBolt Minton’s name would have been operating.” million a year but it is declining Consultant’s advice 100 years old next year, said its Early next year, the buildings because of increased broadband Woodhouse’s e-mail also inton’s Lumber and president, Debby Shulz. will be demolished and construc- phone use. The measure may reveals that campaign advice Supply, the city’s old- “It has always been my feeling tion will begin on a 200-unit also prevent legal challenges to came from a city-funded con- Mest business, will soon that it’s difficult for the small apartment project on the site. the existing tax, which is based sultant, Larry Tremutola, who trickle away piece by piece as independent business to compete The developer, Prometheus Real on an obsolete federal law. was paid by the city to study the lumber, tools and trucks are auc- against big boxes,” Shulz said. “It Estate Group, has agreed to rent But former council member phone tax issue before it went on tioned off on Nov. 9. just was not working out. My par- the land from Shulz and her fam- Greg Perry says city resources the ballot. If there had been enough busi- ents, the owners, were putting in were used to promote the mea- Tremutola “believes that in ness to keep the store open, the their own money to keep things See MINTON’S, page 11 sure in a way that is illegal, or at order to maximize the possibil- least has the appearance of being ity of success, at least a modest inappropriate. Leaders of the campaign will be needed (a campaign acknowledge that city supportive steering committee, Prometheus draws ire from tenants, again funds and resources cannot be possibly one mailer or ads and TENANT’S ONLINE VIDEOS DOCUMENT “CONSTRUCTION SITE HELL” used in the campaign. $10,000-$20,000 in funding),” Woodhouse wrote. By Daniel DeBolt to illustrate exactly how he’s suf- before the buildings rotted further. Assistant’s e-mail Tremutola account represen- fered from the work to repair water Construction dust set the alarms In an e-mail obtained by the tative Steven Boardman said he esidents of Castro Street’s damage to the 120 unit apartment off at first, but managers later found Voice, assistant to the city man- was the Tremutola employee who largest apartment complex complex. Kulman, who works at a resident pulling the fire alarm ager Kevin Woodhouse makes helped with the campaign. Rare demanding compensa- home every day, appears tormented and referred the matter to police, an appeal to a resident to help “Very little time (was) given tion from their landlord, Pro- by noise in his videos, including the Standard said. organize a Yes on T campaign. and we were happy to give it,” metheus Real Estate Group, after ear-piercing fire alarms that ago off “This is absolutely a horrible place While it may appear that the city Boardman said. “We weren’t enduring the noise of a months- after confusing construction dust to live,” Kulman says to a manager manager’s office orchestrated the working with anyone from the long construction project. with smoke. in one video with fire alarms going start of the campaign, Wood- city when we were working on Park Place South resident Guy Rod Standard, vice president of off. “Would you live here and not house says he wrote such e-mails the campaign.” Woodhouse “was Kulman has gone as far as to post property management for Pro- be compensated to endure this on his personal time from his acting as a volunteer,” he added. videos on his blog, parkplacesouth metheus, said his firm was being personal e-mail address in order constructionsitehell.blogspot.com, proactive in fixing water damage See PROMETHEUS, page 13 to comply with campaign law. See MEASURE T, page 6

INSIDE GOINGS ON 21 | MARKETPLACE 22 | REAL ESTATE 25 | VIEWPOINT 15 apr.com

Go to open.apr.com for the Bay Area’s only complete online open home guide.

JANIS AHMADJIAN-BAER JERYLANN MATEO ELAINE KLEMM

MOUNTAIN VIEW 5-year-old custom built MOUNTAIN VIEW Quality craftsmanship and MOUNTAIN VIEW Completely remodeled craftsman home on a quiet cul-de-sac with top Los high-end finishes are abundant in this fabulous 3bd/2ba home on a large cul-de-sac lot. HW floors, Altos schools. 4bd/3ba with stunning great room. 5bd/3ba home. Enjoy entertaining inside and out. limestone FP, + gorgeous kitchen with top-of-the-line Open Saturday & Sunday. $1,598,000 Great location. $1,499,000 stainless steel appliances. $1,225,000 MARGO KELLY . BEA SINES

MOUNTAIN VIEW Charming, elegantly de- MOUNTAIN VIEW Charming, updated 3bd/1ba signed 3-year-old custom home ideally located . home in move-in condition. HW floors, Pella win- close to downtown Mountain View. 3bd/2.5ba with dows, central AC, + spacious family room. Los Altos HW floors + large master suite. $949,000 Elementary School. $919,500

JERYLANN MATEO SHARON WALZ & MARCELLA CHRISTOFF HELEN & KI NYBORG, AND SCOTT RUTLEY

MOUNTAIN VIEW End-unit townhouse in MOUNTAIN VIEW Wonderful, quiet location MOUNTAIN VIEW Charming 1bd/1ba condo great location. 3bd/2.5ba with formal living room in the Crossings. Spacious 2bd/2.5ba townhouse with bonus room! New paint, carpet and bathroom. with FP, and formal DR. Family room opens to kitch- with vaulted ceilings, new carpet, + cherry HW floor- Inside laundry, deck, + views of landscaped court- en. Spacious master suite. $699,000 ing. Los Altos schools. $617,000 yard. Complex pool and spa. $375,000

LOS ALTOS ⎮ 167 South San Antonio Rd 650.941.1111 APR COUNTIES ⎮ Santa Clara ⎮ San Mateo ⎮ San Fracisco ⎮ Marin ⎮ Sonoma ⎮ Alameda ⎮ Contra Costa ⎮ Monterey ⎮ Santa Cruz

2 ■ MOUNTAIN VIEW VOICE ■ OCTOBER 22, 2010 7PJD FT 2010 AROUND TOWN Asked in Downtown Mountain View. Pictures and interviews by Nick Veronin. Have you been thinking about your city’s upcoming local elections? Are you past due for your check-up and cleaning?

· Service – At smiles dental, we · Smiles – Our offi ce is equipped “I’ll be voting in the local believe in treating our patients to the best with the latest technology to help you elections. I know more about of dentistry and technology with fi rst class achieve the smile you deserve. them than I do about some of personal service. the state elections.” Health & Beauty Eric Flint, Mountain View · Passionate – Our skilled team is passionate about helping our patients EXAM maintain healthy beautiful smiles. FREENEW PATIENTS ONLY INCLUDES EXAM & DIGITAL X-RAYS! SECOND OPINIONS WELCOME Call for details. Dr. William Hall & Dr. Peri Eilers Some restrictions may apply. Offer Good for 60 Days. “Generally, I do pay attention. 100 W. El Camino Real, Suite 63A But I just started grad school and Mountain View I haven’t been paying attention (Corner of El Camino and Calderon) this year. I can’t even think of a 650.964.2626 single candidate.” Daniel Vucurevich, Mountain View www.SmilesDental.com

EXPERT CARE FOR YOUR

“I’m currently investigating FORD the candidates and measures. I know what I’m voting on for Entrust the care of your some, but not all.” 2010 Kathy Hall, Mountain View Ford vehicle to us, RUNNER-UP and enjoy expert service in a stress-free environment 2009 with a lot of TLC. “I have a plan. It would be great if more people attended the League SERVICE EXCELLENCE “We go beyond auto repair to auto care.” of Women Voters’ candidate WITH A PERSONAL TOUCH forums. It’s better to meet the candidates than just read what the newspaper says about them.” Victoria Hobel Schultz, I have total Mountain View “ confi dence that the job will be done right and on time when I “I probably won’t vote this To schedule your appointment, take it to Dean’s. November. I don’t really think ” please call us today at 650-961-0302 about it too much.” -B.H. Mountain View Chris Revell, San Diego 2037 Old Middlefi eld Way Mountain View, CA 94043 Open Monday-Friday 8am-5:30pm

Find us on Visit us at: www.deansautomotive.com Facebook Have a question for Voices Around Town? E-mail it to [email protected] 650-961-0302 OCTOBER 22, 2010 ■ MOUNTAIN VIEW VOICE ■ 3 -PDBM/FXT Bridges Community Church presents:

)$0,/<)811,*+7 NCRIMEBRIEFS Come join us for Games, Trick-Car-Treat, Pumpkin Carving, Bounce Houses, Face Painting, Snacks, and Photo Booth. TEEN’S JOYRIDE earlier in the evening, and the ENDS IN ARREST youth was arrested and booked into juvenile hall. FREE OF CHARGE A 14-year-old Redwood City —Nick Veronin Date: October 29th, 6:30—8:30 pm boy was arrested on suspicion of recklessly evading the police Saturday night. A police officer MAN HURLS (YHU\RQHLVZHOFRPH attempted to pull over a black SHOPPING CARTS Ford Ranger, but the driver fled at *Please no masks or scary costumes Two early morning drivers high speed, blowing through stop were attacked by flying shopping signs and making erratic turns carts on Friday as they passed and lane changes, police said. through the 1900 block of El A Mountain View police offi- Camino Real, police said. www.ConnectBCC.org/FFN 625 Magdalena Ave., Los Altos (650) 948-5698 cer initially attempted to pull In two separate incidents, vic- the truck over after it failed to tims — a 74-year-old Sunnyvale stop at a stop sign at Rengstorff man and a 31-year-old Milpitas and University avenues around man — told police that an assail- #10 Monthly Workshop Series by Harrell Remodeling 8:30 p.m. The driver evaded the ant had charged their vehicles officer, making wild turns, run- and heaved a shopping cart at ning red lights at high speed and them, around 4 a.m. on Oct. Kitchen & Bath Remodels almost causing “a whole bunch of 15, according to police spokes- accidents,” police spokeswoman woman Liz Wylie. For homeowners interested in learning more about how to Liz Wylie said. Jossue Hernandez, a 31-year- approach a remodeling project, these interactive workshops At one point, early in the chase, old Mountain View man, was promise to be informative and fun! Planning ahead will the truck made a hairpin turn to arrested shortly after 4 a.m. when ensure a successful project! double back on the officer and police found him nearby, stagger- nearly flipped, she said. n Discover the designers tricks of the trade and explore your ing in the middle of El Camino It was then that the pursuing color courage! Change a room’s “look” in a day! Real “with no regard for his own officer got a look at the driver safety,” Wylie said. A damaged n Learn about budgets, permits, types of contracts and why and two other passengers in the shopping cart was found nearby. upfront communication is key in the remodeling process. vehicle, Wylie said. The officer “He was clearly under the n Hear about design guidelines, storage, trends, technology and stopped chasing the truck shortly influence,” Wylie said of Her- remodeling case studies. thereafter, because of the safety nandez, noting that the police hazards involved in the pursuit, n Choices in appliances, cabinets, counters, lighting and more… report stated the man almost fell and lost sight of the Ranger over a number of times as police on northbound San Antonio approached him. Kitchen & Bath Remodels We never forget it’s your home.® Road as it crossed over Central There was damage to both Expressway. vehicles, Wylie said. Thursday, November 4 - 6:30pm to 8:30pm The truck was later found by Hernandez was charged with Registration and light dinner at 6:15pm another officer at around 11:30 being drunk in public and with Harrell Remodeling Design Center, Mountain View p.m., parked at the corner of Villa throwing objects with intent to Saturday, November 6 - 10:00am to 12:00pm Street and Calderon Avenue, cause great bodily injury, which Wylie said. The first officer was Keplers Bookstore, Menlo Park a felony, Wylie said. called to the scene, identified To register for this class or to see a complete list of our 2010 Monthly License: B479799 Workshop Series, please visit us at: www.harrell-remodeling.com Our Design Center the driver as the one he had seen —Nick Veronin is 85% solar powered

NPOLICELOG

AUTO BURGLARY N. Bernardo Av. and E. Middlefield Rd., 2400 block W. El Camino Real, 10/12 10/13 2000 block San Luis Av., 10/13 NB 101 and N. Rengstorff Av., 10/15 1900 block W. El Camino Real., 10/15 Bryant St. and Villa St., 10/18 Bernardo Av. and El Camino Real, 10/18 3END5S3END5S!0OSTCARD!0OSTCARD BATTERY 2500 block Claire Ct., 10/16 GRAND THEFT 400 block Tyrella Av., 10/16 100 block Plymouth St., 10/13 300 block Escuela Av., 10/17 RESIDENTIAL BURGLARY 1 Amphitheatre Av., 10/18 200 block Showers Dr., 10/14 1900 block Latham Av., 10/18 400 block Sylvan Av., 10/15 COMMERCIAL BURGLARY ROBBERY 2600 block Marine Wy., 10/14 Rengstorff Park, 10/12 500 block Showers Dr., 10/16 500 block Escuela Av., 10/19 600 block Showers Dr., 10/18 VANDALISM DISORDERLY CONDUCT 1700 block California St., 10/12 700 block E. El Camino Real, 10/12 100 block Hope St., 10/12 N. Shoreline Bl and Terra Bella Av., 10/16 200 block E. Dana St., 10/13 DOMESTIC DISTURBANCE 100 block Bryant St., 10/15 1900 block Latham St., 10/14 1000 block El Monte Av., 10/16 DRIVING UNDER THE INFLUENCE 700 block W. Middlefield Rd., 10/13 Photo of Jessica Gandhi in front of the Neuschwanstein Castle The Mountain View Voice is published every Friday by Embarcadero Media, in Hohenschwangau, Germany. 450 Cambridge Ave, Palo Alto CA 94306 (650) 964-6300. Application to Mail at Periodicals Take a photo with the Mountain View Voice on your next trip Postage Rates is Pending at Palo Alto, CA and additional mailing offices. The Mountain View Voice is mailed free to homes and apartments in Mountain View. Subscription rate of $60 and email to [email protected] per year. POSTMASTER: Send address changes to Mountain View Voice, 450 Cambridge Ave, Palo Alto, CA 94306.

4 ■ MOUNTAIN VIEW VOICE ■ OCTOBER 22, 2010 MOUNTAINVIEWVOICE ■ CITY COUNCIL UPDATES ■ COMMUNITY -PDBM/FXT ■ FEATURES Council: Give more power to the planning commission COMMISSION COULD APPROVE DEVELOPMENT PROJECTS, ZONING CHANGES By Daniel DeBolt and given to a city-employed zon- ing administrator, a position now ouncil members said Tues- held by City Planner Peter Gilli. day that the city’s largely “It was residents making deci- Cpowerless environmental sions,” Siegel said. “Our zoning planning commission should be administrator is great, but appoint- given the authority to approve small ed people made those decisions in development projects and have an our city. It worked very well.” expanded role as the “keepers” of Siegel’s return to the commis- the city’s planning policies. sion years after the change was During the study session, com- frustrating, he said. missioners and council members “We were totally frustrated,” he who had served on the commis- said. Commissioners would ask sion spoke with frustration about themselves, “What are we doing the lack of influence given to the here? Why are we wasting out group of council-appointed vol- time?” unteers. A majority of the council Possible new powers for the appeared supportive of giving it commission mentioned Tues- new powers, which could include day included conditional permit MICHELLE LE the ability to approve small plan- approvals, approving housing Simon Rosenbaum sits in the cockpit of a land-speed racer parked at Los Altos High School. Amir ning projects, issue conditional developments that have fewer Rosenbaum brought his “Spectre Infidel” car to the school’s annual Science and Technology Week events. use permits and than five units, make certain approving zon- zoning changes, We don’t want to ing variances Valley tech stars wow students as such com- and home addi- missions do in make the process tions, and con- LOS ALTOS HIGH SHOWS HOW SCIENCE, TECHNOLOGY CAN PAY OFF other cities. ducting annual The council any tougher for reviews of the By Nick Veronin kids to disobey local traffic laws. physical challenges he had to over- also supported developers. city’s zoning He just wants teens to reach for come in order to reach his goal. planning direc- code. hen it comes to high their goals, whatever they may According to Los Altos Princi- tor Randy Tsu- MIKE KASPERZAK The goal would school students and be. pal Wynne Satterwhite, the series da’s recommen- be to make sure Wcars, the general wis- And so, for Los Altos High of presentations from community dation that the “our precise dom handed down from parents School’s fifth-annual Science and members like Rosenbaum, along commission be the “keepers” of plans or zoning codes are never and teachers is to buckle up and Tech Week, Rosenbaum showed with area scientists, technologists, the city’s development policies, as out of date as they are today,” obey the speed limit. However, the off the car that recently allowed engineers and mathematicians, periodically reviewing them to Tsuda said. “There’s no reason why group of Los Altos High School him to reach one of his goals give students “something to look make sure they are up to date. things need to be 10 to 20 years out students that gathered around — to travel over 400 miles per forward to” after high school. It of date.” Amir Rosenbaum’s vehicle earlier hour on land. Prior to showing also demonstrates that classes in ‘Window dressing’ Under those changes, picking this week received a slightly differ- his car to students, Rosenbaum science, technology, engineering Former commissioner Arnold planning commissioners could ent message: gave a lecture titled, “Science and and math aren’t just fodder for Soderbergh, who recently resigned become an even more political Buckle up and push the pedal to Technology vs Dumb Luck and college transcripts. from the commission after three process than it currently is. It’s the metal. Hard Work.” In that lecture he years, called the commission a already viewed by many as a step- It’s not that Rosenbaum wants described the engineering and See SCIENCE WEEK, page 6 “minor appendage tacked onto ping stone to the City Council. city government” that only comes The current commission is partly into play after the planning divided among housing advocates department, City Council, zoning and slow-growthers. Candidates favor new park for Whisman administrator and development Commissioners say that say that review committee have talked they’ve often heard from city staff By Daniel DeBolt tic response, having a park there is fund the creation of Cuesta and about a project. “It’s mere window that they can’t take on more work definitely needed, candidates said. Rengstorff parks. dressing, a reactive authority with because it is costly — every time uilding a large park in the “That area is under-served with “I would never consider eminent no powers, almost an afterthought. the group meets it costs the city Whisman neighborhood park space,” said candidate Greg domain, ever,” said incumbent It only exists because it so states in staff time and money to take the Bwas a popular idea among David. “They don’t have anything Jac Siegel. “But would you bring a city charter,” he said. commission’s input. the six candidates for City Council like Cuesta there.” bond measure to the people? Abso- That’s not the case in other cit- Mike Kasperzak was the only at the latest debate. The 12-acre site could be the lutely.” ies, where planning commissions council who appeared to have At the League Of Women Voters- fourth largest park in the city “Asking the voters whether they approve zoning changes, variances serious concerns about giving the hosted debate Oct. 14, the candi- and the only one in northeastern would be interested in a bond might and small projects. commission more powers. dates were asked if they would be Mountain View. be an interesting thing to do,” said Vice Mayor Jac Siegel was the only “We don’t want to make the pro- willing to have the city purchase The only problem is that the Mayor Ronit Bryant. council member who had served on cess any tougher” for developers, Mountain View’s last orchard, property is not for sale, but if it Candidates Aaron Jabbari a more powerful variation of the Kasperzak said. We don’t want to owned by the Franzia family on ever is, asking voters to pass a bond and Dan Waylonis, both Google commission decades ago, when it hear developers saying, “I’d rather North Whisman Road, for sports measure to pay for it would be employees, were not familiar with approved zoning changes. Those be in Los Altos or Palo Alto. A few fields. worthwhile, said Margaret Abe- the property, but said a “cost-ben- responsibilities were later taken people will say the planning com- While the idea of putting fields on Koga. Such a measure requires a from the commission, said to be the site did not receive an enthusias- two-thirds vote, and was used to See LEAGUE DEBATE, page 9 busy with other things at the time, See PLANNING, page 10

