DOCSLIB.ORG

SPECIAL GUEST Barn 15 Hip No

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
SPECIAL GUEST Barn 15 Hip No Consigned by Lane's End, Agent Hip No. SPECIAL GUEST Barn 549 Bay Mare; foaled 2009 15 Raise a Native Mr. Prospector ...................... Gold Digger Smart Strike .......................... Smarten Classy 'n Smart .................... No Class SPECIAL GUEST Nijinsky II Seattle Dancer ...................... My Charmer Gwenjinsky ............................ (1992) Taylor's Falls Carols Folly .......................... No Trespassing By SMART STRIKE (1992). Black-type winner of $337,376, Philip H. Iselin H. [G1] , etc. Leading sire twice, sire of 19 crops of racing age, 1596 foals, 1284 starters, 131 black-type winners, 13 champions, 949 winners of 3055 races and earning $146,878,217. Sire of dams of 96 black-type winners, including champions Mine That Bird, Inglorious, Eye of the Leopard, Stacked Deck, Desert Power, Smart D N A, Cowboy Son, and of Strong Return, Dullahan, Shared Account, First Dude, Dixie Strike, Cambodia. 1st dam GWENJINSKY, by Seattle Dancer. Placed at 3 and 4, $5,600. Dam of 14 reg - istered foals, 14 of racing age, 11 to race, 10 winners, including-- LEAD STORY (f. by Editor's Note). 8 wins, 2 to 5, $842,031, Falls City H. [G2] (CD, $207,204), Louisville Breeders' Cup H. [G2] (CD, $202,740), Churchill Downs Distaff H. [G2] (CD, $139,748), HBPA H. [L] (ELP, $61,250), 2nd Ban - shee Breeze H. [L] (GP, $15,000), 3rd Rampart H. [G2] (GP, $22,000), Sabin H. [G3] (GP, $11,000), Hoosier Debutante S. [L] (HOO, $11,495). CAPEJINSKY (g. by Cape Town). 5 wins, 2 to 5, $188,411, Dover S. [L] (DEL, $60,000), 2nd Whirling Ash S. (DEL, $11,740). PRIZE CATCH (f. by A.P. Indy). 3 wins at 3 and 4, $138,810, Key to the Bridge S. (BEL, $36,000). Producer. Strike Midnight (c. by Smart Strike). 2 wins, $220,897, 2nd Gio Ponti S. (AQU, $25,000), English Channel S. (BEL, $20,000), Manila S. (BEL, $20,000), 3rd National Museum of Racing Hall of Fame S. [G2] (SAR, $20,000). Glory Glory (f. by Honour and Glory). Winner at 2 and 3, $83,810, 2nd Flawlessly S. [L] (AP, $12,600). Producer. Federal Agent (g. by Curlin). 11 wins, 4 to 8, 2018, $178,590. Sir Ray (c. by Smart Strike). 3 wins at 3 and 4, 2018, $77,350. 2nd dam CAROLS FOLLY , by Taylor's Falls. 5 wins, $32,756, Airdrie S. (BIR, $12,000), etc. Half-sister to Heroe Silencioso ($108,504). Dam of 3 winners, incl.-- UNBRIDLED ELAINE (f. by Unbridled's Song). 6 wins, $1,770,740, Breeders' Cup Distaff [G1] , etc. Dam of ETCHED [G2] (c. by Forestry, sire), etc. GLITTER WOMAN (f. by Glitterman). 10 wins, $1,256,805, Ashland S. [G1] , etc. Dam of POLITICAL FORCE [G1] (c. by Unbridled's Song, $607,232). RACE RECORD: At 2, unraced; at 3, once 2nd, once 3rd; at 4, three wins, once 3rd; at 5, twice 2nd in 2 starts. Earned $114,736. PRODUCE RECORD: 2015 Elkhorn Poet, c. by Dunkirk. Winner at 2 and 3, 2018, $23,033. 2016 Parade Field, c. by Quality Road. Unplaced in 1 start. 2017 not mated; 2018 f. by Mineshaft. Mated to Mineshaft (A.P. Indy--Prospectors Delite), last service May 11, 2018. (Believed to be PREGNANT )..
