LYK5 (STRADA) Rabbit Polyclonal Antibody – TA330986 | Origene

Total Page：16

File Type：pdf, Size：1020Kb

LYK5 (STRADA) Rabbit Polyclonal Antibody – TA330986 | Origene

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA330986 LYK5 (STRADA) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-LYK5 antibody: synthetic peptide directed towards the N terminal of human LYK5. Synthetic peptide located within the following region: MSFLTNDASSESIASFSKQEVMSSFLPEGGCYELLTVIGKGFEDLMTVNL Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 44 kDa Gene Name: STE20-related kinase adaptor alpha Database Link: NP_001003787 Entrez Gene 92335 Human Q7RTN6 Background: LYK5 belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily. It contains 1 protein kinase domain. LYK5 is a pseudokinase which, in complex with CAB39, binds to and activates STK11. It relocates STK11 from the nucleus Synonyms: LYK5; NY-BR-96; PMSE; Stlk; STRAD Note: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 92%; Bovine: 92%; Dog: 86% This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 LYK5 (STRADA) Rabbit Polyclonal Antibody – TA330986 Protein Families: Druggable Genome, Protein Kinase Protein Pathways: mTOR signaling pathway Product images: WB Suggested Anti-LYK5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:500; Positive Control: Human Spleen This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 2.

Copy Link

Recommended publications

FK506-Binding Protein 12.6/1B, a Negative Regulator of [Ca2+], Rescues Memory and Restores Genomic Regulation in the Hippocampus of Aging Rats
This Accepted Manuscript has not been copyedited and formatted. The final version may differ from this version. A link to any extended data will be provided when the final version is posted online. Research Articles: Neurobiology of Disease FK506-Binding Protein 12.6/1b, a negative regulator of [Ca2+], rescues memory and restores genomic regulation in the hippocampus of aging rats John C. Gant1, Eric M. Blalock1, Kuey-Chu Chen1, Inga Kadish2, Olivier Thibault1, Nada M. Porter1 and Philip W. Landfield1 1Department of Pharmacology & Nutritional Sciences, University of Kentucky, Lexington, KY 40536 2Department of Cell, Developmental and Integrative Biology, University of Alabama at Birmingham, Birmingham, AL 35294 DOI: 10.1523/JNEUROSCI.2234-17.2017 Received: 7 August 2017 Revised: 10 October 2017 Accepted: 24 November 2017 Published: 18 December 2017 Author contributions: J.C.G. and P.W.L. designed research; J.C.G., E.M.B., K.-c.C., and I.K. performed research; J.C.G., E.M.B., K.-c.C., I.K., and P.W.L. analyzed data; J.C.G., E.M.B., O.T., N.M.P., and P.W.L. wrote the paper. Conflict of Interest: The authors declare no competing financial interests. NIH grants AG004542, AG033649, AG052050, AG037868 and McAlpine Foundation for Neuroscience Research Corresponding author: Philip W. Landfield, [email protected], Department of Pharmacology & Nutritional Sciences, University of Kentucky, 800 Rose Street, UKMC MS 307, Lexington, KY 40536 Cite as: J. Neurosci ; 10.1523/JNEUROSCI.2234-17.2017 Alerts: Sign up at www.jneurosci.org/cgi/alerts to receive customized email alerts when the fully formatted version of this article is published.