OCTOBER 22, 2010 ■ MOUNTAIN VIEW VOICE ■ 5 -PDBM/FXT

SCIENCE WEEK exceed that speed on wheels. physics, biology, chemistry and Continued from page 5 Jose Rodriguez, a senior from geology to name a few. On top of Mountain View, said the speedster that, Heldmann said, solid com- was the only thing that had cap- munication, ability to work with “It translates what they are learn- tured his attention all week. others, and organizational skills are ing in the classroom to real life,” “It’s really fast,” said Rodriguez, key. Satterwhite said. “Kids can now see who likes working on cars. She told the students that while that the stuff they are learning is her job had not taken her to the practical.” Shooting for the moon moon or Mars, it had given her the In addition to Rosenbaum, guests Shortly after lunch on Oct. 18, a opportunity to travel around the at this year’s Science and Tech group of about 400 students shuf- world to remote locations — the Week included representatives from fled into the school’s Eagle Theater desert in Chile, the Australian Facebook, Google, NASA and Stan- to listen to Dr. Jennifer L. Held- Outback, Antarctica — desolate ford. Danielle Feinberg, director of mann, a scientist at NASA Ames places meant to simulate Martian photography and lighting at Pixar Research Center. Her presentation, topography and give researchers a Animation Studios, delivered the titled “Moon, Mars, and Beyond: chance to practice doing research keynote address on Wednesday Space Exploration,” detailed how in spacesuits and living in confined evening in an event that was open she and her fellow researchers from quarters as they would in a real to the public. around the globe were working to Mars mission. All of the speakers volunteered solve the many logistical problems The scientist concluded by their time. presented by a future manned mis- encouraging students to test the “This is what’s so cool about sion to Mars. waters of many different fields this,” said Patty Einerson, an event Heldmann began by telling the through internships. If students in organizer and parent of a Los Altos students that all the work she does the audience found a career that student. “We’re in the heart of Sili- is dependent on math. “Every single they enjoyed, she said, they would www.ycis-sv.com con Valley, so all these resources are day in my job I use those concepts, be on the right track to living a right at our doorstep.” those key themes that you learn in productive happy life. class — you actually apply them.” “I’m not going to say it’s all fun The science of speed But, she explained, math and and games, because it is a lot of Rosenbaum, a Los Altos Hills rocket science aren’t the only tools work,” said Heldmann, who was resident and owner of Spectre NASA needs to plan and execute speaking to the students on her Performance, an automotive air planetary exploration. Heldmann lunch break. “But you’ll actu- filter company, wheeled his rocket- and her team devote much of ally look forward to getting up and shaped speed car out behind Eagle their time to trying to figure out going to work.” Theater at lunch on Tuesday, Oct. where future explorers might find John Hershey, a senior who 19, and fired it up. The roaring drinkable water on the red planet. attended Heldmann’s lecture, isn’t engine lured students in for a closer If NASA can identify a source of interested in working for NASA, look. potable water for its astronauts, but he said Science and Tech Week “What is that?” one student asked future Mars missions could save has made him realize that his in astonishment, and ran off to find fuel by packing less water. Scien- academic career thus far has been his friends. tists know water is there, but where building toward a career. That, according to Rosenbaum, is exactly that water is, and how to “I really enjoy it,” Hershey said. “I the only gasoline-powered vehicle access it, is another matter. like seeing that the work I do in high to drive faster than 400 miles per Figuring that out requires a school can be used outside of hour. He is only the 12th person to multitude of scientific disciplines: school.” V

MEASURE T lease the store’s land for a 200-unit would be illegal. He said the Continued from page 1 apartment complex, Tod Spieker developers were interested in ($1,000) whose company now preserving the city services that Perry still questioned the manages the Regency Apartments the tax helps to fund. And the action. on Escuela Avenue, the Moun- unions were not looking to hold “I think the city paid for the con- tain View Firefighter’s Association onto their pensions, as Perry sultant with the expectation they ($2,000) and SEIU organized city claims, but may instead want to would also be paying for campaign employees ($2,500). help prevent layoffs next year and services,” Perry said. As to the Perry questioned the donations, preserve quality services. notion that Boardman donated his describing some of them as “extor- “They have projects in the city services, Perry said, “I would like tion” and “insurance money” for they are trying to sell,” Kasperzak to know if this consultant would developers. said of developers. “It’s absolutely be willing to donate his services to “It gives developers a choice of in their interest to have good other campaigns.” donating money to the yes cam- public services, good schools, Larry Tremutola is “regarded as paign or wondering whether their good streets and everything like the country’s top expert on passing project is going to get stalled by that.” difficult tax measures,” according staff,” Perry said. An informational mailer the to the firm’s website. Nothing to that effect needs city sent to residents several to be said by either side, and “I weeks ago describes the effects Campaign contributions don’t think anybody in the room of the measure. It says that if So far, the Yes on T campaign is stupid enough to need to say the measure does not pass, $1.8 has raised $8,500, said treasurer something,” Perry said. “The million in funds for core city and planning commissioner Chris city can cost developers millions services, including firefighting Clarke. Part of the funding was of dollars if they decide to drag and police, would be at risk. used to send out a campaign their heels.” Perry said the mailer was inap- mailer earlier this week. “I think the city’s zoning author- propriate use of taxpayer funds Donors to Yes on T include Regis ity should be used to extract park because it reads like a “long list Homes ($1,500) which wants money not campaign donations,” of reasons to vote yes” and uses to build several hundred home Perry added. the same language the Yes on T on Ferguson Drive, Summerhill campaign uses. Homes ($500) which is about to ‘No quid pro quo’ “The city is permitted by law build 50 homes on Grant Road, Kasperzak said there was no to put out an informational, Minton’s Lumber and Supply “quid pro quo” or expectation of ($1,000) whose owners are about to favors for the donations, which See MEASURE T, page 10

6 ■ MOUNTAIN VIEW VOICE ■ OCTOBER 22, 2010 OCTOBER 22, 2010 ■ MOUNTAIN VIEW VOICE ■ 7 -PDBM/FXT Out of Africa, into the theater AFRICAN FILM FESTIVAL AIMS TO SHOW AUDIENCES A NEW SIDE OF THE CONTINENT By Nick Veronin Nwoffiah, a native Nigerian Through the film festival, who has been living on the which is open to all ages and hen the West hears Peninsula for 22 years, says he will show feature-length films, about Africa, the is constantly explaining Africa shorts and animation, Nwoffiah Wnews is often bad: to others and is often surprised hopes audiences will get a much bloodthirsty guerillas, genocide, by how little people understand more accurate cross-section of starvation, disease. It’s either about his homeland. Africa than they may have been that, Chike C. Nwoffiah says, “There’s this sense of this exposed to in the past. The films or the cameras funnel images monolithic Africa,” says Nwof- come from all over the conti- of tribal people digging with fiah, an actor and filmmaker nent, he says. sticks, barefoot, living as their “You’re talking about almost a ancestors have for millennia — billion people with a multiplic- framing the continent as one ity of languages and cultures giant anthropological study in Nwoffiah says he and religious beliefs,” he says. antiquity. CSMA is proud to host the That is not the story attendees has been frustrated event, says spokeswoman Evy of the first-ever Silicon Valley Schiffman. African Film Festival will hear, by how Africa is “Film is certainly one of the Nwoffiah says. most powerful ways that people “All of that stuff is still Africa. portrayed in film. can be educated about the world No one is disputing it. The only and multiculturalism,” Schiff- thing we are trying to say is that man says. is not the only Africa,” he says. who also teaches African history Members of the Mountain The festival, which runs this at Menlo College. He says some View City Council will attend weekend, Oct. 23 and 24, at the of his first-time students enter and the city is commemorat- Community School of Music his class thinking Africa is a ing the event by declaring it to and Arts is co-hosted by Nwof- country. be “Silicon Valley African Film Among the 30 films to be shown at the Silicon Valley African Film fiah’s own Oriki Theater. The For some time now, Nwoffiah Festival Weekend.” Festival are “The Essence,” an animated short from Nigeria and festival will show 30 films from says, he has been frustrated by The non-profit Oriki The- “Wrestling Grounds,” a feature film from Senegal/Burkina Faso. 16 African countries. Nwoffiah how Africa is portrayed in film ater melds performance, dance, says he hopes the films will give and throughout the media. “I music and art with educational munity about African culture. The festival will open Satur- audiences a “better understand- think there is a need for us to do programs aimed at teaching Nwoffiah founded Oriki in day at 11 a.m. with a “Parade of ing of Africa and its people.” something,” he says. students and others in the com- 1992. Nations,” which will showcase Through trips to local class- native dress, flags, African music rooms, stage productions and and drumming. Films will be events like this weekend’s film screened in the Finn Center of festival, Nwoffiah aims “to the Community School, located tell the story of the hopes and at 230 San Antonio Circle in dreams of Africa and to bring Mountain View. Tickets range +IRIVEXMSR%KIPIWW the voice of Africa to the people from $5 to $30. of Silicon Valley.” More information can be 0SRKIZMX]ERHXLI&SSQIVW So far, he says, “the response found at www.svaff.org or by 'SRWIUYIRGIWJSV3YV;SVPHERH3YVWIPZIW has been overwhelming.” calling 415-774-6787. V

7EXYVHE]3GXSFIV`¦EQ 1ETPIW4EZMPPMSR7XERJSVH9RMZIVWMX]`[[[WXERJSVHIHYVSYRHXEFPI REQUEST FOR PROPOSALS (RFP) FOR WIRELESS INFRASTRUCTURE SYSTEMS

The Mountain View – Los Altos Union High School District invites proposals from qualified firms to provide design and installation of Wireless Infrastructure Systems at Mountain View HS, Los 8SQ&VSOE[ .SLR0,IRRIWW] 0EYVE0'EVWXIRWIR 7ERHVE(E] &EVV]6ERH 7LIV]P7ERHFIVK 6SFIVX7ETSPWO] 7TIGMEP 4VIWMHIRX7XERJSVH (MVIGXSV7XERJSVH 3«'SRRSV ')3%%64 '33*EGIFSSO 4VSJIWWSVSJFMSPSK] Altos High School, Alta Vista High School and the District Offices. 'SVVIWTSRHIRX 'IRXIVSR0SRKIZMX] %WWSGMEXI.YWXMGI RIYVSPSK]ERH 2&'2);7 4VSJIWWSVSJ 977YTVIQI'SYVX RIYVSPSKMGEP Interested Responders should request a detailed RFP from: TW]GLSPSK] VIXMVIH WGMIRGIW

*VSQJEQMP]H]REQMGWXSXLIKPSFEPIGSRSQ]XLIKVE]MRKSJXLIFSSQIVKIRIVEXMSR[MPP Steve Hope, Associate Superintendent Personnel & Technology MQTEGXIZIV]EWTIGXSJWSGMIX];LEXMWRI\XJSVFSSQIVWERHXLIKIRIVEXMSRWXLEXJSP Mountain View-Los Altos Union High School District PS[MRXLIMV[EOI# 1299 Bryant Avenue %WXLITPERIX«WTSTYPEXMSRWYVKIWXS[EVHWFMPPMSRMRSYVWLIIVRYQFIVW[MPP Mountain View, CA 94040 I\IVXXVIQIRHSYWTVIWWYVISRVIWSYVGIWMRJVEWXVYGXYVIWERHXLIEFMPMX]SJPIEHIVWXS Phone: (650) 940-4675 EHHVIWWXLIMWWYIWSJXLIQEWWMZIWLMJXMRHIQSKVETLMGW Email Address: [email protected] 0MZMRKPSRKIVERHFIXXIVQE]FIXLIFMKKIWXGLEPPIRKIER]MRHMZMHYEPFSSQIVJEGIWFYX All proposals must be received by 4:00 pm, November 1, 2010. XLIKPSFEPMQTPMGEXMSRWSJEREKMRK[SVPHTSTYPEXMSREVIIUYEPP]HEYRXMRK*I[MWWYIW EVIEWYRMZIVWEPERHGSQTIPPMRKMRXLI[SVPHERHMRSRI«WS[RPMJI This is not a formal request for bids or an offer by the Mountain View – Los Altos Union High School District to contract with any 3TIRXSXLITYFPMGERHLIPHMRGSPPEFSVEXMSR[MXL7XERJSVH6IYRMSR,SQIGSQMRK party responding to this request. The Mountain View – Los Altos 8MGOIXWEZEMPEFPIJSVIEGLEXXLI7XERJSVHXMGOIXSJ´GI 7XYHIRXWJEGYPX]ERHWXEJJQE]SFXEMRJVIIXMGOIXW[MXL-(GEVH Union High School District reserves the right to reject any and all 4EVOMRKMWPMQMXIHWSGSQIIEVP]SVYWITYFPMGXVERWTSVXEXMSR proposals. 6IYRMSR,SQIGSQMRKTEVXMGMTERXW[MPPFIEHQMXXIH[MXL6IYRMSRREQIXEK

8 ■ MOUNTAIN VIEW VOICE ■ OCTOBER 22, 2010 -PDBM/FXT Roller & Hapgood & Tinney LEAGUE DEBATE Continued from page 5 The Peninsula’s Premier efit analysis” of using city funds Funeral Service would be the only financially responsible way to decide whether The Bowman program builds and Cremation Provider the effort is worthwhile. confidence, creativity and Serving all faiths since 1899 What to do with Wo’O? academic excellence. Offering Pre-need Arrangements Wo’O of Ideafarm has become a thorn in the side of the police +
"#'

$)


 980 Middlefield Rd, Palo Alto, California 94301 department — officers arrested (650) 328-1360 him twice last month. For years, $$
"#'

$)


the homeless libertarian has www.rollerhapgoodtinney.com parked his vehicles, usually cov- $$*-$
)%$#$
(& ered with incendiary messages, Se Habla Español Funeral Home FD132 along El Camino Real and Castro !#'

$
#**
)*$) Street. Candidates were asked Thursday how they would handle 
))
((#' Do You Suffer From him, with the challengers ques- tioning the incumbents’ support "%'
%#, Cancer-Related Bone or Tissue Pain? for the arrests. El Camino Hospital and UCSF are seeking adult patients who have cancer-related Police arrested Ideafarm twice +
)*$#'
 pain in their bones or tissues for a research study to determine the effectiveness of a in September for trespassing, program to help patients and family caregivers manage cancer pain. once for sitting in an empty room www.bowmanschool.org in City Hall and another time Participants will receive education in their homes regarding their pain medicines, 










   for staging a sit-in that officials pain management, and techniques for managing side effects. say blocked the police station’s records window while Ideaf- You may be eligible to participate if you: UÊ
ÀiÊ>}iÊ£nʜÀʜÛiÀ arm read a book about the First UÊ >ÛiÊV>˜ViÀ‡Ài>Ìi`Ê«>ˆ˜ÊÊ­iÝVÕ`ˆ˜}ʘiÀÛiÊ«>ˆ˜®Ê Amendment. Now police want UÊ
LiÊ̜ÊÀi>`]ÊÜÀˆÌiÊ>˜`Êëi>ŽÊ ˜}ˆÃ his “doghouse” — a bicycle trailer he sleeps in and posts messages Participants will be reimbursed for their time. on — off of public property. It was To see if you are eligible or to learn more, call: parked in front of City Hall as the Follow us on Twitter debate went on inside. UCSF Cancer Pain Management Research Office The incumbents sided with 415-476-4516, Ext. #1 police, saying that it wasn’t the twitter.com/mvvoice free speech issue Ideafarm was making it out to be, although some of his messages are racist, Stiffer joints make it painful to move,run or play. Try said Mayor Bryant. It was a safety issue, they said. Cosequin®, the #1 Vet recommended joint supplement. “I don’t believe it’s because C of free speech,” said Abe-Koga, osequin® plays an important role in maintaining although “some of the messages optimal joint function. Healthy cartilage is crucial have been offensive. The real issue CITY OF MOUNTAIN VIEW for proper joint mobility. Cosequin helps support has been in terms of safety. I’ve cartilage production and protect existing cartilage seen many cars almost hit him. NOMINEES FOR PUBLIC OFFICE AND from breakdown. Cosequin allows your pet to enjoy Our staff has been talking to MEASURE T their everyday activities. him, warning him. Prosecution NOTICE IS HEREBY GIVEN that the following persons have been is a last resort. He has repeatedly - Cosequin® Available at - nominated for the offices noted below to be filled at the General OFF come forward with something to Municipal Election to be held in the City of Mountain View on Tuesday, 1/2 instigate” the conflict. your next office November 2, 2010: visit fee “At some point you have to make ($21 Value - With This Ad) a call and we just have to do that.” CITY COUNCIL (3 seats) (listed in the order as they will appear on Expires 12/31/2010 Siegel agreed, saying that Idea- the ballot as a result of the randomized alphabet drawing conducted Wellness Services include: farm’s doghouse almost caused by the Secretary of State): Heartworm/Tick Disease Testing several accidents at El Monte and Flea Control El Camino Real, and that he wit- DANIEL BRIAN WAYLONIS Vaccinations nessed junior high students almost RONIT BRYANT Year-round Parasite Prevention being hit by a car because of it. AARON JABBARI Dentistry & Oral Surgery “He wants to disrupt our daily JAC SIEGEL Surgical Services lives,” Siegel said. Police “tried MARGARET ABE-KOGA Spay & Neuter everything in the world to reason GREG DAVID with the guy and didn’t get any- Fecal Parasite Exams where.” Microchipping MEASURE T: Geriatric Pet Care (650) 969-8555 Waylonis and David disagreed. AlpineVetOnline.com Waylonis said it sounded like Without increasing the tax rate residents and businesses Health Certificates For Travel currently pay, shall the City of Mountain View adopt police were looking for a conve- YES Dr. Rebecca McClellan D.V.M. Dr. Tyler Long D.V.M. nient way to put him jail. an ordinance to update its Utility Users Tax, that would “He sounds harmless and ensure equal treatment of taxpayers regardless of benign,” Waylonis said. “Leaving telecommunications technology used and provide funds to this guy alone might be better preserve essential services including: fire protection; rapid than fanning the flames.” emergency response and crime prevention; library hours and services; gang prevention programs; and maintenance SPEAKING UP THE In the two incidents where he NO was arrested, “he was not violent, of city parks, playgrounds and athletic fields; with SINCE 1992 he wasn’t threatening,” David independent audits and all revenue staying in Mountain said. If police “left the guy alone View? he probably would have gone WANDA WONG, CITY CLERK (ACTING) away.” V OCTOBER 22, 2010 ■ MOUNTAIN VIEW VOICE ■ 9 -PDBM/FXT

MEASURE T Continued from page 6

Let us provide daytime care unbiased piece,” Kasperzak said. “Perry is entitled to his opinion. for your aging loved one The fact of the matter is that the current tax provides $1.9 million and that $1.9 million helps pay ♦ Daily Health Monitoring ♦ Therapies for a number of things. Is listing ♦ Exercise ♦ Gardening those things advocacy? It’s a fac- ♦ Arts ♦ Nutritious Lunches tual statement.” As to Perry’s remarks in general, ♦ ♦ Socializing Local Transportation “It’s hard to argue against the ♦ Music ♦ ... and more! negative,” Kasperzak said. “People can argue all the innuendo they want. If somebody wants to find a boogeyman, somebody can go out and find a boogeyman. But you have to take people at their ANDREW LUCK OWEN MARECIC Th e Family Choice for Adult Day Care word, I believe.” V 270 Escuela Avenue, Mountain View, CA 94040 (650) 289-5494 www.avenidas.org PLANNING Call for your free tour today! Continued from page 5 mission should be doing more but I don’t hear a lot of people saying that the system isn’t working.” Other council members said David Ramadanoff that giving decision-making presents authority to the commission could help streamline the plan- ning process by reducing the FIGHT-TO-THE-FINISH Master Sinfonia “duplication” of effort among Chamber Orchestra the various bodies that govern 3-GAME PLANS START AT $69! planning in Mountain View. Presenting While the commission may be “London Plus” able to approve certain projects, most agreed that such decisions Handel Water Music Suite No. 2 should be able to be appealed for Next Home Game October 23 – 2:00 PM Tickets: a City Council decision on the Martin Concerto for 7 Wind Instruments, matter. stanford vs. WASHINGTON STATE Gen Admission $20 Timpani, Percussion, and Strings The commission and city staff are expected to return to the coun- Don’t miss the FREE pregame Fan Fest! Seniors (60+) $16 Haydn Symphony No. 103 in E-flat cil at some point with specific Youth $5 major “Drum Roll” proposals for expanding the com- mission’s powers. Currently the OFFICIAL GAME SPONSOR Saturday, October 23 at 8:00 pm commission is busy with its most Valley Presbyterian Church ambitious undertaking as of late, (Reception as it reviews a voluminous update This ad sponsored by 925 Portola Rd., Portola Valley Ginny Kavanaugh and follows) to the city’s general plan, a blue- Joe Kavanaugh print for future development city- of Coldwell Sunday, October 24 at 2:30 pm wide. Because of that, and the fact Banker, Portola Valley. Los Altos United Methodist Church that there are “really good people” GET TICKETS BY CALLING 1-800-STANFORD Visit them at 655 Magdalena (at Foothill Expressway) on the commission right now, OR VISIT GOSTANFORD.COM www.thekavanaughs. Los Altos council members said the timing com was right to give the commission new responsibilities. V