Load more

Recommended publications
  • Breeding Anne Peters [email protected] Pedigree Analysis
    BREEDING ANNE PETERS [email protected] Pedigree Analysis Dunkirk Picks Up Unbridled’s Song’s Torch s the calendar flips over to it (Banshee Breeze), and Quiet Aa new year, it’s always edu- American did well with it (Real cational to look at the top fresh- Quiet). Unbridled’s Song sired man sires—those with their first four grade I winners with In Real- crop of 2-year-olds—and see how ity in their dams (Political Force, this crop is unfolding. To date Splendid Blended, Unrivaled the leader is Dunkirk, by a mar- Belle, and Unbridled Elaine). gin of almost $400,000 ahead of Dunkirk’s other graded stakes Pioneerof the Nile. Colonel John, winner, Dunkin Bend, is out of a Diabolical, and Kodiak Kowboy mare by Vindication, which makes round out the top five. him inbred 4x3 to Seattle Slew, the Dunkirk has 14 juvenile win- sire of both A.P. Indy and Vindi- ASUNCION PINEYRUA ners, tied with other freshmen Di- cation. This inbreeding to Seattle Dunkirk abolical and Kodiak Kowboy, but Slew along the “inside” of a pedi- Dunkirk’s winners include a pair gree, through broodmare sires, is a tional, a more accomplished offspring of Unbridled’s of graded stakes winners, Havana successful pattern and has worked Song, topped this sire class when he entered stud the and Dunkin Bend. Havana won well with other stallions carrying same year at a fee of $25,000. Another, the grade II the Foxwoods Champagne Stakes Seattle Slew in their dam’s sire in- winner Old Fashioned, retired that season and stood (gr.
    [Show full text]
  • Pacific Wind Captures the G2 Ruffian at Belmont Park
    PASSPORT Pacific Wind captures the G2 Ruffian at Belmont Park OVERVIEW G2 winner/G1Placed on the DIRT G2 placed on the TURF By leading sire CURLIN Half-Sister to multiple Graded Stakes Winner PACIFIC WIND HIP Curlin x Shag, by Dixieland Band 163 BARN 9 Selling Tuesday, November 5th PAST PERFORMANCES G1Ws G2Ws G1W GSP G2W G2W Pacific Wind put together an unforgettable debut performance winning by 4 ½ lengths (Replay) over a mile on the turf at Santa Anita and was anointed as a TDN ‘Rising Star’ for her efforts. Pacific Wind becomes a ‘Rising Star’ with a 4 ½ length, debut win at Santa Anita. She would earn graded blacktype in her next two races, finishing 3rd in both the G2 Honeymoon and the G3 Senorita, both over the TURF at Santa Anita. Later in her three-year-old season, she was tried on the dirt for the first time over 1 1/16 miles at Santa Anita and responded with a 1 ¾ lengths win (Replay), earning a then career best Beyer of 93, beating future G2W/G1P LA FORCE At four, she was sent east to the barn of Chad Brown, who brought her back in an allowance race at Keeneland over a mile on the dirt where she crushed her foes by 8 ¼ lengths (Replay), beating G1W SAILOR'S VALENTINE. Her (22) Thoro-Graph figure in this race matched the number that G1W SHE'S A JULIE earned when winning this year’s G1 La Troienne. Next out, she was sent off favored in the G2 Ruffian over a mile at Belmont Park, where she won by a length (Replay), defeating G2 winners HIGHWAY STAR, TEQUILITA, FAYPIEN and UNCHAINED MELODY.
    [Show full text]
  • Mating Analysis West Coast
    MATING ANALYSIS You may submit your mare online at lanesend.com or call 859-873-7300 to discuss your matings with CHANCE TIMM, [email protected], JILL MCCULLY, [email protected] or LEVANA CAPRIA, [email protected]. WEST COAST Flatter – Caressing by Honour and Glory 2014 Bay l 16.2 Hands “An Eclipse Award winning champion, West Coast is by an outstanding sire son of A.P. Indy, out of a ChampionTwo-Year-Old Filly. West Coast earned a title as Champion Three-Year-Old Colt with five consecutive victories, four in stakes events, and ran 1-2-3 in six consecutive grade one events, including when capturing the Travers Stakes (G1) and Pennsylvania Derby (G1). He is by Flatter, a leading stallion son of A.P. Indy, and sire of more than 50 stakes winners, and out of Caressing, Champion and Breeders’ Cup (G1) winner at two.“ The offspring of West Coast will be free of Northern Dancer at four generations on their sire’s side, and Flatter has crossed well with a wide variety of broodmare sires from that line. The cross with mares from the Danzig branch of Northern Dancer has been particulary productive with seven stakes winners, including graded stakes winners Classic Point and Mad Flatter out of mares by Langfuhr and Honor Grades (who gives inbreeding to the dam of A.P. Indy), and there are also stakes winners out of mares by War Front – who appears particularly interesting here, giving inbreeding to Relaunch and a full-sister – Danzig Connection, Ghazi and Military (who would be intriguing here).