[Show full text]
A Sensitized RNA Interference Screen Identifies a Novel Role for the PI3K P110γ
Author Manuscript Published OnlineFirst on June 7, 2011; DOI: 10.1158/1541-7786.MCR-10-0200 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. 1 A sensitized RNA interference screen identifies a novel role for the PI3K p110γ isoform in medulloblastoma cell proliferation and chemoresistance Ana S. Guerreiro 1, Sarah Fattet 2,3, Dorota W. Kulesza 1, Abdullah Atamer 1, Alexandra N. Elsing 1, Tarek Shalaby 1, Shaun P. Jackson 4, Simone M. Schoenwaelder 4, Michael A. Grotzer 1, Olivier Delattre 2, and Alexandre Arcaro 1,5 1 Department of Oncology, University Children’s Hospital, Zurich, Switzerland 2 Laboratoire de Pathologie Moléculaire des Cancers, Institut Curie, Paris, France 3 Unité d'Hématologie et Oncologie Pédiatrique, Centre Hospitalier Universitaire Vaudois Lausanne (CHUV), Lausanne, Switzerland 4 Australian Centre for Blood Diseases, Monash University, 6th Floor Burnet Building Alfred Medical Research and Education Precinct, Prahran, Victoria, Australia 5 Division of Pediatric Hematology/Oncology, Department of Clinical Research, University of Bern, Switzerland Requests for reprints: Alexandre Arcaro, University of Bern, Department of Clinical Research, Tiefenaustrasse 120c, 3004 Bern, Switzerland. Tel. +41 31 308 80 29; FAX +41 31 308 80 28; Email [email protected] Grant Support: This work was supported by grants from the Werner und Hedy Berger-Janser – Stiftung zur Erforschung der Krebskrankheiten, the Forschungskredit der Universität Zürich, the Fondation FORCE, the Stiftung zur Krebsbekämpfung and the European Community FP7 (ASSET, project number: 259348) to AA. Running title: Role of p110γ in medulloblastoma Keywords: medulloblastoma; phosphoinositide 3-kinase; Akt; apoptosis; chemoresistance Downloaded from mcr.aacrjournals.org on October 5, 2021.
[Show full text]
Effects of Rapamycin on Social Interaction Deficits and Gene
Kotajima-Murakami et al. Molecular Brain (2019) 12:3 https://doi.org/10.1186/s13041-018-0423-2 RESEARCH Open Access Effects of rapamycin on social interaction deficits and gene expression in mice exposed to valproic acid in utero Hiroko Kotajima-Murakami1,2, Toshiyuki Kobayashi3, Hirofumi Kashii1,4, Atsushi Sato1,5, Yoko Hagino1, Miho Tanaka1,6, Yasumasa Nishito7, Yukio Takamatsu7, Shigeo Uchino1,2 and Kazutaka Ikeda1* Abstract The mammalian target of rapamycin (mTOR) signaling pathway plays a crucial role in cell metabolism, growth, and proliferation. The overactivation of mTOR has been implicated in the pathogenesis of syndromic autism spectrum disorder (ASD), such as tuberous sclerosis complex (TSC). Treatment with the mTOR inhibitor rapamycin improved social interaction deficits in mouse models of TSC. Prenatal exposure to valproic acid (VPA) increases the incidence of ASD. Rodent pups that are exposed to VPA in utero have been used as an animal model of ASD. Activation of the mTOR signaling pathway was recently observed in rodents that were exposed to VPA in utero, and rapamycin ameliorated social interaction deficits. The present study investigated the effect of rapamycin on social interaction deficits in both adolescence and adulthood, and gene expressions in mice that were exposed to VPA in utero. We subcutaneously injected 600 mg/kg VPA in pregnant mice on gestational day 12.5 and used the pups as a model of ASD. The pups were intraperitoneally injected with rapamycin or an equal volume of vehicle once daily for 2 consecutive days. The social interaction test was conducted in the offspring after the last rapamycin administration at 5–6 weeks of ages (adolescence) or 10–11 weeks of age (adulthood).