Manjul E. Dixit, MD Manjul S. Dixit, MD, FAAAAI has moved her practice from Menlo Medical Clinic to Atherton Square. Convenient hours 12 pm-8pm and ample parking. 3ERVICES)NCLUDEs!LLERGIC2HINITISs!STHMAs&OOD!LLERGYs#OUGHs#ONGESTION s,ATEXs(EADACHESsANDMUCHMORE Please visit our website @ www.AthertonAllergists.com %L#AMINO2EAL 3UITEs!THERTON #!   s  FAX www.AthertonAllergists.com

10 ■ MOUNTAIN VIEW VOICE ■ OCTOBER 22, 2010 -PDBM/FXT

Larry Trotter checks out the giveaway table at Minton’s, where everything is being sold or auctioned off in the next few weeks. MICHELLE LE

October to the day before the older.” MINTON’S Nov. 9 auction. The store has history back to Continued from page 1 “The hardest part is having 1897 when it opened as a branch to lay off people because we are yard for Parkinson Bros. Lumber closing,” Shulz said. “They are and Hardware. It was purchased ily for 75 years. like my brothers.” in 1911 by Earl Minton, who Having the property stay in the The average Minton’s employee changed its name. Shulz’s father, family was Shulz’s father’s one has worked there 25 years, she Herbert Eaton, bought the com- wish, she said. “We want to hang said. pany in 1965 after managing the on to the property as long as pos- “Through the 70s, 80s and the business for Minton. V sible.” early part of the 90s, we were Shulz said that items may begin able to run a profitable business,” E-mail Daniel DeBolt at appearing on an auction website, Shulz said. “And I felt we were [email protected] dgwauctioneers.com, within the really able to make an impact on next few days. “Anything that’s the market and provide a service here we have to get rid of it,” you don’t get when you go to a Shulz said. warehouse-type store. But price That includes a small vehicle is just a big factor right now. fleet, the cutting equipment in There is an enormous amount the woodshop and tons of lum- of inventory these stores carry ber, tools and supplies. and they can price it a lot lower. The store doesn’t have a firm Young homeowners are looking closing date. Shulz said it could for the best possible price. Our be anywhere from the end of clientele, I noticed, got older and

The vision, skills, and passion to guide Mountain View into the future

U.S. EPA COMPLETES THIRD FIVE-YEAR REVIEW OF CLEANUP AT CTS PRINTEX SUPERFUND SITE
t
"
HSFFO
BOE
TVTUBJOBCMF
DJUZ The U.S. Environmental Protection Agency (U.S. EPA) has completed the third Five-Year Review of the cleanup of the CTS Printex Superfund site in Mountain View, California. The
t
"
CBMBODFE
CVEHFU purpose of the Review was to evaluate the implementation and effectiveness of the cleanup over the last fi ve years to ensure it remains protective of human health and the environment.
t
%FWFMPQNFOU
POMZ
XIFSF
JU
m
UT The two main fi ndings are 1) Operation of the remedy selected in the 1991 Record of Decision (ROD) – groundwater extraction and discharge to the sanitary sewer system – was
t
&OIBODFE
TFSWJDFT
GPS
PVS
ZPVUI discontinued in 1996. Based on current groundwater sampling data, concentrations of volatile organic compounds (VOCs) remain above cleanup levels; and 2) The 1991 ROD did not address institutional controls (ICs), which restrict land and groundwater use, or the potential for
t
4USPOH
GPDVT
PO
B
)JHI
4QFFE
3BJM
TPMVUJPO
vapor intrusion (VI) of contaminants into structures. Subsequent work to address these issues has been implemented but not included in the ROD. Subsequent work includes the recording

UIBU
XPSLT
GPS
PVS
DJUZ of an environmental restriction covenant and the VI mitigation measures implemented as part of the construction of residential units on the former CTS Printex property. Endorsements Conclusions of this third Five-Year Review for the site fi nd the remedy at the CTS Printex site currently protects human health and the environment. An environmental restriction covenant was recorded to prevent potential exposures to contaminated groundwater and impacted air from subsurface vapors. This institutional control (IC) restricts groundwater t
4JFSSB
$MVC

$BMJGPSOJB
-FBHVF
PG
$POTFSWBUJPO
7PUFST
4$$ use and requires vapor intrusion (VI) mitigation systems to be installed, operated and maintained at residential structures overlying the former CTS Printex property. However, t
.PVOUBJO
7JFX
$IBNCFS
PG
$PNNFSDF in order for the remedy to be protective for the long-term, an amendment to the 1991 ROD needs to be issued to address remaining groundwater contamination and the need for t
4BOUB
$MBSB
$PVOUZ
%FNPDSBUJD
1BSUZ ICs and VI mitigation measures. Over the next year, EPA will prepare a proposed plan describing the proposed changes to the ROD followed by a 30-day public comment period. t
'PS
NPSF
TFF
XXX3POJU#SZBOUPSHFOEPSTFNFOUT Information Repository: U.S. EPA maintains an information repository that contains the site Administrative Record and other materials including the third Five-Year Review Report. It is located at the City of Mountain View Public Library, 585 Franklin Street, Mountain View, California Please visit my website 94041, (650) 903-6337. Additionally, site documents are located at the EPA Superfund Records Paid for by Center, 95 Hawthorne St. (4th fl oor), San Francisco, CA 94105, (415) 820-4700. Ronit Bryant for Mountain If you would like to contact a U.S. EPA staff person about the CTS Printex site, please get in touch with Vicki Rosen, Community Involvement Coordinator, (415) 972-3244 or by email at rosen.vicki@ View City Council 2010 epa.gov . Additional information is available on EPA’s website: www.epa.gov/region09/ctsprintex FPPC # 1328216

OCTOBER 22, 2010 ■ MOUNTAIN VIEW VOICE ■ 11 -PDBM/FXT

Mountain 1704 Miramonte Ave., Suite 6, Mountain View   swww.genacu.com View man was dedicated to education, craft

By Nick Veronin lmer Campbell, a longtime Jungho Jang, MSOM Chinese Medicine Mountain View resident and of Beijing University SERVICES Ea trustee for the Whisman UN Oriental Medicine Unit Elementary School District for 22 s Acupuncture years, died of cancer Sept. 29 at the s Beauty Acupuncture age of 91. s Herbs Campbell was born in Detroit but moved to the Peninsula as a s Cupping youth, where he graduated from s Diet/Nutrition Palo Alto High School. He married Virginia Thomason in 1941 and s Non-invasive worked as a supervising ship fitter Olivia J. Jung, MSOM in San Francisco during World Samra University We accept most War II. In 1950, the couple settled of Oriental Medicine HMO, PPO and Kaiser in Mountain View, where they NCCAOM Certifi ed raised five children and Campbell worked as a general contractor, building homes all over the Pen- CUSTOM SOLUTIONS FOR EVERY insula and in Santa Cruz. STYLE AND EVERY BUDGET He was elected to the Whisman Elementary School District board of trustees in 1955, and served there for 22 years; he was elected presi- dent of the board multiple times. “He was very dedicated to get- ting good things for children,” said Joan MacDonald, who served with Campbell on the Whisman board for 13 years. “He was really selfless. He gave and gave and gave his time and his energy and his love.” In 1969 Campbell was chair of the school board when it was named the best school district in the south- western region by the Association of Classroom Teachers, part of the National Education Association. During difficult economic times, in the mid ‘70s, Campbell fought alongside his fellow board members to preserve school pro- grams, MacDonald said. “He felt strongly that education was the most important thing that com- munities could offer to children.” Join us at... “We were very blessed to have Join us at... him here that long,” said his daugh- MountainMountain ViewView ter, Lisa Sewell. She said her father CommunityCommunity CenterCenter lived a very long and full life and 201 S. Rengstorff Ave. had been fairly active until recently. 201 S. Rengstorff Ave. Even after he was not as capable CallCall (650)(650) 903-6331903-6331 physically, Sewell said, his mind $500 for more information ——— OFF ——— for more information remained sharp. “He was kind of like a ‘Car Talk’ MUST ACT BEFORE 11-15-10 guy for contractors,” Sewell said,

MINIMUM $5,000 PURCHASE. comparing Campbell to the hosts SOME RESTRICTIONS APPLY. of the popular automotive call-in show. She said that family and friends would regularly call up OUR PENINSULA SHOWROOMS HAVE CONSOLIDATED. Campbell for advice on how to make home repairs, fix electrical VISIT US AT OUR NEWLY EXPANDED AND RENOVATED 5:45 P.M. problems or install a sink. CAMPBELL SHOWROOM. THE BAY AREA’S LARGEST! “He did everything except CERTIFIED GREEN masonry,” Sewell said. He is survived by his wife, Vir- CAMPBELL SHOWROOM 1190 DELL AVENUE ginia, who recently turned 90, WWW.VALETCUSTOM.COM 408.370.1041 and four of his five children. A 





FORMERLY EURODESIGN memorial service was held at the Soquel cabin that Campbell built HOME OFFICES MEDIA CENTERS after he retired in 1988. V WALL BEDS CLOSETS GARAGES

12 ■ MOUNTAIN VIEW VOICE ■ OCTOBER 22, 2010 -PDBM/FXT

PROMETHEUS very least, we should at most pay for Continued from page 1 the Pinto.” Kulman said he wanted a 30-per- cent reduction in rent or to have Pro- crap? I don’t think so. I just called metheus pay his moving expenses. Follow us on Twitter the Hearing Loss Association of Standard said Prometheus was twitter.com/mvvoice America and we’re going to have a willing to sit down with residents conversation.” like Kulman to talk about compen- In other videos, Kulman opens his sation but would not go into specifics door to the sounds of high-pitched beyond helping people out of their electric saws and hammers right leases and buying lunch or a movie. outside his door. He complains He added that facilities were set up about the smell of port-a-potties at Park Place North where residents 7HATSCHOOLISMEANTTOBE emanating from the parking garages like Kulman could “work and relax” below the apartments. Construc- and avoid the daytime noise. tion workers walk around in hard Despite the complaints, three hats right outside his door. Kulman large moving trucks were parked wonders if he shouldn’t have on of on High School Way in front of his own, along with a dust mask. Park Place on Friday. Movers were Prometheus also manages the moving people into the complex, massive Americana apartment not out of it. complex behind Camino Medi- One new resident dismissed the cal Group, where numerous ten- complaints. “What are they going ants protested roof work in 2007 to do, not fix it?” that showered home interiors with “That shocks me,” Kulman said. asbestos dust. At least one tenant “I never would have chosen to live was awarded damages from Pro- here if I had known. I know a num- metheus in small claims court. ber of people have moved out.” “Our chief complaint is that the Prometheus recently gained City management did not disclose the Council approval for a project to extent of the renovation yet con- build 200 apartments at the site of tinues to refuse to lower the rent Minton’s Lumber and Supply on to compensate for all the problems Eleven Avenue. #HALLENGING%NGAGING*OYFUL it causes,” said Park Place resident The project is scheduled for Rob Smith in an e-mail. completion on Nov. 19, Standard -IDDLE3CHOOL/PEN(OUSEPM PM “In my mind, they leased us a said. Updates on the project are 5PPER3CHOOL/PEN(OUSEPM PM BMW, and then gave us a Pinto,” posted by Prometheus at tinyurl. Kulman wrote in an e-mail. “At the com/parksouth. V 
7BMQBSBJTP
"WFOVF
"UIFSUPO
$"

t

sXXXNFOMPTDIPPMPSH

Paid for the Committee to Re-elect Jac Siegel for Mountain View City Council FFPC# 1327317

OCTOBER 22, 2010 ■ MOUNTAIN VIEW VOICE ■ 13 Shop Local Good for Business. Good for You.

Discover and enjoy Good for the Community. the rich diversity of Mountain View businesses at ShopMountainView.com, the new online guide to all When you shop locally, good things happen to make our community stronger: local businesses featuring t Sales tax dollars, which fund schools and local t You reduce your carbon footprint by not driving listings, customer opinions, services, stay in the community. outside the community to shop. web links, photos, maps, t You help to sustain the unique and diverse businesses t And when you shop at locally owned businesses, coupons, special deals, gift that make our shopping areas vibrant. you also support our friends and neighbors who are certifi cates, promotional running these businesses, donating to community t You show how much you value the expertise event listings and events and causes, hiring our kids and getting of these businesses and the quality service they involved in making Mountain View a better place. much more. off er their customers.

Introducing

ConnectingSupport local residents Local with Business local businesses

Learn more about the value of locally owned businesses at ShopMountainView.com

ShopMountainView is also available in a mobile version.

A community collaboration brought to you by

For more information call 650.223.6509

14 ■ MOUNTAIN VIEW VOICE ■ OCTOBER 22, 2010 ■ EDITORIAL ■ YOUR LETTERS 7JFXQPJOU ■ GUEST OPINIONS NEDITORIAL NGUESTOPINION THE OPINION OF THE VOICE Founding Editor, Kate Wakerly Why you should vote yes on E NSTAFF Good, bad in state propositions By Craig Goldman the specialized math, science and Publisher he Voice analyzed selected state propositions that will be on the and Barry Groves engineering skills needed to begin a Tom Gibboney Nov. 2 ballot. Look for more next week. (The Voice endorsed successful career in our demanding local Measure T and Measure E last week.) t’s no secret that succeeding local job market. Editorial T in the Silicon Valley economy Managing Editor Andrea Gemmet Local demand for community requires a top-notch education. college courses is increasing as Staff Writers Daniel DeBolt, Nick Veronin PROPOSITION 20: VOTE YES I The best and the brightest from all University of California (UC) and Photographer Michelle Le emoves elected representatives from establishment of congres- over the world come here to work California State University (CSU) Contributors Dale Bentson, sional districts and gives that authority to a bipartisan 14-mem- and our residents must be prepared Angela Hey, Sheila Himmel, campuses turn away more and Jennifer Pence, Monica Schreiber ber redistricting commission. to compete for jobs. more high school graduates each R At Mountain View’s elementary, year. UC and CSU have raised Design & Production PROPOSITION 27: VOTE NO middle and high schools, we strive tuition substantially, making a Design Director Raul Perez to give our students a strong foun- four-year university education too liminates 14-member state redistricting commission and returns Designers Linda Atilano, Gary Vennarucci dation in math, science and writing expensive for many students and redistricting authority to elected representatives. so the students are prepared for the Advertising their families. Between 2005 and Propositions 20 and 27 are about how state legislature and next step in their education. 2009, the number of Mountain Advertising Representatives E Upon graduation, many of our Anna Mirsky, Brent Triantos U.S. House of Representatives voter districts in California should be View Los Altos high school district students go on to Foothill College Real Estate Account Executive drawn up — by a bipartisan independent panel, or by incumbent students who entered Foothill Col- Rosemary Lewkowitz politicians. Voting districts are redrawn after every 10-year census. In and De Anza College, which con- lege or De Anza College increased Real Estate Advertising Coordinator 2008, California voters passed Proposition 11, which took the redis- sistently rank among the best com- by 29 percent. Samantha Mejia munity colleges in the nation. Foot- tricting of the state Assembly, Senate and Board of Equalization out At the same time as demand for hill and De Anza are an important of the hands of the Legislature and gave the authority to a 14-member community college courses is ris- Published every Friday at stepping stone to transfer to top 450 Cambridge Avenue Citizens Redistricting Commission to be established once every 10 universities and a place to learn Palo Alto, CA 94306 years, with five Democrats, five Republicans and four others, to redraw See GUEST OPINION, page 16 (650) 964-6300 fax (650) 964-0294 the districts based on the latest census — while keeping the integrity of E-mail news and photos to: geographic boundaries and respecting city, county and neighborhood NLETTERS [email protected] limits. VOICES FROM THE COMMUNITY E-mail letters to: [email protected] Prop. 11 didn’t affect the lines of the congressional districts — and provide plenty of challenges News/Editorial Department Proposition 20 seeks to bring those under the purview of the Citizens BECKER IS BETTER FOR needing attention for this $300 (650) 964-6300 Redistricting Commission, as well. WATER BOARD fax (650) 964-0294 million district. Lou Becker’s Proposition 27, meanwhile, is a proposal to throw out the Citizens Display Advertising Sales Your endorsement of Brian real world business experience, (650) 964-6300 Redistricting Commission altogether and stick with the old ways for Schmidt for a new seat on the including 10 years on the Water Classified Advertising Sales both the state Legislature and U.S. Congressional districting. Santa Clara Valley Water Dis- Commission, makes him the   s   trict is puzzling, since he has FAX   It’s no act of brilliant political insight to suggest that it’s probably not logical choice. As a seasoned the best idea to have legislators influencing their own district boundar- nowhere near the qualifications leader with 12 years on the Los E-mail Classified [email protected] needed for this important job. E-mail Circulation [email protected] ies — or those of their fellow party members. Altos City Council, he knows The district already has one how to listen to the public and The Voice is published weekly by Embarcadero lawyer on the board, and needs Media Co. and distributed free to residences and PROPOSITION 21: VOTE YES how to get things done. businesses in Mountain View. If you are not someone with real world man- Daniel Seidel currently receiving the paper, you may request stablishes $18 annual vehicle license fee to help fund state parks agement and engineering expe- free delivery by calling 964-6300. Subscriptions Los Altos Hills FORPERYEAR PERYEARSAREWELCOME and wildlife programs. rience, not another lawyer. The #OPYRIGHT¥BY%MBARCADERO-EDIA California’s state parks are the frequent target of funding cuts issues Brian identified, such Company. All rights reserved. E as directors’ pay and meeting — and last year park goers felt it in a big way, as 150 of our 246 state- CONCERNED BY CITY’S Member, Mountain View Chamber of Commerce times, are miniscule compared operated parks suffered deep reductions in services and hours of opera- LOSS OF BIRD HABITAT tion. This $18 vehicle registration “surcharge” would create about $500 to dam safety, flood protection, unfunded retirement obliga- million in revenue for the parks. Of that amount, 85 percent would I’m writing due to my concern for tions, and safe, reliable water the bird species that have managed go to park operations and most of the rest toward wildlife protection supplies. programs. In return, all registered vehicles would receive free daytime Recent grand jury reports See LETTERS, page 16 parking at all state parks.