    [Show full text]
  • Jockey Records
    JOCKEYS, KENTUCKY DERBY (1875-2020) Most Wins Jockey Derby Span Mts. 1st 2nd 3rd Kentucky Derby Wins Eddie Arcaro 1935-1961 21 5 3 2 Lawrin (1938), Whirlaway (’41), Hoop Jr. (’45), Citation (’48) & Hill Gail (’52) Bill Hartack 1956-1974 12 5 1 0 Iron Liege (1957), Venetian Way (’60), Decidedly (’62), Northern Dancer-CAN (’64) & Majestic Prince (’69) Bill Shoemaker 1952-1988 26 4 3 4 Swaps (1955), Tomy Lee-GB (’59), Lucky Debonair (’65) & Ferdinand (’86) Isaac Murphy 1877-1893 11 3 1 2 Buchanan (1884), Riley (’90) & Kingman (’91) Earle Sande 1918-1932 8 3 2 0 Zev (1923), Flying Ebony (’25) & Gallant Fox (’30) Angel Cordero Jr. 1968-1991 17 3 1 0 Cannonade (1974), Bold Forbes (’76) & Spend a Buck (’85) Gary Stevens 1985-2016 22 3 3 1 Winning Colors (1988), Thunder Gulch (’95) & Silver Charm (’98) Kent Desormeaux 1988-2018 22 3 1 4 Real Quiet (1998), Fusaichi Pegasus (2000) & Big Brown (’08) Calvin Borel 1993-2014 12 3 0 1 Street Sense (2007), Mine That Bird (’09) & Super Saver (’10) Victor Espinoza 2001-2018 10 3 0 1 War Emblem (2002), California Chrome (’14) & American Pharoah (’15) John Velazquez 1996-2020 22 3 2 0 Animal Kingdom (2011), Always Dreaming (’17) & Authentic (’20) Willie Simms 1896-1898 2 2 0 0 Ben Brush (1896) & Plaudit (’98) Jimmy Winkfield 1900-1903 4 2 1 1 His Eminence (1901) & Alan-a-Dale (’02) Johnny Loftus 1912-1919 6 2 0 1 George Smith (1916) & Sir Barton (’19) Albert Johnson 1922-1928 7 2 1 0 Morvich (1922) & Bubbling Over (’26) Linus “Pony” McAtee 1920-1929 7 2 0 0 Whiskery (1927) & Clyde Van Dusen (’29) Charlie
    [Show full text]
  • SMART STRIKE B, 1992
    SMART STRIKE b, 1992 height 16.0 Dosage (20-7-17-0-2); DI: 3.38; CD: 0.93 RACE AND (STAKES) RECORD See gray pages—Polynesian Age Starts 1st 2nd 3rd Earned Native Dancer, 1950 Polynesian, by Unbreakable 22s, SW, $785,240 2 0 0 0 0 — Raise a Native, 1961 304 f, 43 SW, 4.06 AEI Geisha, by Discovery 3 4 3 1 0 $51,416 4s, SW, $45,955 4 4 3(2) 0 0 $285,960 838 f, 78 SW, 2.34 AEI Raise You, 1946 Case Ace, by Teddy 24s, SW, $37,220 Totals 8 6(2) 1 0 $337,376 Mr. Prospector, b, 1970 14s, SW, $112,171 14 f, 12 r, 11 w, 2 SW Lady Glory, by American Flag Won Philip H. Iselin H (gr. I, 8.5f), Salvator Mile H 1,178 f, 181 SW, 3.98 AEI Nashua, 1952 Nasrullah, by Nearco (gr. III, 8f). 7.62 AWD 30s, SW, $1,288,565 SIRE LINE Gold Digger, 1962 638 f, 77 SW, 2.37 AEI Segula, by Johnstown 35s, SW, $127,255 SMART STRIKE is by MR. PROSPECTOR, stakes 12 f, 7 r, 7 w, 3 SW Sequence, 1946 Count Fleet, by Reigh Count winner of $112,171, Gravesend H, etc., and sire of 181 17s, SW, $54,850 stakes winners, including champions CONQUISTADOR 8 f, 8 r, 8 w, 3 SW Miss Dogwood, by Bull Dog CIELO (Horse of the Year and champion 3yo colt), Cyane, 1959 Turn-to, by Royal Charger RAVINELLA (in Eur, Eng, and Fr), GULCH, FORTY NINER, 14s, SW, $176,367 ALDEBARAN, RHYTHM, IT’S IN THE AIR, GOLDEN Smarten, 1976 401 f, 47 SW, 2.34 AEI Your Game, by Beau Pere 27s, SW, $716,426 ATTRACTION, EILLO, QUEENA, MACHIAVELLIAN, etc.