[Show full text]
Phytophthora Sojae Effector Avr1d Functions As an E2 Competitor and Inhibits Ubiquitination Activity of Gmpub13 to Facilitate Infection
Phytophthora sojae effector Avr1d functions as an E2 competitor and inhibits ubiquitination activity of GmPUB13 to facilitate infection Yachun Lina,b,c,1, Qinli Hud,e,1, Jia Zhoud,e, Weixiao Yina,f, Deqiang Yaog, Yuanyuan Shaoa, Yao Zhaoa,b,c, Baodian Guoa,b,c, Yeqiang Xiaa,b,c, Qian Chenh,i, Yan Wanga,b,c, Wenwu Yea,b,c, Qi Xiei, Brett M. Tylerj, Weiman Xingk,2, and Yuanchao Wanga,b,c,2 aDepartment of Plant Pathology, Nanjing Agricultural University, 210095 Nanjing, China; bThe Key Laboratory of Integrated Management of Crop Diseases and Pests (Ministry of Education), Nanjing Agricultural University, 210095 Nanjing, China; cThe Key Laboratory of Plant Immunity, Nanjing Agricultural University, 210095 Nanjing, China; dShanghai Center for Plant Stress Biology and Center of Excellence in Molecular Plant Sciences, Chinese Academy of Sciences, Shanghai 200032, China; eUniversity of Chinese Academy of Sciences, Beijing 100049, China; fDepartment of Plant Pathology, College of Plant Science and Technology and the Key Lab of Crop Disease Monitoring and Safety Control in Hubei Province, Huazhong Agricultural University, 430070 Wuhan, China; giHuman Institute, ShanghaiTech University, Shanghai 201210, China; hMinistry of Agriculture Key Lab of Pest Monitoring and Green Management, Department of Plant Pathology, College of Plant Protection, China Agricultural University, 100193 Beijing, China; iState Key Laboratory of Plant Genomics, Institute of Genetics and Developmental Biology, The Innovative Academy of Seed Design, Chinese Academy of Sciences,
[Show full text]
Potential Genotoxicity from Integration Sites in CLAD Dogs Treated Successfully with Gammaretroviral Vector-Mediated Gene Therapy
Gene Therapy (2008) 15, 1067–1071 & 2008 Nature Publishing Group All rights reserved 0969-7128/08 $30.00 www.nature.com/gt SHORT COMMUNICATION Potential genotoxicity from integration sites in CLAD dogs treated successfully with gammaretroviral vector-mediated gene therapy M Hai1,3, RL Adler1,3, TR Bauer Jr1,3, LM Tuschong1, Y-C Gu1,XWu2 and DD Hickstein1 1Experimental Transplantation and Immunology Branch, Center for Cancer Research, National Cancer Institute, National Institutes of Health, Bethesda, Maryland, USA and 2Laboratory of Molecular Technology, Scientific Applications International Corporation-Frederick, National Cancer Institute-Frederick, Frederick, Maryland, USA Integration site analysis was performed on six dogs with in hematopoietic stem cells. Integrations clustered around canine leukocyte adhesion deficiency (CLAD) that survived common insertion sites more frequently than random. greater than 1 year after infusion of autologous CD34+ bone Despite potential genotoxicity from RIS, to date there has marrow cells transduced with a gammaretroviral vector been no progression to oligoclonal hematopoiesis and no expressing canine CD18. A total of 387 retroviral insertion evidence that vector integration sites influenced cell survival sites (RIS) were identified in the peripheral blood leukocytes or proliferation. Continued follow-up in disease-specific from the six dogs at 1 year postinfusion. A total of 129 RIS animal models such as CLAD will be required to provide an were identified in CD3+ T-lymphocytes and 102 RIS in accurate estimate
[Show full text]
Inaugural-Dissertation Zur Erlangung Der Doktorwürde Der Naturwissenschaftlich-Mathematischen Gesamtfakultät Der Ruprecht-Kar
Inaugural-Dissertation zur Erlangung der Doktorwürde der Naturwissenschaftlich-Mathematischen Gesamtfakultät der Ruprecht-Karls-Universität Heidelberg vorgelegt von Diplom-Biochemiker Stefan Knoth Tag der mündlichen Prüfung: 25.07.2006 Titel der Arbeit: Regulation der Genexpression bei der Erythroiden Differenzierung Gutachter: Prof. Dr. Stefan Wölfl, Universität Heidelberg Prof. Dr. Katharina Pachmann, Universität Jena Prof. Dr. Jürgen Reichling Prof. Dr. Ulrich Hilgenfeldt Zusammenfassung Viele Erkrankungen des blutbildenden Systems, insbesondere Leukämien, haben ihre Ursache in einer Störung der Differenzierungvorgänge, die ausgehend von undifferenzierten Stammzellen des Knochenmarks zu allen Arten von hochspezialisierten Blutzellen führen. Bei der Chronischen Myeloischen Leukämie (CML) im Stadium der Blastenkrise kommt es zu einer unkontrollierten Vermehrung unreifer Blasten. Alle Chronischen Myeloischen Leukämien exprimieren dass Fusionsprotein BCR-ABL welches aus der Translokation t(9;22)(q34;q11) resultiert. BCR-ABL ist eine konstitutiv aktive Proteinkinase und stimuliert die Zellen zu unkontrolliertem Wachstum. Es ist bekannt, dass sich bei transformierten Zellen mit verschiedenen Substanzen wie AraC oder Butyrat die Proliferation unterdrücken und eine weitere Differenzierung induzieren lässt. Daher werden diese Substanzen oder ihre Derivate als Therapeutika eingesetzt bzw. als solche erprobt. Bei CML-Zellen geht man davon aus, dass durch die genannten Chemikalien die Differenzierung in Richtung der erythroiden Reihe stimuliert wird, da verstärkt Hämoglobine synthetisiert werden. Wegen ihrer einfachen Handhabung in Kultur wurden diese Zellsysteme in der Vergangenheit häufig als Modelle zur Untersuchung der erythroiden Differenzierung verwendet. Die therapeutikastimulierte erythroide Differenzierung von CML-Zellen ist also in zweierlei Hinsicht interessant, einerseits aus medizinischer Sicht zur Bewertung der Vorgänge im behandelten Patienten und andererseits hinsichtlich der Eignung dieser Systeme als Modelle zur Erforschung der Erythropoese.