NWHAT’S YOUR VIEW? PROPOSITION 22: VOTE YES All views must include a home address and contact phone number. Published letters will also appear rohibits the state from diverting funds intended for transporta- on the web site, www.MountainViewOnline.com, tion, redevelopment or local government projects. and occasionally on the Town Square forum. In its farcical triage of annual budget balancing decisions, the TOWN SQUARE FORUM P state often shifts funds away from their intended local targets to help POST your views on the Town Square forum at pay for things the state deems more pressing. For instance, cities’ trans- www.MountainViewOnline.com portation and redevelopment funds have been unilaterally raided dur- E-MAIL your views to ing fiscal crises to help pay for other state budget needs. Proposition 22, [email protected]. Indicate among other things, would eliminate the state’s ability to use fuel-tax if it is a letter to be published. revenue for non-transportation purposes, and prohibit the state from MAIL to: Editor Mountain View Voice, borrowing local property tax funds to pay for schools. While we don’t P.O. Box 405 like the trend toward protecting an ever-growing list of services from Mountain View, CA 94042-0405 cuts through ballot initiatives, we also object to the Legislature seizing CALL the Viewpoint desk at local funds instead of legitimately balancing the state budget through 964-6300 tax increases or reduced expenses. OCTOBER 22, 2010 ■ MOUNTAIN VIEW VOICE ■ 15 7JFXQPJOU

GUEST OPINION Continued from page 15 success ing, Foothill College and De Anza College have been forced to reduce course offerings and eliminate hun- dreds of full- and part-time faculty and staff positions due to more than $20 million in state funding cuts. Thousands of students could not get the courses they need. With pride more state budget deficits expected, this problem will only get worse. This November we can preserve access to affordable job training and higher education by voting yes on Measure E for the Foothill De Anza Community College District. Measure E will provide stable family spirit funding for our colleges that cannot be taken away by the state. Measure E will fund core academic classes, including math, science and writ- ing; training for careers in health- care, nursing, paramedics, technol- ogy, and engineering; and prepara- tion for students to transfer to four-year universities. V Dr. Barry R. Groves and Craig be Goldman are superintendents, respectively, of the Mountain View Los Altos high school and Achieve Your Personal Best the Mountain View Whisman Open House Elementary school districts. October 31 9 am – 1 pm Sponsored by the LETTERS Brothers of Holy Cross www.sfhs.com Continued from page 15 to survive in spite of the incredible development of the city of Moun- SPEAKING UP tain View. SINCE 1992 It disheartens me to hear of more depletion of land for the burrowing owl due to the deal with Google and the city. It saddens me that everyone has their price, yet Follow us on Twitter: twitter.com/mvvoice with so few burrowing owls left, every bit of land counts. It’s also important to men- tion that construction and noise drives birds away. Why destroy special habitat when it is only for GET IN SHAPE a “temporary” site for Google employee recreation until a building can be raised? Google has brought many good things to Mountain View, but this lack Bounce $19.00 of respect for endangered species 14 Day Start-up, Fitness Assessment | 1 Training Session is definitely a disappointment showing a lack of ethics. Jump $39.00 As a former state Fish and Game 14 Day Start-up, Fitness Assessment | 2 Training Sessions employee working on endangered species, it also concerns me that Leap $59.00 many or all trees will be cut down 14 Day Start-up, Fitness Assessment | or removed for the Mayfield 3 Training Sessions development. I have recently seen a bird of prey frequenting the tall- Over 65 Classes per week est tree on the property, a Modesto :UMBAs0ILATESs9OGAs#OMBAT#ARDIOs3TEP ash. What did the environmental impact report say about the bird "OXINGs+ETTLEBELLSs0ERSONALs4RAININGs3PIN
populations, including humming &REE7EIGHTSs4283USPENSIONs!ND-UCH-ORE
birds and birds of prey? I have faith in the people of Mountain View to see the big MASSAGE NOW AVAILABLE picture and show respect for all liv- .OLONGTERMCONTRACTSs!LLMEMBERSHIPSAREMONTHTOMONTH ing things and not just temporary s3OMERESTRICTIONSAPPLY material gains. s.3HORELINE"LVD -TN6IEW Charlene Chow - &AM PM3AT3UNAM PM Aldean Avenue www.overtimefi tness.com 2010

16 ■ MOUNTAIN VIEW VOICE ■ OCTOBER 22, 2010 MOUNTAINVIEW VOICE ■ RESTAURANT REVIEW ■ MOVIE TIMES 8F FLFOE ■ BEST BETS FOR ENTERTAINMENT

N RESTAURANTREVIEW The Persian version BEST BITE IS A COMPLETELY DIFFERENT RESTAURANT FROM WHAT ITS NAME AND DECOR SUGGEST By Monica Hayde Schreiber Peek in the window and any est Bite is an easy restau- of these initial suspicions might rant to miss — and per- be confirmed. You’ll see about Bhaps initially to misjudge. 10 humble tables, most of them You may have driven past the booths covered in a red leather- modest El Camino building ish material, plus a few seats at hundreds of times and barely a front counter. The overall vibe noticed the place. Then there’s is “small-town diner” or even the restaurant’s name, which “retro luncheonette.” offers little indication about the But lift the veil on this quiet type of food it serves. Best Bite? little establishment and there is Is that a deli? A sandwich shop? something unexpected beneath: Look closer, however, and the centuries-old recipes fragrant neon window signs advertising with cinnamon, rose water, “gyros” and “falafel” would sug- cardamom and pomegranate; gest a pan-Mediterranean, order- savory eggplant stews and pieces MICHELLE LE at-the-counter place — maybe of charbroiled lamb served with Best Bite offers Persian dishes, such as the zereshk polo with joojeh, a charbroiled chicken entree. one of those quickie lunch spots sumac-dusted basmati rice. where you can get good, cheap Greek or Lebanese food. See BEST BITE, page 18

Experience the taste of Italia TOTHESEABREEZESOFTHE!MALlfrom COASTANDWINDINGBACKTHROUGHTHEANCIENTTOWNSOF4USCANY the 7 hills of Rome #UCINADI6ENTIHASCAPTUREDTHESOULOF)TALIANCOOKING7ETAKEPRIDEINBRINGINGYOUTHEVERYBEST 4HEINGREDIENTSARESIMPLEˆ)MPORTED)TALIANWATERFORTHEDOUGHFRESHHERBSTOBRINGOUTTHETRUETASTEOFTHE REGIONSANDEXTRAVIRGINOLIVEOILENHANCECLASSICDISHESFROMTHEWORLDSl NESTCUISINE /URLOVEOF)TALIANFOODKNOWSNOBOUNDS

Bellaowner & chefAwdisho de cuisine Join us soon and experience the taste of Italia… 4OOURVALUEDCUSTOMERS right here in Mountain View. 0IZZERIA6ENTI HASANEWNAMEREm ECTINGOURLOVE OFBRINGINGYOUCLASSICDISHESFROM THEWORLDSl NESTCUISINE—

±,A#UCINADI6ENTI² )TISINTHISSPIRITTHATWEWILL CONTINUESHARINGOURCLASSIC RECIPESWITHYOUEACHWEEK

buon appetito! a ucinaTM di Venti LAN AMERICANC TRATTORIA IN THE ITALIAN TRADITION™ 0EAR!VE -OUNTAIN6IEWs  sWWWMVPIZZERIAVENTICOM (OURS3UNDAYTHROUGH4HURSDAYˆAMTOPMs&RIDAYTHROUGH3ATURDAYˆAMTOPM

OCTOBER 22, 2010 ■ MOUNTAIN VIEW VOICE ■ 17 8FFLFOE

Yes, Best Bite turns out to be Afghanistan, Turkey and even or firmly scrambled eggs. The a full-service — and sometimes India. Heavily spiced stews called kashk bademjan ($8.99) was surprisingly spendy — Persian gheymeh are simmered with also an eggplant puree, but the restaurant. meat or beans and often comple- eggplant was sauteed rather than Best Bite, owned by Iranian- mented by fruity undertones — grilled and mixed with caramel- born Ellahe Kakhadem and her lime, pomegranate, sour cherries ized yogurt for a tangier finish. family, has been serving up plat- or prunes. Chelow kabab, a ubiq- We ate the eggplant starters ters of home-style Iranian fare uitous dish in Iran, is basmati- with the mast-o-moosir ($4.99). for 13 years. The Voice had not style rice served with charbroiled Similar to Greek tzatziki, this stopped by Best Bite since 2004, lamb, beef or chicken, and a spinach-flecked dish of rich, cool so we decided recently to revisit. grilled tomato or two. Polo is a yogurt was tangy and tasty, the We were glad we did. pilaf-like rice dish in which the perfect complement to every- While Persian food shares rice is cooked in broth and sub- thing we ate that night. During many similarities with the cui- sequently steamed with meat or the main course, I even used MICHELLE LE Best Bite’s sine of Arab countries, the food vegetables. it as a dip for the lamb kabab meerza ghaasemi is eggplant chopped with garlic and is distinct in many ways, hew- Different types of flat breads ($18.99). tomato with an egg and spices, served with lavash and fresh onions. ing more toward Central Asia, (naan) are enjoyed throughout In my opinion, the best kababs Iran with the ultra-thin, almost this side of Kandahar can be cracker-like lavash being one of found at Kabul, a longtime the most common. Lavash is one Afghani restaurant tucked away of the oldest and simplest bread in a San Carlos strip mall. recipes on the planet (flour, water Impossibly tender and embody- and salt). I’m not a fan — lavash ing all the primeval appeal of makes flour tortillas seem moist meat cooked on an open flame, and interesting — so I passed on they are the yardstick by which I the basket our waiter brought to measure all other kababs. While the table with an incongruous Best Bite’s lamb kabab was fine, it pairing of butter and raw onion. didn’t come close to thwarting its We moved quickly to the magic Afghani competition, especially that Iranians make with egg- the price. For $19, I got about plant. Two of the three appetizers six pieces of slightly overcooked we ordered were centered on the (but flavorful) lamb, a mound of aubergine and we inhaled both buttery basmati rice, and a small of them. The meerza ghaasemi grilled tomato. ($8.99) was a plate of charbroiled My friend’s gheymeh ($11.99) eggplant pureed with egg, garlic, was a bigger hit. In Iran, this stew tomato and spices. It was smoky would be considered basic, every- and fluffy, almost like a souffle day fare, but to us it was appeal-

on the Dining Town October AMERICAN FRENCH Pie Special Any Whole Pie 99 CLARKE’S LE PETIT BISTRO $6 + pie tin deposit CHARCOAL BROILER 1405 W. El Camino Real Excludes fresh fruit 615 W. El Camino Real Mtn. View & cheesecakes. Mtn. View 650/964-3321 PIZZA 650/967-0851 Casual and cozy French KAPP'S restaurant. 15 tables. Voted Best Hamburger PIZZA BAR & GRILL PRIME RIB 16 Yrs in a Row. Friday & Saturday Nights Starting at 5pm Beautiful Outside Patio Dining. 191 Castro Street Mtn. View Prime Rib Dinner 650/961-1491 starting at $15.99 includes choice of a cup of soup or house salad, ICE CREAM cornbread or garlic bread and a slice of pie for dessert (excludes CHINESE Happy Hours Mon-Fri 4pm-6pm. Fresh Fruit Pies & Cheesecakes). GELATO CLASSICO CHEF CHU’S 241 B Castro Street NIGHTLY DINNER SPECIALS 1067 N. San Antonio Road Mtn. View 6/&#:!*634&#:
;
5#35+/)
#5
1. corner of El Camino 650/969-2900 THAI All served with your choice of garlic or corn bread. Add a slice Los Altos of pie for only $2 (excludes Fresh Fruit Pies & Cheesecakes). 650/948-2696 THAIPHOON Sunday: Flat Iron Steak served with mashed potatoes & vegetables "2010 Best Chinese" 185 Castro Street Monday: Lasagna MV Voice & PA Weekly MEDITERRANEAN/ Mtn. View Tuesday: Grilled Boneless Rainbow Trout PERSIAN 650/988-1488 served with rice & vegetables $ 99 NEW TUNG KEE plus www.ThaiphoonRestaurant.com Wednesday: Braised Lamb Shank 10 tax NOODLE HOUSE BEST BITE Call about our Happy Hour. served with mashed potatoes & vegetables 520 Showers Drive RESTAURANT Thursday: Choose any Pasta Dish off our menu Mtn. View Nightly Dinner Specials not valid on holidays and cannot be combined with any other offer, discount or coupon. Valid at Los Altos location only. 650/947-8888 Falafels, Gyros and Kababs 1414 W. El Camino Real (Inside San Antonio Center) Mtn. View Voted Best Noodle House in SUNDAY (Regular price $13.99) 650/988-8895 BUY 1 GET$ 199 FREE 2003/2004 Mountain View Voice. Purchase 1 regularBRUNCH priced entrée and two beverages and receive the Meals starting at $4.75 Bring this ad in for 10% Off second entrée, of equal or lesser value,9 for free. Good for up to 2 Cannot be combined with any other offers, discounts or coupons. Not valid on Minimum $20 pre-tax purchase. discounts for party of 4. Cannot be combined with any other offers, discountsany holidays. or Validcoupons. only at NotLos Altos valid location. on any No holidays. cash value. Valid Must presentonly at Los -504
-0%#5+0/

0
%#4*
7#-6'

91+3'4
coupon.,4/3
,/ $"Expires4*/.

11/05/10./
$"3)
6",5&

80*2&3
1/5/10.  
  If you would like to be listed in DINING ON THE TOWN please call Anna or Brent at the Voice at 964-6300. 
-
#.+/0
'#-
;
04
-504
;
 
  18 ■ MOUNTAIN VIEW VOICE ■ OCTOBER 22, 2010 8FFLFOE $ GoodACUPUNCTURE Care & MASSAGE 20 MASSAGEoff OR Bring balance and harmony back to your body TREATMENT Middle Eastern desserts are the 1st visit with coupon only. We treat pain, stress, insomnia, infertility, thyroid, stuff of diabetic nightmares and Not valid with any other offer. weight issues, etc. exp: 10/31/2010 Best Bite’s sugar-and-rose water Call to make appointment today concoctions rank right up there on the sweet-o-meter. 4898 El Camino Real #202, Los Altos 650.961.0110 www.gcacu.com The baklava ($2.50) was too Best Bite chewy and so sweet my teeth regular Bryan hurt just looking at the nutty Getz takes triangles. The bamieh ($2.50), a falafel described in the menu as “a Center Cut sandwich unique Persian pastry,” was like to go. a hardened funnel cake. Rose Pork Loin Roast water and cardamom gave it an MICHELLE LE appealing flavor, but it was so Filled with prunes, ing and exotic — tiny pieces of tiny red barberries and amped hard to chew I gave up on it. We beef, lentils, cinnamon, tomato up with saffron. Barberries are also tried the bastani ($3.99), an walnuts + vegetables. and onion, all cooked with a miniscule but pack an intensely orange-pink ice cream flavored whole lime for that fruity-savory tart punch. They accompanied with saffron and pistachios. I $17.95 interplay so typical of Persian the tender chicken like cranber- couldn’t taste any saffron and Complimentary glass of house food. ries playing off turkey. even the nutty flavor of pistachio wine with mention of this ad. We also tried one of the The falafel sandwich ($6.99) is was overpowered by sugar. Exp. 10/26/2010 house specials, the zereshk polo one of the less expensive options While the desserts left us with Dinner 5:30-9:30pm with joojeh (charbroiled chicken) on the menu and among the best little more than a glucose rush, Ph: 650-964-3321 ($15.99). This rice-and-meat values — it was hefty, goopy our overall experience at Best dish was almost identical to the with hummus and tahini, and Bite was good. It can be reward- French Restaurant since 1989 kabab plates, but the rice was the falafel balls were moist and ing to look past appearances and 1405 W. El Camino Real, Mountain View, CA 94040 more interesting, flecked with flavorful. let yourself be surprised. V

NDININGNOTES FREE SINCE 1945 CHARCOAL BROILER DELIVERY Best Bite Reservations Voted “Best Burger” 1414 W. El Camino Real (with min. order) Mountain View Credit Cards for 17 years 650-988-8895 in a row Alcohol as reported in Monday-Friday, Takeout the Mtn. View Voice 11:30 a.m.-2:30 p.m. and 5- 9 p.m. Highchairs Saturday, 11:30 a.m.-9 p.m. Daily Wheelchair Access Closed Sundays Lunch Banquet Specials Catering 11am to 2pm Mon-Fri 790 Castro Street Outdoor Seating THE BEST Breakfast on Weekends Mountain View Noise Level low (1 block from El Camino) PIZZA WEST OF Open 7 days for Lunch & Dinner Bathroom Cleanliness good +0*/ &*
&"1

4

615 W. El Camino Real NEW YORK Parking street (650) 967-0851 (650) 961-6666 —Ralph Barbieri KNBR 680

ComForcare senior services®

We offer: Home Companions Personal Care Aides 24-Hour Assistants ❧ Rigorous 10-step hiring process Fast, reliable ❧ Free initial RN assessments help is always ❧ All caregivers are qualifi ed, available when experienced professionals it's needed. ❧ 24-hour care and phone assistance ❧ We do quality assurance calls 650.386.1496 www.wsantaclara.comforcare.com