    [Show full text]
  • SOUTHERN STRIKE Barn 5 Hip No
    Consigned by Glennwood Farm Inc., Agent Hip No. SOUTHERN STRIKE Barn 154 Bay Mare; foaled 2007 5 Raise a Native Mr. Prospector ...................... Gold Digger Smart Strike .......................... Smarten Classy 'n Smart .................... No Class SOUTHERN STRIKE His Majesty Pleasant Colony .................... Sun Colony Promenade Colony .............. (1992) Northern Dancer Dance Review ........................ Dumfries By SMART STRIKE (1992). Black-type winner of $337,376, Philip H. Iselin H. [G1] , etc. Leading sire twice, sire of 19 crops of racing age, 1596 foals, 1284 starters, 131 black-type winners, 13 champions, 949 winners of 3055 races and earning $146,878,217. Sire of dams of 96 black-type winners, including champions Mine That Bird, Inglorious, Eye of the Leopard, Stacked Deck, Desert Power, Smart D N A, Cowboy Son, and of Strong Return, Dullahan, Shared Account, First Dude, Dixie Strike, Cambodia. 1st dam PROMENADE COLONY, by Pleasant Colony. Winner at 3, $20,910. Sister to DANCE COLONY [G2] , Colonial Review [L], half-sister to ANOTHER REVIEW [G1] ($752,370), NO REVIEW [G1] ($634,545), Rap and Dance , Pleasant Review [L]. Dam of 18 registered foals, 18 of racing age, including a 2-year-old of 2019, 12 to race, 8 winners, including-- PROMENADE GIRL (f. by Carson City). 8 wins, 2 to 4, $678,990, Molly Pitcher Breeders' Cup H. [G2] (MTH, $180,000), Nellie Morse S. [L] (LRL, $51,000), etc. Dam of CAVORTING (f. by Bernardini, 8 wins, $2,063,000, Ogden Phipps D. [G1] (BEL, $535,000), etc.), Thirstforlife (g. by Stay Thirsty, to 4, 2018, $328,665, 2nd Mineshaft H. [G3] (FG, $30,000), etc.).
    [Show full text]
  • Lookin at Lucky (Usa) ______
    LOOKIN AT LUCKY (USA) ________________________________________________________________________________________ RAISE A NATIVE MR PROSPECTOR GOLD DIGGER (USA) (USA) SMART STRIKE (CAN) SMARTEN (USA) CLASSY 'N SMART NO CLASS (CAN) LOOKIN AT LUCKY (CAN) (USA) (2007) DANZIG (USA) A BAY HORSE BELONG TO ME (USA) BELONGING (USA) PRIVATE FEELING CLEVER TRICK (USA) (USA) (1999) REGAL FEELING (USA) SHARP BELLE (USA) LOOKIN AT LUCKY (USA) (c by Smart Strike (CAN)), Champion 2yr old colt in U.S.A. in 2009, Champion 3yr old colt in U.S.A. in 2010, won 9 races at 2 and 3 years in U.S.A. and £2,137,439 including Del Mar Futurity, Del Mar, Gr.1, Izod Haskell Invitational Stakes, Monmouth Park, Gr.1, Norfolk Stakes, Santa Anita, Gr.1, Preakness Stakes, Pimlico, Gr.1, Cashcall Hollywood Futurity, Hollywood Park, Gr.1, Best Pal Stakes, Del Mar, Gr.2, Rebel Stakes, Oaklawn Park, Gr.2 and Indiana Derby, Hoosier Park, Gr.2, placed three times viz second in Grey Goose Breeders' Cup Juvenile, Santa Anita, Gr.1, third in Santa Anita Derby, Santa Anita, Gr.1 and fourth in Breeders’ Cup Classic Stakes, Churchill Downs, Gr.1; sire. 1st Dam. PRIVATE FEELING (USA) (f by Belong To Me (USA)), won 2 races at 3 years in U.S.A. and placed once; dam of three winners including- LOOKIN AT LUCKY (USA) (c. by Smart Strike (CAN)), see above. KENSEI (USA) (c. by Mr Greeley (USA)), won 5 races at 2, 3 and 5 years in U.S.A. and £502,942 including Dwyer Stakes, Belmont Park, Gr.2, Jim Dandy Stakes, Saratoga, Gr.2 and Salvator Mile Stakes, Monmouth Park, Gr.3, placed 6 times viz second in Derby Trial Stakes, Churchill Downs, Gr.3, Duncan F Kenner Stakes, Fair Grounds, L., Majestic Light Stakes, Monmouth Park, L., Santana Mile Stakes, Santa Anita, L., third in Jerome Handicap, Belmont Park, Gr.2 and Woody Stephens Stakes, Belmont Park, Gr.2; sire.