[Show full text]
Thesis Reference
Thesis A kinome-wide RNAi screen to identify genes controlling membrane lipid homeostasis in human cells GEHIN, Charlotte Abstract The control of lipid homeostasis is a fundamental process that allows cells to maintain the unique lipid composition of their membrane compartments and to deal with the energetic fluxes from metabolism. If most of enzymes involved in lipid metabolism are characterized, the question of the genetic control of lipid homeostasis is still outstanding. In order to find genes that control the homeostasis of membrane lipids, I combined a large-scale RNAi screen targeting the human knome with the techniques of targeted lipidomic analysis by mass spectrometry to monitor lipid changes in HeLa cells. Data analysis of the screen allowed the characterization of candidate genes involved in the control of membrane lipid homeostasis. In parallel, in the context of the NCCR Chemical Biology, I developed a robotically-assisted siRNA transfection assay and screened a library of chemicals potentially able to transfect siRNA in Human cells at least as efficiently than commercially available compounds. Reference GEHIN, Charlotte. A kinome-wide RNAi screen to identify genes controlling membrane lipid homeostasis in human cells. Thèse de doctorat : Univ. Genève, 2014, no. Sc. 4670 URN : urn:nbn:ch:unige-380353 DOI : 10.13097/archive-ouverte/unige:38035 Available at: http://archive-ouverte.unige.ch/unige:38035 Disclaimer: layout of this document may differ from the published version. 1 / 1 UNIVERSITÉ DE GENÈVE FACULTÉ DES SCIENCES
[Show full text]
View.50 the Small figure Shows the R2 Between the Two Snps Highlighted in Red
META-ANALYSIS www.jasn.org Common Variants in UMOD Associate with Urinary Uromodulin Levels: A Meta-Analysis † ‡ | †† Matthias Olden,* Tanguy Corre, § Caroline Hayward, Daniela Toniolo,¶** Sheila Ulivi, ††‡‡ ‡ Paolo Gasparini, Giorgio Pistis,¶ Shih-Jen Hwang,* Sven Bergmann, § Harry Campbell,§§ ††‡‡ ††‡‡ || Massimiliano Cocca,¶ Ilaria Gandin, Giorgia Girotto, Bob Glaudemans, | ††† Nicholas D. Hastie, Johannes Loffing,¶¶ Ozren Polasek,*** Luca Rampoldi,§§ Igor Rudan, ‡‡‡ ††‡‡ Cinzia Sala,¶ Michela Traglia,¶ Peter Vollenweider, Dragana Vuckovic, || || | ‡ ||| ||| Sonia Youhanna, §§§ Julien Weber, §§§ Alan F. Wright, Zoltán Kutalik, § Murielle Bochud, || Caroline S. Fox,*¶¶¶ and Olivier Devuyst §§§ *National Heart, Lung, and Blood Institute’s Framingham Heart Study, Framingham, Massachusetts; †Department of Genetic Epidemiology, Institute of Epidemiology and Preventive Medicine, University of Regensburg, Regensburg, Germany; ‡Department of Medical Genetics, University of Lausanne, Lausanne, Switzerland; §Swiss Institute of Bioinformatics, Lausanne, Switzerland; |Institute of Genetics and Molecular Medicine, Western General Hospital, and ‡‡‡Centre for Population Health Sciences, University of Edinburgh, Edinburgh, Scotland, United Kingdom; ¶Division of Genetics and Cell Biology, San Raffaele Scientific Institute, Milano, Italy; **Institute of Molecular Genetics, National Research Council, Pavia, Italy; ††Institute for Maternal and Child Health, Burlo Garofolo Pediatric Institute Trieste, Italy; ‡‡Department of Medical Sciences, University of
[Show full text]
Download Validation Data