OCTOBER 22, 2010 ■ MOUNTAIN VIEW VOICE ■ 19 HELLER IMMIGRATION LAW GROUP 8FFLFOE Employment-based, Family/Marriage & Investor Visas A Full-Service Immigration Law Firm Serving the SF Bay Area & Silicon Valley for 25+ years N MOVIETIMES PERM Labor Certifi cation N EB1/NIW Self-Petitions Green Cards, H1B and Work Permits Alpha and Omega (PG) Century 20: 11:20 a.m.; 1:35, 3:50, 6, 8:15 & 10:25 p.m. Engineers, IT/Computer fi elds, Scientists/Researchers HR/Corporate, Business & Individual Clients Beware, My Lovely (1952) Stanford Theatre: Fri. at 6 & 9:30 p.m. N MOVIEREVIEWS Free Attorney Consult! Easy A (PG-13) Century 20: 12:25, 2:45, 5:10, 7:30 & 9:50 p.m. 650.424.1900 N greencard1.com N[email protected] Hereafter (PG-13) (Century 16: 11 a.m.; 12:10, 2, 3:30, 4:55, 7, 8:25 & 10:30 NEVER LET ME GO--- p.m. Century 20: 11:25 a.m.; 12:50, 2:30, 4, 5:30, 7, 8:30 & 10 p.m. (Aquarius) Kazuo Ishiguro’s dystopian, Inside Job (PG-13) CinéArts at Palo Alto Square: 1:55, 4:40 & 7:20 p.m.; alternate-universe science-fiction melo- Fri. & Sat. also at 9:55 p.m. drama gets a rendering from director Ecole internationale de la Péninsule It’s Kind of a Funny Story (PG-13) (((Century 20: 2:25 p.m.; Fri.- Mark Romanek that’s austere to a Wed. also at 7:50 p.m. fault. The approach bonds the viewer to the leading characters, who grow up Jackass 3 (R) Century 16: In 3D at 11 a.m.; noon, 1:20, 2:20, 4, 5, 7, 8, 9:40 confused and frustrated in the vaguely & 10:35 p.m. Century 20: In 3D at 1:05, 2:15, 3:30, 4:35, 7:10, 9:30 & sinister Hailsham House boarding school. ̽ 10:40 p.m.; Fri., Sat., Mon., Wed. & Thu. also at 11:55 a.m.; 5:50 & 8:15 p.m.; Three youngsters compose a love triangle: Sun. also at 5:50 & 8:15 p.m. ࣑ shyly emotive Kathy (Izzy Meikle-Small), Laura (1944) Stanford Theatre: Sat.-Mon. at 5:50 & 9:10 p.m. brashly confident Ruth (Ella Purnell) and ੢ Legend of the Guardians: The Owls of Ga’Hoole (PG) Century 16: In sensitive loner Tommy (Charlie Rowe), 3D at 11:05 a.m.; 1:30, 3:55, 6:40 & 9:05 p.m. Century 20: In 3D at 1:55, the boy in whom both girls develop an ᄑ 4:20, 6:50 & 9:15 p.m.; Fri., Sat. & Mon.-Thu. also at 11:30 a.m. interest. When the students move out Letter from an Unknown Woman (1948) Stanford Theatre: Sat.-Mon. of the school and into their adult roles, ዕ at 7:30 p.m.; Sat. & Sun. also at 4:10 p.m. Kathy (Carey Mulligan), Ruth (Keira ओ Life As We Know It (PG-13) Century 16: 12:20 & 3:40 p.m. Century 20: Knightley) and Tommy (Andrew Garfield) 11:40 a.m.; 2:15, 4:55, 7:35 & 10:15 p.m. have developed physically but made little emotional progress. Unfair laws, a shel- Mao’s Last Dancer (PG) (( Aquarius Theatre: Fri. at 3 p.m.; Sun. at PRE-SCHOOL YOUR CHILD tered upbringing and, yet more disturb- WHEN IT’S , 5:30 & 8 p.m.; Mon. at 3 p.m.; Tue.-Thu. at 3, 5:30 & 8 p.m. ing, the sense of self-limitation inculcated Outstanding full- day program. EXPERIENCE MATTERS. The Metropolitan Opera: Boris Gudonov Century 20: Sat. at 9 a.m. from a young age socially cripples the CinéArts at Palo Alto Square: Sat. at 9 a.m. trio, but they work to justify their lives as LANGUAGE TEACHING MANDARIN CHINESE IMMERSION FOR 15 YEARS LEADER IN FRENCH IMMERSION meaningful, if only on their own terms. Longest running . A IN The Metropolitan Opera: Das Rheingold Century 20: Wed. at 6:30 p.m. bilingual PALO ALTO. ACCEPTING PRE-SCHOOL APPLICATIONS. CinéArts at Palo Alto Square: Wed. at 6:30 p.m. Rated R for some sexuality and nudity. immersion school REGISTER FOR A TOUR TODAY. in the area. Never Let Me Go (R) ((( Aquarius Theatre: 2, 4:30, 7 & 9:30 p.m. One hour, 44 minutes. — P.C. Experienced TOURS & OPEN HOUSES INFORMATION NIGHTS native-speaking UPCOMING TOURS Nowhere Boy (R) ((( Century 16: 11:45 a.m.; 2:10, 4:40, 7:50 & 10:15 p.m. faculty. Learn more about the school’s October 8, 2010 Mandarin Chinese Immersion NOWHERE BOY--- October 15, 2010 and French Immersion programs. Paranormal Activity 2 (R) Century 16: 11:25 a.m.; 12:25, 1:45, 2:45, 4:20, November 5, 2010 RSVP on our website. ACADEMICS November 19, 2010 (Century 16) Spanning 1955 to 1960, the FRENCH INFO NIGHT 5:20, 7:10, 8:10, 9:50 & 10:40 p.m. Century 20: 11:35 a.m.; 12:15, 1, 1:50, Established English OPEN HOUSES/INFO SESSIONS October 12, 2010 2:35, 3:20, 4:10, 4:55, 5:40, 6:40, 7:20, 9:05 & 10:30 p.m.; Fri.-Wed. also at story kicks off with John Lennon (Aaron curriculum. November 13, 2010 January 8, 2010 CHINESE INFO NIGHT Johnson) losing his beloved Uncle George Rigorous program October 19, 2010 8:05 & 10:30 p.m. in a nurturing (David Threlfall) and facing life alone with environment. Low Pickup on South Street (1953) Stanford Theatre: Thu. at 7:30 p.m. student-to-teacher INTERNATIONAL SCHOOL OF THE PENINSULA his somewhat priggish Aunt Mimi (Kristin ratio. 7%"777)340/2's0(/.%   Red (PG-13) ((( Century 16: 11:15 a.m.; 12:15, 1:55, 2:55, 4:35, 5:35, Scott Thomas). The familial shift prompts 7:30, 8:30 & 10:10 p.m. Century 20: 11:45 a.m.; 12:55, 2:20, 3:40, 5:15, the teenage Lennon to reconnect with 6:30, 8, 9:20 & 10:35 p.m. his affectionate but erratic mother Julia RiffTrax Live: House on Haunted Hill Century 16: Thu. at 8 p.m. (Anne Marie-Duff of “The Last Station”). Century 20: Thu. at 8 p.m. Something of a war of wills ensues between The Rocky Horror Picture Show (R) Guild Theatre: Sat. at midnight. Mimi and Julia, with the attentions and loyalty of John at stake. When all is said Saw 3D (R) Century 16: Thu. at 12:01 a.m. Century 20: Thu. at 8 & 10:20 p.m. and done, John will have faced the ugly Secretariat (PG) ((1/2 Century 16: 12:05, 3:20, 6:50 & 9:55 p.m. truth about the splintering of his family a Century 20: 11:15 a.m.; 2, 4:45, 7:40 & 10:30 p.m. decade earlier, and experienced the fresh A Guide to the The Social Network (PG-13) (((1/2 Century 16: 11:30 a.m.; 12:40, hell of another family tragedy. It isn’t all 2:25, 3:50, 5:15, 7:05, 8:20 & 10 p.m. Century 20: 11:15 a.m.; 2:10, 5, 7:55 & uncomfortable psychodrama for Lennon, 10:40 p.m.; Fri., Sun.-Tue. & Thu. also at 12:40, 3:35, 6:25 & 9:25 p.m.; Sat. also who we see enthusiastically raising hell Spiritual Community at 3:10 p.m.; Wed. also at 12:40 & 3:25 p.m. and even more enthusiastically embracing The Sound of Music Sing-Along Event Century 16: Tue. at 6:30 p.m. the cultural arrival of Elvis by adopting a Century 20: Tue. at 6:30 p.m. new style and procuring a guitar. Rated R Los Altos Stone (R) ((1/2 Century 16: 11:35 a.m.; 2:05, 4:45, 7:40 & 10:25 p.m. for language and a scene of sexuality. One Lutheran Sudden Fear (1952) Stanford Theatre: Fri. at 7:30 p.m. hour, 38 minutes. — P.C. Church To include your Tamara Drewe (R) Century 16: 11:10 a.m.; 1:50, 4:30, 7:25 & 10:05 p.m. ELCA Church in RED--- Pastor David K. Bonde The Town (R) (((1/2 Century 16: 7:20 & 10:20 p.m. Century 20: (Century 16, Century 20) “Red” stars Bruce 1:25, 4:15, 7:05 & 9:55 p.m. Outreach Pastor Inspirations Willis as Frank Moses, a retired CIA black Gary Berkland Please call Blanca Yoc UFC 121: Lesnar vs. Velasquez Century 20: Sat. at 7 p.m. ops agent with a fearsome reputation. Of 9:00 am Worship at 650-326-8210 Waiting for Superman (PG) Century 20: 11:50 a.m.; 2:25, 5:05, 7:45 & course, news of Frank’s skills haven’t reached 10:30 am Education ext. 6596 10:20 p.m. CinéArts at Palo Alto Square: Fri. at 1:45, 4:30, 7:15 & 9:50 his suburban neighbors or Sarah Ross (Mary- Nursery Care Provided p.m.; Sat. at 4:30, 7:15 & 9:50 p.m.; Sun.-Tue. & Thu. at 1:45, 4:30 & 7:15 p.m.; Louise Parker), the Social Security office or e-mail Wed. at 1:45 p.m. cubicle worker he’s taken to chatting up over 650-948-3012 [email protected] Wall Street: Money Never Sleeps (PG-13) Century 20: 11:25 a.m.; Fri.- the phone. Frank’s quiet life doesn’t last long: 460 S. El Monte Ave., Los Altos Wed. also at 4:50 & 10:15 p.m. his plan to travel to Kansas City to meet up www.losaltoslutheran.org Where the Sidewalk Ends (1950) Stanford Theatre: Thu. at 5:45 & 9 p.m. with Sarah hits a snag when armed comman- dos attempt to kill him. For Sarah’s safety, You Will Meet a Tall Dark Stranger (R) ((( Guild Theatre: 3:45, he’ll have to abduct her and keep her in line 6 & 8:15 p.m. while looking up old friends also classified Note: Screenings are for Friday through Tuesday only. as “RED”: “Retired — Extremely Danger- AQUARIUS: 430 Emerson St., Palo Alto (266-9260) ous.” Rated PG-13 for intense sequences of CENTURY CINEMA 16: 1500 N. Shoreline Blvd., Mountain View (800-326-3264) action violence and brief strong language. CENTURY PARK 12: 557 E. Bayshore Blvd., Redwood City (800-326-3264) One hour, 51 minutes. — P.C. CENTURY 20 DOWNTOWN: 825 Middlefield Road, Redwood City (800-326-3264) MOUNTAIN VIEW CENTRAL SEVENTH-DAY ADVENTIST CHURCH CINEARTS AT PALO ALTO SQUARE: 3000 El Camino Real, Palo Alto (493-3456) N MOVIECRITICS GUILD: 949 El Camino Real, Menlo Park (266-9260) Sabbath School: 9:30 a.m. SPANGENBERG THEATRE: 780 Arastradero Road, Palo Alto (354-8263) R.P.-Renata Polt, S.T.- Susan Tavernetti, P.C. Saturday Services: Worship 10:45 a.m. For show times, plot synopses and more information about any films playing at the Peter Canavese, T.H.-Tyler Hanley Wednesday Study Groups: 10-11 a.m. Aquarius, Guild and Park, visit www.LandmarkTheatres.com Pastor Kenny Fraser, B.A.M. DIV REVIEWS -Skip it For show times, plot synopses, N MOVIE 1425 Springer Rd., Mtn. View Office Hrs. M-F 9am-1pm --Some redeeming qualities trailers and more movie www.mtviewda.adventistfaith.org Phone: 650-967-2189 ---A good bet info, visit www.mv-voice.com Read more reviews online at Outstanding ---- and click on movies. www.PaloAltoOnline.com.

20 ■ MOUNTAIN VIEW VOICE ■ OCTOBER 22, 2010 MOUNTAINVIEW VOICE NHIGHLIGHT

SILICON VALLEY AFRICAN FILM FESTIVAL 2010 First-ever showcase of 30 films from 16 countries, presenting a mix of feature films, shorts and animations from Africaís seasoned and emerging first-voice filmmakers. Presented by Oriki Theater in partnership with Community School of Music and Arts (CSMA). Oct. 23-24, 11 a.m. $5 to $30. Community School of Music and Arts (PJOHT0O (CSMA), Finn Center, 230 San Antonio Circle, Mountain View. www.svaff.org ART GALLERIES danastreetroasting.com LIVE MUSIC with film clips and pithy anecdotes. Oct. 24, Creekside Center, 655 Magdalena Ave. (@ The Tuttles with AJ Lee Bluegrass 2-4 p.m. $20-$30. Congregation Beth Am, Foothill Exp.), Los Altos. Call 650-383-9322. Mixed Media Prints by Pantea Sarah Nicole Wallace w/ Rory Cloud Concert The Tuttles with AJ Lee is a 26790 Arastradero Road, Los Altos Hills. Call www.laumc.org Karimi Exhibition of prints by CSMA faculty Sarah Wallace and Rory Cloud perform Oct. young band, mostly aged 12 - 17, that plays . www.betham.org/women/ Deborah’s Palm Volunteer Oppor- member Pantea Karimi. Gallery Hours: 9 23, 8-10 p.m. Red Rock Coffee, 201 Castro bluegrass music. Molly, Sullivan, Michael Richard Kadrey Richard Kadrey, author tunities Deborah’s Palm is a women’s a.m.-7 p.m. Mon.-Fri.; 9 a.m.-3 p.m. Sat. St., Mountain View. Tuttle and their father Jack are joined by of “Sandman Slim,” presents “Kill the Dead: resource center located in downtown Palo Exhibit runs through Nov. 21, Free. Mohr their friend AJ Lee. Oct. 23, 8 p.m. $18 in A Sandman Slim Novel.” Oct. 29, 7 p.m. Alto. It has many volunteer opportunities Gallery, Community School of Music and advance, $20 at the door; ages 13-18 are Free. Books Inc., 301 Castro St., Mountain available ranging from front desk greeters, Arts, 230 San Antonio Circle, Mountain ON STAGE 1/2 price; under 13 years free with a paying View. www.booksinc.net fund raising, grant writing, special events View. www.arts4all.org/attend “Sleeping Beauty” Los Altos Youth adult. First Presbyterian Church, 1667 Mira- and much more. Deborah’s Palm, 555 Lytton Theatre presents a modern, sassy version of Strategic IP: Building a Portfolio & monte Ave., Mountain View. Call 650-691- Ave., Palo Alto. www.deborahspalm.org the fairy tale. Audiences are encouraged to Managing Exposure Learn about build- 9982. www.rba.org AUDITIONS wear their princess dress, dragon costume or ing the IP portfolio of a cleantech start-up Stanford Cats Need Foster Homes Auditions for “A Winter Fairy Tale” other royal wear. Oct. 22-Nov. 6, tickets are and protecting it from the claims of others. Stanford Cat Network needs foster homes The Bayer Ballet Company is holding audi- ENVIRONMENT $15 adult and $10 student/senior/child. Bus Oct. 26, 8:30-10:30 a.m. $25. Fenwick & for newcomer cats to campus. For more info tions for males ages 8 - 18 for major and Barn Theatre, 97 Hillview Ave., Los Altos. West LLP, 801 California St., Mountain View. and to volunteer, go to the SCN website and Tree Pruning Workshop - MVTrees minor roles in its original story ballet “A Call 650-941-0551. Call 408-309-8736. http://www.environ- complete the Foster Home Profile: catnet. Discussion of tree-pruning methods and Winter Fairy Tale”, open to gymnasts, actors mentalcluster.org/events/ev_2010Q1-4- stanford.edu/support_foster.html . Adop- tips. Oct. 23, 10-11:30 a.m. Free / donations and dancers. Call for appointment time and LegalSeries.htm#session3 tion fair help also needed. Opportunities accepted. Bryant Street, Between California more info. Oct. 24, 10 a.m.-1 p.m. Bayer SPECIAL EVENTS ongoing. Stanford Cat Network, P.O. Box & Mercy Streets, Mountain View. Call 415- Ballet Academy, 2028 Old Middlefield Way, Fresh Choice Fundraiser Benefiting 18287, Stanford. Call 650-566-8287. catnet. 412-1127. www.mountainviewtrees.org TEEN ACTIVITIES Mountain View. Call 650-988-9971. www. Eastside College Prep., East Palo stanford.edu bayerballetacademy.com Alto Fresh Choice will donate 15 percent of Teen Open Gym Teen Open Gyms are Writing Buddies Volunteers Needed FAMILY AND KIDS sales generated Thu., Oct. 28. Must bring open every Saturday night for various sports. Write stories with second-graders. Writing flyer (see link provided). 11 a.m.-9 p.m. Fresh Middle School and High School students LAH Annual Pumpkin Patch Pumpkin Buddies pairs adults 1:1 with Mountain View CLASSES/WORKSHOPS Choice, 2540 W. El Camino Real, Mountain only; bring student ID. 6:30-9:30 p.m. Free. patch to support Los Altos High School schoolchildren in a six-week program. Two Hearing Health Dr. David Tang discusses View. Call 650-521-2894. www.freshchoice. 6:30-9:30 p.m. Free. Whisman Sports Cen- athletics. Through Oct. 31, 8 a.m.-8 p.m. Los hours/week, Tuesdays. All training provided. the physiology and pathology of hearing. com/wp-content/uploads/2010/10/fund- ter, 1500 Middlefield Road, Mountain View. Altos High School, 201 Almond Ave., Los 1:30-3:30 p.m. Free. Castro School, 505 Escue- Oct. 28, 2 p.m. Free. Mountain View Senior raiser_flyer_Mt_view_EASTSIDE-COLLEGE- Call 650-903-6410. Altos. Call 650-948-0261. la Ave., Mountain View. Call 650-323-1183. Center, 266 Escuela Ave., Mountain View. PREP.pdf Call 650-903-6330. Santa Rita’s Witches Delight Carni- VOLUNTEERS val Carnival rides are back and will include TALKS/AUTHORS CONCERTS the Dizzy Dragons, Frog Hop Kite Swings and Children’s Disaster Services Volun- new Wild Raft ride. Other attractions include ‘Reel Jewish Women’ with Jan Wahl teer Workshop This workshop will train N MORELISTINGS Kizuna Concert for Down Syndrome games, cake walk, obstacle course, cookie KRON-TV film critic Jan Wahl will take wom- attendees to understand and respond to chil- Bay Area Japanese professional musicians decorating and costume contest. Churros, en on a behind-the-scenes Hollywood tour, dren who have experienced a disaster. Par- For a complete listing of come together to perform a classical music cotton candy, popcorn and BBQ. All children onscreen and offstage. Wahl will focus her ticipants will experience a simulated shelter, local events, see our website at concert to raise funds for the Silicon Val- must be accompanied by a parent. Oct. 29, lens on Jewish women in film, from Picon to sleeping on cots and eating simple meals. www.MountainViewOnline.com ley Down Syndrome Network (SVDSN). All 3-8 p.m. Free admission/$1 per ticket. Santa Portman, from Streisand to Midler, complete Oct. 29-30, 5 p.m. $45 early reg./$55 after profits from this concert will be donated to Rita Elementary, 700 Los Altos Ave., Los Oct. 8. Los Altos United Methodist Church, SVDSN. (Tickets are tax-deductible.) Oct. Altos,. 24, 3 p.m. $10 to $20. Mountain View Zoo Night Dress up in your Halloween Japanese Seventh-day Adventist Church, costume and bring the kids and family to the 195 N Rengstorff Ave., Mountain View. Call annual Zoo Night. The JMZ will have food 408-687-5915. www.sfcv.org/event/kizuna- ID-PENINSULA and drinks, Halloween treats, and close-up M concert-%E2%80%93-a-fundraiser-for-the- animal encounters. Bat-naming winners will silicon-valley-down-syndrome-network be announced,” the Junior Museum and Zoo IGH CHOOL The Scott Amendola Trio Drummer says. Oct. 29, 6-8 p.m. Become a member H S Scott Amendola leads his trio in original of the Friends to attend Zoo Night. Palo Alto jazz music. Oct. 24, 7:30-10 p.m. $15. Dana Junior Museum & Zoo, 1451 Middlefield Street Roasting Company, 744 West Dana Road, Palo Alto. http://www.friendsjmz.org/ St., Mountain View. Call 650-390-9638. support.html

 
 &!'
 !
 $$!    
 

 
 








 
" !
' $$!
-&'
"((& FALL OPEN HOUSE Saturday, October 23, 2010

No RSVP is necessary 10:30-12pm

OPEN HOUSES: ()&-
$*"&


%" Choose a small, caring, innovative high school  )&'-
"&


%" 1340 Willow Road, Menlo Park, CA 94025 (650) 321-1991  
$&(
#'($&/
*
.
$)#( #
 +


  

,
.
+++ &!'"'$&
.
" '' $#' &!'"'$& www.mid-pen.com

OCTOBER 22, 2010 ■ MOUNTAIN VIEW VOICE ■ 21 fogster.com THE PENINSULA’S FREE CLASSIFIEDS WEB SITE Combining the reach of the Web with Marketplace print ads reaching over 150,000 readers! PLACEPLACE AN AD fogster.com is a unique web site offering FREE postings from communities throughout the Bay Area and an opportunity for your ad to appear in the Palo Alto Weekly, The Almanac and the Mountain View Voice. ONLINE Jazz & Pop Piano Lessons Horses Full Board $500-$700 Royal Doulton China Pieces - $See Ad fogster.com Learn how to build chords and impro- Private stables, 11 flat acres. No riding. 260 Sports & Vintage Bakelite Purse - $30.00 vise. Bill Susman, M.A., Stanford. 650/851-1796 Exercise Equipment (650)906-7529 E-MAILE-MAIL Bulletin White Maltese Puppies!! 220 Computers/ German Hiking Boots (Men) - $45.00 OBO Learn to Play Trumpet [email protected]@fogster.com Beginner to Advanced. Classical and Electronics 270 Tickets Board Jazz. Lessons in your home. Brand New Apple Iphone 4 32GB Jimmy Buffet 10/16 / 4 Lawn Tix - $155 650/279-7139 The item is Brand New, 100% original, PHONE Manzana Music School Fully Factory Unlocked. Will work per- 650/326-8216 115 Announcements Lessons on Guitar,Violin, Vocals, Fiddle, fectly with all sim cards in all countries, GAIN NATIONAL EXPOSURE Banjo, or Mandolin. 650 799-7807 Please Contact Us Today at adkelec- Kid’s Reach over 5 million young, educated [email protected] For Sale [email protected] for more information about this item. Now you can llogog on to readers for only $995 by advertising in McCool Piano Studio 566-9391MP 110 weekly newspapers like this one. Near Burgess Gym Menlo Park 201 Autos/Trucks/ CANON 4L BATTERY & CHARGER - $15.00 fogster.comfogster.com, day or Call Jason at 202-289-8484. This is not Stuff ninightght and ggetet yyourour ad a job offer. (AAN CAN) Piano Class for Ages 2-6, FUN! Parts HARD-SIDED LAPTOP CARRIER - $100.00 started immediatelimmediatelyy online. PREGNANT? CONSIDERING Piano Lessons Cadillac 1977 De Ville d Elegance - $7500 HDMI CABLE 6’ BLUE RAY - $15.00 330 Child Care ADOPTION? Talk with caring agency spe- Susan Jackson, Mus B. MM. HDMI CABLE PREMIUM GOLD - $18.00 Most listings are free and cializing in matching Birthmothers with Classical or Jazz. (650)326-3520 www. Ford 1990 Ranger SuperCab XLT w/ Offered susanjacksonpianoinstruction.com Rack - $2800 IBM Selectric II Typewriter - $350 Families nationwide. LIVING EXPENSES Are you looking for mature Nanny iincludenclude a one-line ffreeree PAID. Call 24/7 Abby’s One True Gift Piano Lessons Honda 2006 Civic Coupe EX - $10,500 JVC HD-ILA 61inch HDTV - $500.00 Adoptions 866-413-6293 (Void in Illinois) Art Birthday Parties pprintrint ad in our Peninsula Taught in your home. TOYOTA 2007 CAMRY HYBRID - $18,600 (AAN CAN) Member MTAC & NGPT. 230 Freebies babyguru.org - Night nanny newspapers with the Specializing in beginners. All levels Vespa 2008 LX 50 Co-Dependents Anonymous (CoDA) HAMMOND ORGAN - FREE Chidcare Provider/Baby Sitter welcome. Like new, 250 miles. $3500 obo ooptionption of photos and “Transformation” - art show addadditionalitional llines.ines. ExemExemptpt Karen, (650)367-0307 or Learn to Live Pain Free - FREE Child Care opening in San Carlos Adult Jazz - Dance Expressions Piano Lessons 202 Vehicles Wanted OFFICE PARTITIONS - FREE Debbie’s Family Day Care - RWC aarere employment ads, Bake Sale for Orphaned Kittens!! Guaranteed to make good performer. Donate Vehicle EXCELLENT BABYSITTER AVAILABLE! Kids & Adults. 650-739-5145 Receive $1000 Grocery Coupons, 235 Wanted to Buy wwhichhich inincludeclude a wwebeb Free Reiki to the community! Your Choice. Noah's Arc, No Kill EXCELLENT NANNY AVAILABLE! Piano Lessons w/E Moreno PhD Mus Free Theta Healing sessions! Animal Shelters. Advanced Veterinary Antique dolls listinlistingg charcharge.ge. Home 650 324 2795 Mother’s helper Happy to help u! House Cleaning Treatments. Free Towing, IRS Tax Services anandd MinMindd & BoBodydy Pro Tools Recording Facility Deduction. Non-Runners. 1-866-912- 240 Furnishings/ Sweet and Outgoing Babysitter Services rerequirequire contact K-2nd Grade The Cave ~ Multi Track “Live” recording GIVE. (Cal-SCAN) Violin Teacher facility for full digital musical perfor- Household items Ready for the Year to End? Donate Your Car wwithith a CustoCustomermer SaSalesles mance capture. Access to local musi- 2 Beautiful Sofas - $100 each VLS Multicultural,Bilingual. Children's Cancer Fund! Help Save Singers Wanted cians and recording artist for perfor- A Child's Life Through Research and 2 Italian Marble Lvg Rm Tables - $299 RepresentativeRepresentative.. mance enhancements to your current 340 Child Care Swim competition Support! Free Vacation Package. Fast, projects. Film and ADR support. Call for Bookshelf - $100 Easy and Tax Deductible. Call 1-800- So, the next time yyouou have The Allodola Violin Duet rates! Angelo (650) 245-0984 Wanted 252-0615. (Cal-SCAN) Chairs Couch Large Wall Piece - $50-$450 Wine and Chocolate Event Afternoon Nanny Wanted, M-F aann item to sell, barter, ggiveive FREE double mattress (like new) - $0 135 Group Activities 203 Bicycles Mother’s helper aawayway or buy, get the perfect 130 Classes & 2 Singles Halloween Parties New big entertainment center!!! Subaru Two Bike Rear Hitch Rack - $30 Mother’s helper for afternoons ccombination:ombination: pprintrint aadsds in Instruction Art classes Porthole Clock - $100.00 Nanny Jobs in Peninsula yyourour local newspapers, Attend College Online CHILDREN’S ENTERTAINER 210 Garage/Estate from Home. *Medical, *Business, Etz Chayim Second Annual Holiday 345 Tutoring/ reachinreachingg more than 150,000 *Paralegal, *Criminal Justice. Job place- Sales readers, and unlimited free ment assistance. Computer available. Etz Chayim's Fifth Friday Servic Los Altos, 2266 Sierra Ventura Drive, Lessons wwebeb postings reacreachinghing Financial Aid if qualified. SCHEV certi- Mountain View Seasoned Travelers Sat 23rd 9 to 5 Chess Lessons for kids and adult fied. Call 888-210-5162 www.Centura. French ,Spanish Lsns. 6506919863 huhundredsndreds of tthousandshousands us.com (Cal-SCAN) NATURE/OUTDOORS Events Calendar STAGING FURNITURE BLOW OUT French&German Tutor 608-381-0210 High School Diploma www.art4growth.com aadditionaldditional people!! SALE! guitar/piano/voice Graduate in 4 weeks! FREE Brochure. Great Deal on Furniture & Accessories Call Now! 1-866-562-3650 ext. 60 www. 140 Lost & Found High School Math/Science tutor SouthEasternHS.com (Cal-SCAN) LOST DAYPACK 2 WEEKENDS ONLY! Math Instructor offers lessons HIGH SCHOOL DIPLOMA! Lost Keys -Sat Oct. 16th & Sun Oct. 17th INDEX One-to-One Tutoring Service Graduate in just 4 weeks!! Lost keys to my old Chevy Blazer some- -Sat Oct. 23rd & Sun Oct 24th N BULLETIN FREE Brochure. Call NOW! where between the PV Town Center Stanford-Educated Expert Tutors 1-800-532-6546 Ext. 97 http://www. TIME: 8AM - 5PM and the top of Old La Honda Road. Violin lessons & Voice Lessons BOARD continentalacademy.com (AAN CAN) Please help. Da Lusso Design: 140 South Whisman Road STE #D Mtn View 100-199 Cardinal Tutors Runaway Cat! Morgan Hill, 1154 Teresa Lane, Oct 355 Items for Sale Best Stanford Tutors for High School 22, 23 & 24; 9-5 245 Miscellaneous 24mon/3y/4y BOY clothes N FOR SALE Students; SAT, Math, English, Physics, 145 Non-Profits Huge Estate Sale Biology, History, and more... Sign up Friday, October 22nd Sawmills 4TBlues Clues costume$10 200-299 today to get 50% off your first session! Needs Saturday, October 23rd New Norwood LumberMate-Pro handles Barbie,bratz,dolls,girltoys$10 www.cardinaltutors.com/backtoschool N KIDS STUFF Chocolate and Wine Event 9:00 AM TO 5:00 PM logs 34” diameter, mills boards 28” Sunday, October 24th wide. Automated quick-cycle-sawing Bear costume XL 4-8 years GERMAN Language Class Donate your Cell Phones! 330-399 9:00 AM TO 4:00 PM increases efficiency up to 40%! www. BOY comforter/blankets $25 Instruction for Hebrew Donations Needed! 1154 Teresa Lane, Morgan Hill NorwoodSawmills.com/300N 1-800- Bar and Bat Mitzvah For Affiliated and Boy VHS videos N MIND & BODY Elegant, up-scale home with 3 levels 661-7746 ext. 300N. (Cal-SCAN) Unaffiliated Knitters Wanted of Antiques, furniture, rare figurines, BOYS Jackets6mon-3years 400-499 George Rubin, M.A. in 1963 Indian Sari - $395 baby grand piano, collectibles, Persian Hebrew/Jewish Education Bugaboo Chameleon Stroller-$500 - 500 150 Volunteers style rugs, paintings, Jenny Lind baby Back Pack - Jansport - $30.00 NJOBS 650/424-1940 Bake Sale Volunteers Needed!! crib, lamps, pictures, freezer, kitchen Beethoven LP Box Set - $55 DUTALIER GLIDER/ROCKER W/ 500-599 Math, Stats, Physics, Chem Tutor ware and small appliances, household OTTOMAN - $90 for pair Community Cell Phone Collector Canon 35 MM Camera - $40.00 15 yrs exp. Jim, 307/699-3392 items and cleaning appliances, TVs and Graco LiteRider Stoller - 20 NBUSINESS Knitting Volunteers much more!! costumes cheap - $10 Kids playfood/utensils/pans Library Volunteers Needed Credit/Debit Cards accepted with ID SERVICES 133 Music Lessons even more costumes cheap Leap FrogAlphabetPalCaterpillar A Piano Teacher Museum Volunteers Palo Alto, 219 Addison Avenue, Oct 600-699 Children & Adults 23 8am -12pm FREE FIREWOOOD & MULCH NIKE 6Toddler tennis/runningshoe NASA cats need fosterers Ema Currier (650)493-4797 Multi-family garage sale featuring furni- Mixed Firewood-Seasoned & Split - NHOME Stuffed animals bag full $15 Barton-Holding Music Studio Stanford Cats need volunteers ture, toys, clothing, kids’ clothes, sporting $150.00 good, books and household items. Tons of SERVICES Next 6 week “singing for the non-singer” Yes! Mentor! more costumes cheap - $5 class starting soon. Call Laura Barton great stuff. Drinks and snacks too. 700-799 Pre-Teen Girls Clothing - $2.00 or L 650/965-0139 155 Pets Palo Alto, 537 Addison Ave., Oct. 23 No phone N FOR RENT/ FUN Piano Voice Violin Guitar & 24, 9-3 Stetson Western Hats - $35.00 English bulldog puppies for sale Palo Alto, 714 Matadero Avenue, Telephoto Camera Case - $25.00 FOR SALE Glenda Timmerman Piano AKC registered English bull- number in the 23 years exp. MA. 650/938-0582 Oct. 23 9-4 Veinlite EMS - $175 REAL ESTATE dog puppies 6 weeks old avail- Garage Sale: decorative items, odds able 3-males and 1 female. All ad? Guitar Lessons 650-224-3550 and ends. 714 Matadero Avenue, PA Western Boots - $55-$100 800-899 puppies are Vet. checked (Dr. beg/int all styles your home $60 GO TO Butchko), Micro chipped with NPUBLIC/LEGAL 215 Collectibles & 250 Musical Hope Street Studios all shots up to date. We strive to FOGSTER.COM NOTICES In downtown Mtn. View produce conformational cor- Antiques Instruments rect, healthy, well-tempered Most instruments, voice Antique Baby buggy Large wicker - $175 Piano-Baldwin Excel Tone - 2,250.00 for contact 995-997 All ages & levels (650) 961-2192 bulldogs. All our bullies come with a health guarantee and will go to *good Antique Sewing Machine - 276 Tama 5 piece drum set - $400.00 homes only*....$950 information The publisher waives any and all claims FOGSTER.COM Fairy Tale Prince Ken Doll - $20.00 or consequential damages due to errors. FOGSTER.COM Embarcadero Media cannot assume Orrefors Crystal - $See Ad responsibility for the claims or performance of its advertisers. Embarcadero Media has the right to refuse, edit or reclassify any ad solely at its discretion without prior notice. GO TO FOGSTER.COM TO RESPOND TO ADS WITHOUT PHONE NUMBERS 22 ■ MOUNTAIN VIEW VOICE ■ OCTOBER 22, 2010 THE PENINSULA’S FREE CLASSIFIEDS WEBSITE MARKETPLACE the printed version of TO RESPOND TO ADS WITHOUT PHONE NUMBERS GO TO WWW.FOGSTER.COM fogster.com

710 Carpentry 748 Gardening/ bradley SHMOOVER Cabinetry-Individual Designs Apply as a bookkeeper Precise, 3-D Computer Modeling: Landscaping CONSTRUCTION ENTERPRISES Apply as a bookkeeper. MOOVERS Mantels * Bookcases * Workplaces Beckys Landscape 650-575-1924 LICENSE CAL. T-118304 * Wall Units * Window Seats. Weekly/periodic maint. Annual rose/fruit Qualifications: Ned Hollis, 650/856-9475 tree prune, clean ups, irrigation, sod, 1 Serving the Peninsula since 1975/Owner-Operated! -Excellent computer skills Kitchens planting, raised beds. Demolition, exca- 1 Jobs -Knowledge of simple Accounting vation. Driveway, patio, deck installs. Baths 327-5493 softwares..Versacheck,peachtree etc 715 Cleaning Power washing. 650/493-7060 1 Doors & Windows 500 Help Wanted -Internet-capable Services 1 Dry Rot & Termite Specialists -Quick learner 771 Painting/ RN Director of Health Services -Ability to work under pressure Gaeta's Landscape 1 Small Jobs Welcome at Avenidas Rose Kleiner Senior Day -Proven ability to handle sensitive and Asuncion Yanet Complete Garden Maintenance 1 Multi-Unit Buildings Wallpaper Health Center, a non-profit Adult Day confidential information House Cleaning 1 Full Service Construction Gary Rossi PAINTING Health Center (ADHC) in Mountain View. -Ability to work independently as well Pavers, flagstone, brick work, BBQs, !

!

!

 sprinkler, retaining walls/fences, Lic. #842550 Free 2 gal. paint. Water damage FT, Weekdays, working with frail elderly. as part of a team repair, wallpaper removal. Bonded. Lic Seeking CA licensed RN with clinical and -Strong verbal and written communi- 
 
 lighting, Free Estimate! #559953. 650/207-5292 administrative experience to join our multi- cation skills 

 

  (650) 368-1458 disciplinary team. Familiarity with Title 22 -Strong organizational skills 650-906-7712 or 650-630-3279 Glen Hodges Painting ADHC requirements preferred. Requires -Ability to perform several tasks Senior discount. Quality work. 35+ yrs GARDENING & LANDSCAPE exp. Payment plan avail. Lic #351738. computer skills: MS Word and Excel at a simultaneously Francisca’s Deep Housecleaning Woodwork/Fencing, Irrigation, minimum. Details at www.avenidas.org/ -Would work only 3 Since1990! 650/322-8325 Experienced, Refs. 650-669-0628 or Aeration, Stump Grinding,Tree/ GENERAL BUILDING you/careers-volunteering. Send cover let- days;Mondays,Wednesdays & Fridays 650-701-0703 Shrub Trimming, Rototilling Clean STYLE PAINTING ter and resume to [email protected] -Maximum of 2hrs during work days ups, Rose/Fruit Tree Pruning. CONTRACTORS Comm’l/Residential, interior and ext., -$1200 per month( i.e $300/wk) Roger:650-776-8666 540 Domestic Help  

 

 
 
full service painting. Insured. Lic. APPLICANTS WILL BE TRAINED GARDENING 




  903303. 650/388-8577 Wanted PERSONALLY " 
%

%
 !!
%
$ ce MAINTENANCE 650-322-7930 LOCAL AND HONEST REPRESENTATIVES Only interested applicants reply to: #
%
#"!
%

!! 775 Asphalt/ NEEDED [email protected] 
 
%
 






PL/PD STATE LIC# 608358 “Serving All The Bay Area”





www.cjtigheconstruction.com Concrete





550 Business (650) 380-4114 (650) 389-3327 Domicile Construction Inc. Mr. Low Price WILLING TO TRAIN



Jose Martinez Driveways, patios, pavers, stamp, Opportunities Seeking highly motivated individual for Nena & Ney House Cleaning (650) 271-4448 brick, block, all stone, retaining walls. Business for Sale! rewarding career in financial services. General Lic. #875321. Insured. Free est. Call Rose 408-529-4886. Detail Oriented, 15 yrs. exp. and driv- Construction Services Established for 3 years. Will Train. Nets ing available. CDL. good refs. 650- Jody Horst 650/630-2866 100k. Can operate from anywhere. 851-7603 or cell# 650-465-2187 Roofi ng, Water Proofi ng, Decks Roe General Engineering $4,400 down. Call Jerry 1-800-418- 
Artist and other Services. Concrete, asphalt, sealing, pavers, new 8250. (Cal-SCAN) 856-9648 construct, repairs. Business Olga’s Housecleaning (408) 532-8020 34 yrs exp. No job too small. 560 Employment Res./Com. Wkly/mo. Low Rates. Lic#770948-B&C39 Lic #663703 * 650/814-5572 Local Refs. Exp’d. & Friendly. I love $

 
Consult Information My Job! Ins. (650)380-1406 779 Organizing $$$HELP WANTED$$$ Services $
Dr

Spray
Irrigation 757 Handyman/ Extra Income! Assembling CD cases $
 

Maintenance Repairs Services from Home! No Experience Necessary! 619 Consultants Orkopina $
La!

Roc
Gardens End the Clutter & Get Organized Call our Live Operators Now! 1-800-405- $

Edib
Gardens
V
Residential Organizing 7619 EXT 2450 http://www.easywork- K. Stewart Consulting Housecleaning Lic. #725080 ABLE HANDYMAN FRED Experienced Consultant for Business Boxes by Debra Robinson greatpay.com (AAN CAN) “The BEST Service for You”
Complete
Home
Repair


Maintenanc

(650)941-5073 and Nonprofits: Please contact me for
emodelin


Professional
Painting

Company Drivers my rates and additional information. Bonded Since 1985 Insured Leo Garcia Landscape/
Carpentr


Plumbing


Electrical

Solos & Hazmat Teams * GREAT PAY (646) 245-5230/[email protected]. $

Housecleaning Maintenance
Custom
Cabine
Design

Deck

ence 787 Pressure * GREAT MILES * CDL-A Required. We $
Laundry,


Linens Lawn and irrig. install, clean-ups.


