PrimePCR™Assay Validation Report Gene Information Gene Name STE20-related kinase adaptor alpha Gene Symbol STRADA Organism Human Gene Summary The protein encoded by this gene contains a STE20-like kinase domain but lacks several residues that are critical for catalytic activity so it is termed a 'pseudokinase'. The protein forms a heterotrimeric complex with serine/threonine kinase 11 (STK11 also known as LKB1) and the scaffolding protein calcium binding protein 39 (CAB39 also known as MO25). The protein activates STK11 leading to the phosphorylation of both proteins and excluding STK11 from the nucleus. The protein is necessary for STK11-induced G1 cell cycle arrest. A mutation in this gene has been shown to result in polyhydramnios megalencephaly and symptomatic epilepsy (PMSE) syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described but their full-length nature is not known. Gene Aliases FLJ90524, LYK5, NY-BR-96, PMSE, STRAD, Stlk RefSeq Accession No. NC_000017.10, NT_010783.15, NG_015817.1 UniGene ID Hs.514402 Ensembl Gene ID ENSG00000125695 Entrez Gene ID 92335 Assay Information Unique Assay ID qHsaCID0016267 Assay Type SYBR® Green Detected Coding Transcript(s) ENST00000336174, ENST00000375840, ENST00000447001, ENST00000392950, ENST00000245865 Amplicon Context Sequence CGCTGCCCATGGCTTATCATGCTGAGGTTGCTGCGCAAACCAGACAGGTAGACC TTCCCATCCACAGAGATCAGGATGTGGCTGGCTTTGACACTCCTGTGTACATATC CCATGTGGTGGATGTAGTCGAGGGCCTTCAGCACCC Amplicon Length (bp) 115 Chromosome Location 17:61784683-61787899 Assay Design Intron-spanning Purification Desalted Validation Results Efficiency (%) 103 Page 1/5 PrimePCR™Assay Validation Report R2 0.9994 cDNA Cq 22.26 cDNA Tm (Celsius) 84 gDNA Cq 41.26 Specificity (%) 100 Information to assist with data interpretation is provided at the end of this report.
[Show full text]
AMPK Causes Cell Cycle Arrest in LKB1-Deficient Cells Via Activation of CAMKK2
Published OnlineFirst May 2, 2016; DOI: 10.1158/1541-7786.MCR-15-0479 Cell Cycle and Senescence Molecular Cancer Research AMPK Causes Cell Cycle Arrest in LKB1-Deficient Cells via Activation of CAMKK2 Sarah Fogarty, Fiona A. Ross, Diana Vara Ciruelos, Alexander Gray, Graeme J. Gowans, and D. Grahame Hardie Abstract The AMP-activated protein kinase (AMPK) is activated by also caused G1 arrest similar to that caused by expression of LKB1, phosphorylation at Thr172, either by the tumor suppressor kinase while expression of a dominant-negative AMPK mutant, or a þ LKB1 or by an alternate pathway involving the Ca2 /calmodulin- double knockout of both AMPK-a subunits, also prevented the dependent kinase, CAMKK2. Increases in AMP:ATP and ADP:ATP cell-cycle arrest caused by A23187. These mechanistic findings ratios, signifying energy deficit, promote allosteric activation and confirm that AMPK activation triggers cell-cycle arrest, and also net Thr172 phosphorylation mediated by LKB1, so that the LKB1– suggest that the rapid proliferation of LKB1-null tumor cells is due AMPK pathway acts as an energy sensor. Many tumor cells carry to lack of the restraining influence of AMPK. However, cell-cycle loss-of-function mutations in the STK11 gene encoding LKB1, but arrest can be restored by reexpressing LKB1 or a constitutively LKB1 reexpression in these cells causes cell-cycle arrest. Therefore, active CAMKK2, or by pharmacologic agents that increase intra- þ it was investigated as to whether arrest by LKB1 is caused by cellular Ca2 and thus activate endogenous CAMKK2. activation of AMPK or of one of the AMPK-related kinases, which are also dependent on LKB1 but are not activated by CAMKK2.