An
Much
More Washing also have dedicated & regional positions 624 Financial $
W
W
"

Blinds Res. and comml. maint. Free Est. 30 Years Experience available. Call 866-789-8947. Swift. Clean-up Lic. 823699. 650/369-1477. 650.529.1662

 3.27 Emerald City Powerwashing (Cal-SCAN) Cash Now! $
!
 !



Exterior Surface Cleaning Get cash for your structured settlement $
"
Wash Mario’s Gardening Wood Deck Restoration Computer Work HANDY “Ed” MAN or annuity payments. High payouts. Call $


 
Work Maintenance, clean-ups. Free est. 650/787-8017 Work from anywhere 24/7. Up to $1,500 J.G. Wentworth. 1-866-SETTLEMENT (650)962-1536- Lic. 020624 650/365-6955; 995-3822  
$
!
$
  Part Time to $7,500/mo. Full Time. (1-866-738-8536). Rated A+ by the  #
$

$
 www.orkopinacleaningservice.com Noel Leal Gardening Service 790 Roofing Training provided. www.KTPGlobal.com Better Business Bureau. (Cal-SCAN) 
#
"
#!
 or call 1-888-304-2847. (Cal-SCAN) crosetti funding R. Alvarez Cleaning R.G. Landscape FREE ESTIMA 

  Priority Roofing Solutions, Inc. Drivers CASH NOW we offer fast cash for your Weekly, monthly or one time cleaning. Yard clean-ups, maintenance, installations. ED RODRIGUEZ Roofing and Gutters 408-532-8020 Act now! New Pay Increases! 37-43 mortgage note, annuity, and business 15 years exp. Excel. refs. Lic. #41574. Call Reno for free est., 650/468-8859 (650)465-9163
$
(650)570-5274 cpm. Excellent Benefits. Need CDL-A & note call 1 800 391 4032 650/369-1477 Uriel’s Gardening 3 months recent OTR. 1-877-258-8782. Maint., haul, poison oak, clean up, free Socorro’s Housecleaning 795 Tree Care www.MeltonTruck.com (Cal-SCAN) 645 Office/Home est. 650/862-1378 Uriel Helping Hands Handyman Service Comm’l, residential, general, move Palo Alto Drivers: 20 Needed Business Services in/out. Detailed, honest, good refs, USA LANDSCAPING CDL-A, Experienced. 11 Western States. * Honey-Do List Specialist Advertise Your Home 25 yrs exp. 650/245-4052 General Maintenance, Clean ups, Lawn, TREE SERVICE STABLE Family Owned - ANDRUS Fences ,Retaining Walls, Sprinklers, * Rental Repairs TRANSPORTATION. Good Pay, Routes, property or business for sale in 240 * Problem Solver * Local Refs 

  
 California newspapers. Reach over 6 Concrete. 10 years exp., free estimates. People! 1-800-888-5838 or 1-866-806- (408)891-2468 lic. #33088 * Call Vicki, 650/465-9529 
  


  5119 x1402. (Cal-SCAN) million readers for ONLY $550! Call this *[email protected]  
  

  newspaper or visit: www.CAL-SCAN.com 719 Remodeling/ Vidal Gardening & Landscaping 25 yrs Exp

Lic & Ins. #819244 Good Leaders (Cal-SCAN) Additions (650) 380-2297 for Sales Workforce. Partner with the cre- Bi-Weekly, twice a month clean up. Tree ators of PROACTIV. 5 BILLION DOLLAR Advertise Your Job Opening Domicile removal. Fences, retaining walls, new 759 Hauling Industry in Next 5 Years. (248)224- in 240 California newspapers. Reach Construction, Inc. lawn irrigation systems. Gutter cleaning. over 6 million readers for ONLY $550! THE TREE EXPERTS 5383 www.joybenavidez.myrandf.biz General Contractor Free est., excel. refs. 650-771-0213 AJOHNSTON Tree trimming/removal. For COMPENSATION. (Cal-SCAN) Call this newspaper or visit: www.Cal- SCAN.com (Cal-SCAN) T 415 999-3143 650 366-8335 Quality tree care. 10% off. 70% Recycled lic./Ins. Medical Assistant www.domicileconstructioninc.com 751 General Display Advertising LARGE TRUCKS (650)222-4733 Learn on the job. Good pay, benefits, 30 in 140 Cal-SDAN newspapers state- since 1990 Contracting days vacation/yr, $ for school. No expe- wide for $1,550! Reach over 3 million lic #627843 ,&(
,'*
-
Trees rience OK. HS grads ages 17-34. Call Californians! FREE email brochure. Call Mon-Fri 1-800-345-6289. (Cal-SCAN) LARGE/small JOBS (916) 288-6019. www.Cal-SDAN.com NOTICE TO READERS It is illegal Free Estimate Insured Paid In Advance! (Cal-SCAN) for an unlicensed person to perform Real Make $1000 a Week mailing brochures from contracting work on any project val- 650-327-HAUL home! Guaranteed Income! FREE Supplies! 650 Pet Care/ ued at $500.00 or more in labor and No experience required. Start Immediately! materials. State law also requires cell: 415-999-0594 www.homemailerprogram.net (AAN CAN) Grooming/Training that contractors include their license Estate numbers on all advertising. Check 
HAULING  Reefer Drivers Neede All Animals Happy House your contractor’s status at www.cslb. Experienced drivers and Class A com- Pet Sitting Services by Susan ca.gov or 800-321-CSLB (2752). 801 Apartments/ mercial students welcome! Our Incredible A Junk Hauling Service Licensed, insured, refs. Remodels, Additions & New Homes. Unlicensed persons taking jobs that Condos/Studios Freight network offers plenty of miles! 650-323-4000 total less than $500.00 must state Residential & Commercial. Yard Call for your FREE estimate today. Los Altos, 2 BR/2 BA - $2600 Call Prime today!1-800-277-0212. www. in their advertisements that they are clean-up service. Large & Small jobs. PrimeInc.com (Cal-SCAN) HammondHomes7.com not licensed by the Contractors State 650-771-0213 Menlo Park, 2 BR/1 BA - $1,780/mo Lic. #703822 Sales License Board Mountain View, 1 BR/1 BA - $1175 Travel, work, party, play! Now 408-255-9994 AAA Danny’s Haul Away hiring 18-24 guys/gals for exciting Home Residential and commercial waste. Mountain View, 1 BR/1 BA - $1155 travel job. 2 wk pd. training. Hotel/ 650/669-2470 Palo Alto, 1 BR/1 BA - $1,895/mon Transportation provided. Return guaran- 728 Drywall/Plaster AB WEST CONSTRUCTION Portola Valley, Studio - $1,200 teed. Call today/start today. 877-724- Summit Drywall CLINT’S HAULING SERVICE 3713. (Cal-SCAN) Services $

$
 Misc. junk, office, appliances, Sunnyvale, 2 BR/1.5 BA - $1595/mo 730 Electrical garage, storage, etc, clean-ups. Old Sunnyvale, 2 BR/2 BA - $1,695/mo $

$
 ! #
$
 furniture, green waste and yard junk. 703 Architecture/ Alex Electric $
! 
$
"
Licensed & insured. FREE ESTIMATES Sunnyvale, 3 BR/1.5 BA - $1,895/mo Lic #784136. Free Est. $
! 650/368-8810 Design All electrical. 803 Duplex Alex, (650)366-6924 www.ABWESTConstruction.com Design/Permits Fully Furnished New Duplex Home PLACE AN AD One stop for your remodel/design Call E. Marchetti Frank’s Hauling Commercial, Residential, Garage, Available, 2 BR/2.5 BA - $4500 needs. Comp. plans incl structural engi- 741 Flooring/  

 "  ONLINE: fogster.com neering and energy compliance (T-24). Basement & Yard. Clean-up. Fair prices. Palo Alto, 2 BR/2.5 BA - $4500 Carpeting 650/361-8773 ADW 650-969-4980 (650) 799-5521 Palo Alto, 3 BR/2 BA E-MAIL: [email protected] Uncommon Kitchens Design Aladdin Carpet and Floors 767 Movers Bike to Stanford/downtown:20 Sales, installs, remodels and minutes,hardwood & ceramic floor,nice Armandos Moving painting for the home. Free IT’S EASY TO PLACE YOUR AD VIA yard,pet ok. PHONE: 650/326-8216 IT’S EASY TO PLACE YOUR AD VIA est. Lic. 1236 So. Abel St., Milpitas. Homes, Apartments, Storage. Full THE INTERNET. JUST GO TO — Tony, 408-263-1988. THE INTERNET. JUST GO TO — Service moves. Serving the Bay Area for 805 Homes for Rent 20 yrs. Licensed & Insured. Armando, www.MountainViewOnline.com Los Altos, 3 BR/2 BA - $2400.00 www.MountainViewOnline.com 650-630-0424. CAL-T190632 OCTOBER 22, 2010 ■ MOUNTAIN VIEW VOICE ■ 23 Menlo Park, 2 BR/1 BA - $2290. Caretaker-Tenant w/Refs., etc 840 Vacation LAND LIQUIDATION Menlo Park, 2 BR/1 BA - $3250.00 Long-Term Rental Needed 20 Acres $0 Down $99/mo. ONLY 

 Rentals/Time Shares $12,900 near growing El Paso, Texas, Menlo Park, 3 BR/2 BA - $3495 Looking for a place with garage Timeshares Guaranteed Owner Financing, NO CREDIT Office to Share CHECKS! Money back Guarantee. FREE Menlo Park, 3 BR/2 BA Sell/rent for cash! Our Guaranteed Services 



   will Sell/ Rent Your Unused Timeshare for Map/Pictures. 800-755-8953 www.sun- $3,800.LasLomSch,2car Seeking Quiet Cottage/Guest Quar setranches.com (AANCAN) gar,Hardwood flrs,sun rm, dining CASH! Over $78 Million Dollars offered rm,LndRm,InclGard.nosmk/pets, in 2009! www.SellaTimeshare.com (877) Montana 160 Acres 
   
  820 Home Exchanges 554-2098 (Cal-SCAN) It’s here! Elk Hunters and Investors. 650-598-7047 FULLY FURNISHED NEW 2 BEDROOM/2  
 ALL INCLUSIVE GET-AWAY! Mussellshell Area $99,900. 640 Acres Menlo Park, 3 BR/2 BA - $3495 Midtown Palo Alto New Duplex Elk Paradise $599,900. 3000 Acres Bed & Breakfast B&B Hotel of Elk Preserve. Call for prices. 888- Midtown Palo Alto, 2 BR/2.5 BA * )
+ 825 Homes/Condos Midtown Palo Alto New Duplex 361-3006 www.WesternSkiesLand.com Mountain View, 3 BR/2 BA - $2875 (Cal-SCAN) (  
,)
) for Sale North Tahoe Ski Lease Home Palo Alto Furnished, 3 BR/2 BA - $4000/ Truckee 3-level, 4Bedrms, 2Baths, Close mon Los Altos, 2 BR/1 BA - $1,098,000 to ski, Garage,3 queens, 1 bunk Fully 890 Real Estate 




Palo Alto, 4 BR/2 BA - $3900. Palo Alto, 3 BR/3 BA, OPEN HOUSE equipped kitchen,TV, Phone, Internet, Wanted 10/23, 2-4 - $895K Enclosed yard,$2K/month + utilities, 1 Short Term Rental 

 Redwood City, 3 BR/2 BA - $729,950 month security Dec-Apr 650-367-5044 Redwood City, 5+ BR/4+ BA - $2599500 Professional woman needs to take 6    or 650-207-0687 week class at Stanford.Wishes to rent 809 Shared Housing/ Redwood City: Emerald Hills, 5+ BR/4+ Northstar Tahoe room reasonably near campus with bath BA - $2599500 Rooms or can share. From 8th of November San Carlos, 4 BR/2 BA - $839000  
 Los Altos Hills, 1 BR/1 BA - $750 850 Acreage/Lots/ thru 15 of December.Call 402 477-0990 #(( ) or 402 601 2237 Can provide refer- 810 Cottages for Rent 830 Commercial/ Storage ences upon request. LAND LIQUIDATION Menlo Park, 1 BR/1 BA - $1550 mo. Income Property 20 Acres $0 Down 

 
' Palo Alto, 1 BR/1 BA - $1700/mont Deli/Restaurant/Commercial $99/mo. ONLY $12,900 near growing PLACE AN AD El Paso, Texas, Palo Alto, 1 BR/1 BA - $1600/mont  
 OFFICE SPACE Guaranteed Owner Financing, NO ONLINE: fogster.com Woodside/skyline, 2 BR/1 BA - $2500/mos. OFFICE SPACE AVAILABLE! CREDIT CHECKS! E-MAIL: [email protected] ) 
2
Downtown Menlo Park. Money back Guarantee. FREE Map/ 650-218-3669 Pictures. 800-755-8953 (
  815 Rentals Wanted PHONE: 650/326-8216 1 Bedroom House/Cottage www.sunsetranches.com (AAN CAN) 






  

1(

2
 1VCMJD
/PUJDFT 3

'3 This business is owned by: A County Clerk-Recorder of Santa Clara Court of California, County of Santa 995 Fictitious Name Corporation. County on October 12, 2010. Clara, 191 N. First Street, San Jose, !
$ %
#&
' Statement The name and residence address of the (Voice Oct. 22, 29; Nov. 5, 12, 2010) CA 95113. A copy of this ORDER TO CHRISTINA’S SALON owner(s)/registrant(s) is(are): SHOW CAUSE shall be published at  
 FICTITIOUS BUSINESS NAME PURO PERU 997 All Other Legals least once each week for four succes- STATEMENT 1161 N. Lawrence Exp. ORDER TO SHOW CAUSE FOR CHANGE sive weeks prior to the date set for File No.: 542146 Sunnyvale, CA 94089 OF NAME SUPERIOR COURT OF THE hearing on the petition in the following 0 
  The following person (persons) is (are) Registrant/Owner began transacting STATE OF CALIFORNIA FOR THE newspaper of general circulation, doing business as: business under the fictitious business COUNTY OF SANTA CLARA printed in this county: Christina’s Salon at 108B Rengstorff name(s) listed herein on 8/1/10. Case No.: 110CV183142 MOUNTAIN VIEW VOICE Ave., Mountain View, CA 94043, Santa This statement was filed with the TO ALL INTERESTED PERSONS: Date: September 22, 2010 




Clara County. County Clerk-Recorder of Santa Clara Petitioner TERRENCE MICHAEL /s/ Thomas Wm. Cain  

 This business is owned by: An County on September 9, 2010. NICHOLSON JR. filed a petition with this JUDGE OF THE SUPERIOR COURT Individual. (Voice Oct. 8, 15, 22, 29, 2010) court for a decree changing names as (Voice Oct. 1, 8, 15, 22, 2010)   The name and residence address of the GENESIS PHOTOGRAPHY follows: NOTICE OF APPLICATION TO SELL owner(s)/registrant(s) is(are): GENESIS STUDIOS TERRENCE MICHAEL NICHOLSON JR. ALCOHOLIC BEVERAGES MICHAEL WU FICTITIOUS BUSINESS NAME to JENNIFER MURPHY. Date of Filing Application:  
 17815 Condit Rd. STATEMENT THE COURT ORDERS that all persons October 1, 2010 Morgan Hill, CA 95037 File No.: 543454 interested in this matter appear before To Whom It May Concern: #(( ) Registrant/Owner has not yet begun to The following person (persons) is (are) this court at the hearing indicated The Name(s) of Applicant(s) is/are: transact business under the fictitious doing business as: below to show cause, if any, why the LEVEL 10 EVENTS INC. business name(s) listed herein. 1.) Genesis Photography, 2.) Genesis petition for change of name should not The applicants listed above are apply- This statement was filed with the Studios at 185 Moffett Boulevard Mt. be granted. Any person objecting to the ing to the Department of Alcoholic "

 
 
# County Clerk-Recorder of Santa Clara View, CA 94043, Santa Clara County. name changes described above must Beverage Control to sell alcoholic County on September 7, 2010. This business is owned by: file a written objection that includes the beverages at:  
 (Voice Oct. 1, 8, 15, 22, 2010) An Individual. reasons for the objection at least two 1401 N Shoreline Blvd. PURO PERU RESTAURANT The name and residence address of the court days before the matter is sched- Mountain View, CA 94043-1311 owner(s)/registrant(s) is(are): uled to be heard and must appear at Type of license(s) applied for: ) 
 %
FICTITIOUS BUSINESS NAME STATEMENT VINCENT ISOLA the hearing to show cause why the peti- 41 - ON-SALE BEER AND WINE - EATING /&
* ) File No.: 542259 870 South Clover Avenue tion should not be granted. If no written PLACE The following person (persons) is (are) San Jose, CA 95128 objection is timely filed, the court may (Voice Oct. 8, 15, 22, 2010) doing business as: Registrant/Owner began transacting grant the petition without a hearing. 




Puro Peru Restaurant at 1161 N. business under the fictitious business NOTICE OF HEARING: December 7,  

 Lawrence Expressway, Sunnyvale, CA name(s) listed herein on 12/29/1987. 2010, 8:45 a.m., Room: 107. Superior  94089, Santa Clara County. This statement was filed with the WE MEASURE QUALITY BY RESULTS  
 LIFELONG Is Quality Important to You? #(( ) MOUNTAIN VIEW RESIDENT ower of Two! & AREA SPECIALIST The P 
 
 
! s9VONNE*(EYLs Direct (650) 947-4694  
 Cell (650) 302-4055 DRE# 01255661 s*EFF'ONZALEZs 
,
 


DIANE SCHMITZ Realtor Direct (650) 947-4698 -


)(. Cell (408) 888-7748 (650) 947-2955 DRE# 00978793 www.DianeSchmitz.com EMAILTOYVONNEANDJEFF AOLCOMswww.yvonneandjeff.com




[email protected] DRE # 01235034 455 Whisman Park Drive, Mountain View   Open Sat/Sun 1-4

 
 JUST LISTED #(( ) LD Find 
 SO $%
!
  &
'& 
 Your Dream () 
*+
, 
 s"EDROOM  "ATH s"UILT )N3PEAKERSIN,IVING2OOMAND-ASTER Home! s!PPROX 3QUARE&EET "EDROOM - s0ROPERTY"UILTINBY3HEA s7ALK )N#LOSETIN-ASTER"EDROOM s4ILE'AS&IREPLACEIN,IVING2OOM s*ACUZZI4UBW3EPARATE3HOWER3TALLAND $.
/
01) &
'&  s0ROFESSIONAL,ANDSCAPINGIN"ACKYARDAND $OUBLE3INKSIN-ASTER"ATHROOM &RONT9ARD!REA s#ENTRAL!IR#ONDITIONING(EATINGW$UAL 2 +1
, 
 s$ESIGNER0AINT4HROUGHOUT :ONE#ONTROLS s"RAND.EW,IGHT&IXTURES s,OFTFOR/FFICE!REA s"RAND.EW#ARPETON3TAIRS s5PSTAIRS,AUNDRY!REAW3TORAGE#ABINETS s(ARDWOOD&LOORSIN,IVING$INING2OOMS s#AR!TTACHED'ARAGEW2ACKSFOR3TORAGE 

   "EDROOMS 5PSTAIRS(ALLWAYS s4ILE&LOORSIN%NTRY +ITCHEN AND"ATHROOMS Offered at $769,000      INTERO  REAL ESTATE SERVICES® !
"# We have new listings every week! &IRST3T3UITEs,OS!LTOS 24 ■ MOUNTAIN VIEW VOICE ■ OCTOBER 22, 2010  INCREASE
        YOUR It’s all at your fi ngertips:   MountainViewOnline.com/real_estateMMounta EXPOSURE OPEN SAT/SUN 1:30 - 4:30 Get your name known in the Move Right In! community. /PEN3AT3UN PM /PEN3UN PM Showcase your listings to thousands of potential buyers and sellers. 171 Avalon Drive 27500 Deerfield Drive Los Altos Los Altos Hills Stunning One Story has it all. Town & Country Call Rosemary at the Just completed. 4HE"ESTOF"OTH7ORLDS North Los Altos near top schools Incredible & Inspiring Setting Mountain View "2EAWITHOWNBATH ,IBRARYTH"2 NEAR$OWNTOWNs#RAFTEDTO PRICE REDUCED Voice &AMILY0ERFECT #OUNTRY+ITCHEN Delight with European Charm !3UITEOF2OOMS Offered at $2,785,000 905 SAN PIERRE WAY, MOUNTAIN VIEW 650-964-6300 Offered at $2,988,000

329 So. San Antonio Road #6, Los Altos, CA 94022 eautifully updated four bedroom, two bath home on 6,700 sq ft lot. This WWWTEAMABIGAILCOMs,IC home features new dual paned windows, new stucco exterior, remodeled OFlCEsFAXsCELL AbigailResidences Romantiques B bathrooms, fresh paint inside & out, new crown molding & baseboards (PLEASE CHECK WEBSITE “Old Mill” End Unit FOR OPEN HOUSE TIMES) throughout, new driveway, garage door & so much more. A spacious kitchen -Light and Bright- 49 SHOWERS DR. #D464 with eat-in area makes cooking a delight. The comfortable living room has Best Location, Best Views, MOUNTAIN VIEW hardwood floors and the separate family room showcases a wood burning Former Model, Easy parking + www.49ShowersD464.com close to additional parking. fireplace. Great location near Theuerkauf Elementary School with easy access 1.888.328.8097 Tour #273 $695,000 to downtown, shopping and major freeways. Open House Sunday 8 Years New! Offered at $795,000 3 BR—3 BA 21 ROYAL OAK CT. Stunning architecture MOUNTAIN VIEW 3-level-2 car gar. Great location. Howard www.21RoyalOak.com Priced way under market. 1.888.328.8097 BLOOM Tour #175 $629,000 Real Estate Service That Delivers Francis C. ROLLAND - serving you Since 1985 650.947.4780 DIRECT  650.619.2737 MOBILE Direct: 650-947-2259 [email protected]  www.howardbloom.com [email protected] DRE #00893793 MIRAMONTE

=
IN MOUNTAIN VIEW An instant classic =
PRICED FROM $1,298,950 =
TOP-RATED SCHOOLS MOUNTAIN N in the heart of the Silicon Valley. VIEW CENTRAL EXPWY 101 =
WINNER OF GOLD NUGGET ARCHITECTURE AWARD AND BEST IN CASTRO ST SHORELINE BLVD Convenient location. Classic architecture. Discover the simple pleasures of a genuine neighborhood at LOS AMERICAN LIVING ALTOS SUNNYVALE Miramonte. Located on the Los Altos side of El Camino within walking distance of downtown Mountain GOLD AWARD EL CAMIN O REA View, Miramonte has all the features you want in a place called home. From top-notch entertainment at the 85 L MIRAMONTE AVE =
CLOSE TO DINING leading performing arts theater on the Peninsula, to outstanding schools and recreational neighborhood 280 AND ENTERTAINMENT parks, it’s all conveniently close. Visit today. You may just fi nd that your dream home is already a reality. =
NEARBY PARKS AND LITTLE LEAGUE COMPLEX Close-out sale now in progress. Visit today!

1136 Miramonte Avenue • Mountain View, CA 94040 • (888) 224-4515 • classiccommunities.net

Prices effective as of date of publication. Map not to scale.

OCTOBER 22, 2010 ■ MOUNTAIN VIEW VOICE ■ 25 "'#6=>3AB@33Bj;=C3<AC<2/G (!´"(!>;k

Real Estate Made Simple

Mountain View !032A #0/B6A1:/AA71=@757

OPEN SUNDAY, 1:30-4:30 OPEN SUNDAY, 1:30-4:30 OPEN SUNDAY, 1:30-4:30 OPEN SUNDAY, 1:30-4:30

LOS ALTOS CUPERTINO LOS ALTOS LOS ALTOS 101 ANGELA DR. $1,697,000 10535 MADRONE CT. $2,795,000 126 S. CLARK AVE. $2,895,000 1640 CRESTVIEW DR. $2,950,000 NEW ON THE MARKET! Close to downtown, 4BR/2.5BA This stunning 4 BR/4.5 BA home, + sep. office. Gorgeous newly built Mediterranean Estate. 6BR/4.5BA, Stunning contemporary in the Country Club Area. Approx Ranch Style w/ updates throughout. Separate Dining Wonderful detail throughout w/ gorgeous Australian formal LR & DR, Chef’s kitchen, spacious family rm 4,500 sq.ft. hs, 14,250 sq.ft. lot. 4BR/ 4.5BA, Sep. rm, Living rm & Family rm. Newly landscaped yards, Eucalyptus hdwd flrs, pool, fountain, outdoor bbq & opens to ideal yard for entertaining. Close to town & office w/ loft & Au pair quarters. Great for entertaining. pool + spa. fireplace. Views of the Bay and Western Hills. Los Altos Schools.

OPEN SUNDAY, 1:30-4:30 OPEN SUNDAY, 1:30-4:30 BY APPOINTMENT ONLY BY APPOINTMENT ONLY

LOS ALTOS HILLS LOS ALTOS HILLS LOS ALTOS HILLS LOS ALTOS HILLS 25829 SPRINGHILL DR. $2,985,000 13914 MIR MIROU DR. $6,450,000 GREAT LOCATION $2,795,000 PARK LIKE SETTING $3,495,000 Contemporary 4BR/3BA home w/ flexible floor plan & Exceptional Estate includes a 1.12 Acre parcel w/ main Updated 4BR/ 3.5BA, Chef’s style kitchen, & spacious One of a kind, Designed by renowned architect Goodwin upgrades throughout. Quiet setting on level acre w/ home 6BR/5.5BA, pool, gazebo + a 1.25 Acre parcel w/ family rm. Pvt yard with pool & expansive lawn area, Steinberg. 3BR/2.5BA situated on 3 acres of park-like sprawling lawns & solar pool/spa, Room for guest hs. gst house, tennis court, total of 2.37 Acres adj. to the ideal for family sports. Room for guesthouse, minutes setting w/ pool, spa & sprawling lawns. P.A. Schools. Preserve. P.A. Schools. to L.A. Village, & Bullis Charter School.

Worldwide Referral and Global Internet Exposure. Go to www.campi.com for a complete search. 33AN!NTONIO2D ,OS!LTOSs650.941.4300

26 ■ MOUNTAIN VIEW VOICE ■ OCTOBER 22, 2010 


  
 
 

 
 

  

 
 



  
  
 
 
 

 
   
 

  
  
 


   

   
 
    
  


   
  
 

    
 
 
 

  !
 
 !

  


 
  
 
 
 
 


  " #
   $
 
 

    
 
 
 #


    
 
   %

  &  
    
"   !
'

(
  
 
$ 
&  
) 


 
  
  *
 

 


 
& 

 
  
+ , -.
/!011
2


3
) 
 
-
 *
5  
 6 , -.
!114
2


 

) 
 
708@!@/1.11  

 6
.881  .  -
 *    


 


  
  
 

 
  

    
   
5
 




 
 
   


     
 


 
<
= 
& 
>
(
   
5
> $ 
 
    8
  


  &  
 
  
 
#
 


   
 
 
 

  !

 
 


 

 
(
   
 

 
 
 
 


  ; 
 
  
 


  $
 
 


   
   
 


 

3
  &  
 
 
  "   
"   !
$

(
  
$ 
&  
) 


 
  
  *
  
 , -.
:!:11
2


3
) 
 
-
 *
, -.
!/10
2


 

) 
 
5  
 6 -
 * 701!111.11  

 6
.809:;.  ,   



 

  

 #
 
  
  ?&!
'?%!
>?5!
&? ):/1*
@4#90  A   .  .? > .  ?"
B11@@//@  

 


 

OCTOBER 22, 2010 ■ MOUNTAIN VIEW VOICE ■ 27 Sun 1:30-4:30 Sat/Sun 1:00-4:00 Sat/Sun 1:30-4:30

SUNNYVALE 4 BR | 2 BA PALO ALTO 3 BR | 1 BA MOUNTAIN VIEW 5 BR | 2.5 BA 625 W REMINGTON DR $868,000 3141 LOUIS RD $949,000 1355 LLOYD WY $1,149,000 4 BR 2 BA Atrium model w/skylight,updated kitch w/tile counters & 3 BR 1 BA Move right in! Updates, great outoor living space, next to 5 BR 2.5 BA On oversized lot.Within blocks of Dwntwn MV,McKelvey wood-trimmed cabinets,Fam Rm. Seale Park. Prk,Ice Cream. Melanie Johnson 650.948.0456 R. Brendan Leary 650.325.6161 Elizabeth Thompson 650.941.7040

Sun 1:30-4:30 Sun 1:30-4:30 Sun 1:30-4:30

Open Sat/Sun

MOUNTAIN VIEW 3 BR | 2 BA MOUNTAIN VIEW 1 BR | 1 BA LOS ALTOS 2 BR | 2.5 BA 295 FARLEY ST $649,000 505 CYPRESS POINT DR #292 $279,000 81 LOS ALTOS SQUARE $808,000 3 BR 2 BA Granite counters with task lighting, French doors to 1 BR 1 BA Open patio facing redwood trees, creek & pool. Near vibrant 2 BR 2.5 BA Sleek home,remdld w/granite in kitchen & baths.Open Sunroom, New floors & paint, Pergola. downtown Mountain View. living/dining space w/fp. Gordon Ferguson 650.328.5211 R. Brendan Leary 650.325.6161 Charlene & Vicki Geers 650.941.7040

LOS ALTOS LOS GATOS MOUNTAIN VIEW PALO ALTO PALO ALTO 1466 CLUB VIEW TERRACE 460 SANTA ROSA DR 2459 ELKA AV 2527 GREER RD 555 BYRON ST #207 SAT/SUN 1-4 $2,195,000 SUN 1:30 - 4:30 $1,995,000 SAT/SUN 1 - 4 $749,000 SAT/SUN 1:30 - 4:30 $1,245,000 SUN 1:30 - 4:30 $725,000 5 BR 4 BA Spacious 3,978 sq ft.home w/views of 4 BR 4.5 BA An upper-level mstr ste is a lav- 3 BR 2 BA Shows grt! Quiet loc! nicely updated 5 BR 2 BA Spacious and well maintained Eichler on 2 BR 2 BA Luxury Condos in Downtown PA w/ the Bay.41,400 sq.ft.lot,Prestigious street.Office. ish retreat w/a separate sitting area,pass-through w/wood floors,freash paint,front landscape, must a cul-de-sac. Lot is approx 10,000 sq.ft. exceptional amenities. Pool, fitness rm, guest apts. Phyllis & Jamie Carmichael 650.941.7040 frplc. see! Lea Nilsson 650.328.5211 Jo Jackson/Barbara Sawyer 650.325.6161 1574 FRONTERO AV Vicki Geers 650.941.7040 Cesar Cervantes/David Korner 650.328.5211 382 CHRISTOPHER CT REMODELED END UNIT CONDO $449,000 SAT/SUN 1:30 - 4:30 $1,725,000 1469 TYLER PARK WY SAT/SUN 1:30 - 4:30 $1,129,000 1 BR 1 BA Contemporary 1 level w/ hi ceiling, lr/dr 4 BR 3.5 BA 22,000+ sf lot: Backyrd oasis w/pool MENLO PARK SUN 1:30 - 4:30 $635,000 3 BR 2 BA South Palo Alto residence privately situ- combo, open granite kit, cheery br, garden patio Barbara Sawyer 650.325.6161 & spa. Sep office, bath, & sleeping area 215 HANNA WAY 2 BR 2.5 BA Close to Cuesta Pk,shipping & ated on a large lot in a cul-de-sac location. Elena Talis/Di Pali Shah 650.325.6161 Owen Halliday 650.325.6161 SUN 1:30 - 4:30 $2,595,000 great schls.Convinient to Hwys.Includes new REDWOOD CITY 614 TORWOOD LN 4 BR 3.5 BA Tree-lined street, 1/3+ acre lot, formal Kt&windows. 961 MADDUX DR SAT/SUN 1:30 - 4:30 $1,548,000 dining, great room, 2 master suites, hrdw flrs. Susan Marsella 650.941.7040 SAT 1:30 - 4:30 $1,159,000 507 BUENA VISTA AV 5 BR 2 BA Expanded & remodeled 2007.Granite SUN 1:30 - 4:30 $1,095,000 4 BR 3 BA Beautiful updated home in exquisite R. Brendan Leary 650.325.6161 1354 DALE AV #1 kitchen, stainless appl, new roof. Great location! 3 BR 2 BA Open floor plan, updated, large lot, No.Los Altos.New roof,paint,carpet. 1350 SHERMAN AV SUN 1:30 - 4:30 $525,000 Rod Creason 650.325.6161 detached bonus room, pool, gated front yard. Barbara Cannon 650.941.7040 SUN 1:30 - 4:30 $2,095,000 2 BR 2.5 BA 2 lrg bdrms w/priv.balconies,plus GRACIOUS EASY CARE HOME $1,108,000 R. Brendan Leary 650.325.6161 1419 MIRAMONTE AV 4 BR 3 BA Enjoy both - location and house. Lg. kit/ patio,LivRm/DinRm combo,2-car attchd 3 BR 2 BA Gracious home w/bonus dining room 314 E ST SUN 1 - 4 $1,274,950 great room. Formal LR+DR. Oak floors.2 FP. gar,frplc,A/C. Brendan Callahan 650.325.6161 &bedroom. Solar-heated sparkling pool in back SUN 1 - 4 $599,000 4 BR 2 BA Setting on large 14,400 sq ft lot, Backs Kathy Horvath 650.941.7040 315 HEDGE RD yard. 3 BR 1 BA Shows well w/hdwd flrs, updatd to Heritage Oaks Park. CONDO IN SECURED BUILDING $239,000 SAT/SUN 1:30 - 4:30 $1,272,000 Joanne Shapiro 650.328.5211 kit&bath. Dual paned windws, grt deck & trellis Phyllis & Jamie Carmichael 650.941.7040 1 BR 1 BA Great condo in secured building. 3 BR 2.5 BA Fabulous home in Suburban Park. 683 WAVERLEY ST in lrg yd. 36 LYELL ST Upgrades include granite countertops,French drs Three baths, bonus rm, fam. rm, DR, country SUN 1:30 - 4:30 $1,049,000 Wendi Selig-Aimonetti 650.328.5211 to LR, W/D SUN 1:30 - 4:30 $999,000 kitchen, pool. 2 BR 2.5 BA Remodeled downtown townhome w/ 2722 WASHINGTON AVENUE 4 BR 3 BA Remodeled 4 bedrooms, 3 bath.Prime Arvada Darnell/Jeff Beltramo 650.325.6161 Rod Creason 650.325.6161 two mastr suites located just steps frm University SAT/SUN 1:30 - 4:30 $749,000 Los Altos downtown location!Beautiful tree & 1020 SHERMAN AV PALO ALTO Ave shops 4 BR 2 BA Ideally located near shopping, schools yard. SUN 1:30 - 4:30 $1,249,000 Tim Trailer 650.325.6161 and major commute routes Terri Couture 650.941.7040 4 BR 2 BA This charming home near Downtown NEW HOME IN OLD PALO ALTO $4,450,000 354 EMBARCADERO RD Dana Willson 650.941.7040 LIGHT & BRIGHT END UNIT $765,000 5 BR 5.5 BA New 5,695sf home w/gourmet kit & SUN 1:30 - 4:30 $1,079,000 Menlo Park features stepping stones & towering SAN JOSE 2 BR 2.5 BA Townhome just steps to downtown trees. att FR w/FP.Full basement w/media room. MST 3 BR 2 BA Turn of the century charmer with period Los Altos. Sep. LR, DR and FR. Largest unit! Wenda Puzzo 650.325.6161 ste w/walk-in details through out. Old PA, close to Trader Joe's 4158 SAMSON WAY Owen Halliday 650.325.6161 BEAUTIFUL SPACIOUS HOME $898,000 Debbie Nichols 650.325.6161 Sharon Witte 650.325.6161 SAT 2 - 4:30 $664,950 535 TYNDALL ST 3 BR 2.5 BA Beautiful, spacious 3-level home. Walls OLD PALO ALTO $3,849,000 1613 MARIPOSA AV 3 BR 2 BA Dual pane wndws,Hrdwd Flrs thru SUN 1:30 - 4:30 $525,000 of glass. Large, bright kitchen w/breakfast rm. 4 BR 3 BA Classic center hall colonial hm on a lrg SAT/SUN 1:30 - 4:30 $1,075,000 out,Granite in Kit & baths. 2 BR 2 BA One level condo in the heart of Los Ken Morgan/Arlene Gault 650.328.5211 12,825 sq. ft. lot. Separate dining rm, hd flrs. 2 BR 2 BA Remodeled Beauty near Paly H.S. w/bonus Phyllis & Jamie Carmichael 650.941.7040 Altos.Lrg priv.front yrd. Debbie Nichols 650.325.6161 office/bedroom, granite kitchen, vaulted ceilings. 5564 YALE DR Shelly Potvin 650.941.7040 MOUNTAIN VIEW 1881 FULTON ST $2,195,000 Celia Bella 650.325.6161 SUN 1:30 - 4:30 $555,000 575 TYNDALL ST. #7 1201 EL MONTE AV OPEN SUN 1:30-4:30 3065 GREER RD 3 BR 2 BA W/dual pane wndws,newer roof & SUN 1:30 - 4:30 $498,000 SUN 1:30 - 4:30 $1,048,000 3 BR 2 BA One Level Hm on Christmas Tree Lane. SUN 1 - 4 $998,000 diswasher.New carpet & wood grain laminate flrs. 2 BR 2 BA Upgraded single story close to down- 3 BR 2 BA Custom built home on corner lot w/ LR w/FP, DR &Court Yard to entertain. Secret 4 BR 2 BA Uniquely enlarged converted garage - Lrg yard. Marcie Soderquist 650.941.7040 town LA. LR w/FP. Detached gar. Private patio Remodeled kitchen. Garden. with high super ceilings, lots of light. Joanne Fraser 650.941.7040 Jerry Haslam 650.948.0456 w/storage Ann Anni Chu 650.328.5211 SANTA CLARA Leannah Hunt & Laurel Robinson DUPLEX IN MOUNTAIN VIEW! $849,000 2-HOMES,INCOME, BUILD NEW $1,549,000 4290 PONCE DR 650.325.6161 Spacious duplex in Mtn. View! Each unit has 2 2-Homes, 12,900 sq ft lot, Build your Dream home. SAT/SUN 1:30 - 4:30 $875,000 GREAT INVESTMENT OPPORT. $899,000 3 BR 2 BA Large 3BR+Loft/2BA, 2-car attached Ellie Zias 650.941.7040 bedrooms,1 bath, & garage! BY APPT. ONLY! Use as Rental Income. Move-in Condition! LOS ALTOS HILLS DiPali Shah 650.325.6161 Deborah Greenberg 650.328.5211 gar. Gunn HS Dist (ck availability). Community 3846 BALDWIN DR pool. SAT/SUN 1:30 - 4:30 $820,000 26932 BEATRICE LN 330 VELARDE ST 336 HAWTHORNE AV SAT/SUN 1:30 - 4:30 $839,950 Dante Drummond 650.325.6161 3 BR 2 BA Fantastic location in highly desirable SUN 1:30 - 4:30 $3,500,000 SUN 1:30 - 4:30 $1,495,000 2 BR 1 BA Charming home in Dwntwn MtnVw. 3712 HERON WAY Westwd Oaks neighborhood.www.3846Baldwin. 4 BR 5.5 BA On a quiet cul de sac,spacious 2 BR 2 BA Modern Living in Downtown Palo Alto. www.330Velarde.com SUN 1:30 - 4:30 $838,000 com rms,designer touches,priv.1 acre lushly landscaped Ric Parker 650.948.0456 Award winning design by David Solnick Architect. 3 BR 3 BA Elegant 2-year new townhome, many Ric Parker 650.948.0456 setting. Rod Creason 650.325.6161 139 CONCORD CI green built w/energy efficient features. Gary Herbert 650.941.7040 SUN 1:30 - 4:30 $828,000 3907 GROVE AVENUE $1,350,000 Judy Shen 650.328.5211 WOODSIDE 24040 OAK KNOLL CIRCLE 3 BR 2.5 BA 16-yr-old contemporary w/Los Altos SAT/SUN 1:30 - 4:30 GREAT PA OPPORTUNITY! $799,000 0 SKYLINE BL $1,990,000 SUN 1:30 - 4:30 $3,198,000 schools K-12. Backyard w/patio. New paint/floor- 4 BR 2.5 BA Completely renovated.Kit,baths,dual 3 BR 2 BA Charming bungalow. Freshly painted, SAT 1:30 - 3:30 5 BR 5.5 BA Imagine living in your own amazing villa ing. pane wndws & doors & more.Lrg lot. granite countertops, wood flooring, prof. land- 40 Acre Estate Property. Surrounded by estates w/a personal vineyard,Bay & hill views. Julie Lau 650.325.6161 Vivi Chan 650.941.7040 scaping. and open space. RSVP for Tours Jo Buchanan & Stuart Bowen 650.941.7040 809 ALICE AV 1499 COWPER ST Jon Anderson 650.325.6161 Gordon Ferguson 650.328.5211 12790 CAMINO MEDIO LN SAT/SUN 1:30 - 4:30 $825,000 SUN 1:30 - 4:30 $1,299,000 4137 THAIN WY 308 BLAKEWOOD WY $998,000 SUN 1:30 - 4:30 $2,500,000 3 BR 2 BA Updated w/granite & stainless steel 3 BR 2.5 BA Bring your contractor! Explore SUN 1:30 - 4:30 $739,000 SUN 1:30 - 4:30 5 BR 2 BA Remodel or build your dream home on in kitchen w/breakfast bar.LivRm has frplc & bay options on 7k SF lot in Old PA facing Lawn Bowling 2 BR 2 BA Cathedral ceilings, firepl, wd flrs, good 3 BR 2.5 BA Idyllic treasure offers a calm oasis in a this mostly flat lot close to the village. PA schools. wndw Green Pk light, good storage, balconies, big laundry rm. secluded street close to neighborhood amenities Dorothy Gurwith 650.325.6161 Jim Galli 650.941.7040 Geraldine Asmus 650.328.5211 Dan Ziony 650.325.6161 Susan Selkirk 650.325.6161

©2009 Coldwell Banker Real Estate LLC. All Rights Reserved. Coldwell Banker® is a registered trademark licensed to Coldwell Banker Real Estate LLC.  An Equal Opportunity Company. Equal Housing Opportunity . Each Coldwell Banker Residential Brokerage Office Is Owned And Operated by NRT LLC.  DRE License # 00313415

28 ■ MOUNTAIN VIEW VOICE ■ OCTOBER 22, 2010