[Show full text]
Three Novel Mutations of STK11 Gene in Chinese Patients with Peutz
Tan et al. BMC Medical Genetics (2016) 17:77 DOI 10.1186/s12881-016-0339-6 CASE REPORT Open Access Three novel mutations of STK11 gene in Chinese patients with Peutz–Jeghers syndrome Hu Tan1, Libin Mei1, Yanru Huang1, Pu Yang1, Haoxian Li1, Ying Peng1, Chen Chen1,2, Xianda Wei1, Qian Pan1, Desheng Liang1* and Lingqian Wu1* Abstract Background: Peutz–Jeghers syndrome (PJS) is a rare autosomal dominant inherited disorder characterized by gastrointestinal (GI) hamartomatous polyps, mucocutaneous hyperpigmentation, and an increased risk of cancer. Mutations in the serine–threonine kinase 11 gene (SKT11) are the major cause of PJS. Case presentation: Blood samples were collected from six PJS families including eight patients. Mutation screening of STK11 gene was performed in these six families by Sanger sequencing and multiplex ligation- dependent probe amplification (MLPA) assay. Three novel mutations (c.721G > C, c.645_726del82, and del(exon2–5)) and three recurrent mutations (c.752G > A, c.545 T > C and del(exon1)) in STK11 were detected in six Chinese PJS families. Genotype-phenotype correlations suggested that truncating mutations trend to result in severe complications. Conclusion: These findings broaden the mutation spectrum of the STK11 gene and would help clinicians and genetic counselors provide better clinical surveillance for PJS patients, especially for ones carrying truncating mutation. Keywords: Peutz–Jeghers syndrome (PJS), Serine-threonine kinase 11 (STK11), Truncating mutation, Severe complication Background as a cause of PJS in 1998 [3, 4]. The gene, 23 kb in size, Peutz–Jeghers syndrome (PJS) is a rare autosomal dom- consists of nine coding exon and one non-coding exon inant inherited disorder characterized by gastrointestinal and encodes a 433-amino acid protein, which consists of (GI) hamartomatous polyps, mucocutaneous hyperpig- three domains: the N-terminal non-catalytic domain, the mentation of the lips, buccal mucosa, and digits.
[Show full text]
Triphosphate Receptor in Arabidopsis Thaliana A
IDENTIFICATION OF A NOVEL EXTRACELLULAR ADENOSINE 5’-TRIPHOSPHATE RECEPTOR IN ARABIDOPSIS THALIANA A Dissertation Presented to The Faculty of the Graduate School At the University of Missouri – Columbia In Partial Fulfillment Of the Requirements for the Degree Doctor of Philosophy By An Quoc Pham Dr. Gary Stacey, Dissertation Supervisor December, 2019 The undersigned, appointed by the Dean of the Graduate School, have examined the Dissertation entitled: IDENTIFICATION OF A NOVEL EXTRACELLULAR ADENOSINE 5’-TRIPHOSPHATE RECEPTOR IN ARABIDOPSIS THALIANA Presented by An Quoc Pham A candidate for the degree of Doctor of Philosophy And hereby certify that, in their opinion, it is worthy of acceptance. Professor Gary Stacey Professor Walter Gassmann Professor Melissa G. Mitchum Professor Gary A. Weisman ACKNOWLEDGEMENTS I would like to thank my advisor, Prof. Gary Stacey, for giving me an excellent opportunity to work in his lab; thank you for your patience, understanding, encouragement, and guidance in research, career, and life. My sincere thanks to my advisory committee members, Prof. Walter Gassmann, Prof. Melissa G. Mitchum and Prof. Gary A. Weisman for their constructive advice and supportive encouragement. I appreciate Dr. Yangrong Cao and Dr. Kiwamu Tanaka, who guided me in the first two years. Also, I warmly thank Dr. Sung-Hwan Cho, Dr. Deawon Kim and Dr. Dongqin Chen for guiding me to complete my thesis. I want to thank Dr. Cuong T. Nguyen, my lab member, who not only contributed to this study but also supported me a lot in my student life. I am grateful to Prof. Bing Stacey, Dr. Phat Do and Dr.
[Show full text]