    [Show full text]
  • Headline News
    MISWAKI DIES HEADLINE p. 4 NEWS For information about TDN, DELIVERED EACH NIGHT BY FAX AND FREE BY E-MAIL TO SUBSCRIBERS OF call 732-747-8060. www.thoroughbreddailynews.com SATURDAY, DEC. 18, 2004 ECLIPSE BATTLE IN FUTURITY SOARING FREE AT THE SOVEREIGN AWARDS With divisional honors hanging in the balance, eight Soaring Free (Smart Strike) was the star of a big juveniles will go postward in today’s GI Hollywood show for Sam-Son Farms at the Sovereign Awards Futurity at Hollywood Park. Unbeaten Declan’s Moon Friday night at the Wyndham Bristol Place Hotel in (Malibu Moon), the 7-5 morning-line favorite, jumped Toronto, Ontario. The Sam-Son homebred’s outstand- from a debut win at Del Mar July ing campaign, highlighted by victory in the GI Atto Mile, 31 to wins in the Sept. 8 GII Del earned him titles of Horse of the Year and Champion Mar Futurity and Nov. 20 GIII Turf Horse. Also represented by Champion Three-Year- Hollywood Prevue. He’ll be mak- Old Filly Eye of the Sphynx ing his two-turn bow this after- (Smart Strike), Sam-Son was noon as he takes on Breeders’ honored with awards for both Cup Juvenile winner Wilco (Awe- Outstanding Breeder and Out- some Again) and GI Champagne Declan’s Moon Benoit standing Owner. It was the S. winner Proud Accolade (Yes fifth straight Sovereign Award It’s True). Since springing a 28-1 upset in the Juvenile, in the Breeder category for Wilco has joined the barn of Craig Dollase. Dollase perennial powerhouse Sam- reported yesterday that the chestnut colt suffered a Son, and their eighth overall quarter crack in his left front foot, although he is still Smart Strike Owner award.
    [Show full text]
  • STRIKE FREE Barn 12 Hip No
    Consigned by Bluewater Sales LLC, Agent V Hip No. STRIKE FREE Barn 460 Dark Bay or Brown Mare; foaled 2013 12 Raise a Native Mr. Prospector ...................... Gold Digger Smart Strike .......................... Smarten Classy 'n Smart .................... No Class STRIKE FREE Harlan Menifee ................................ Anne Campbell Wow Me Free ........................ (2004) With Approval Double Wow ........................ Triple Wow By SMART STRIKE (1992). Black-type winner of $337,376, Philip H. Iselin H. [G1] , etc. Leading sire twice, sire of 19 crops of racing age, 1596 foals, 1292 starters, 136 black-type winners, 14 champions, 964 winners of 3196 races and earning $154,050,388. Sire of dams of 111 black-type winners, including champions Mine That Bird, Inglorious, Eye of the Leopard, Stacked Deck, Moonlit Promise, Desert Power, Smart D N A, Cowboy Son, and of Strong Return, Dullahan, Shared Account, First Dude, Dixie Strike. 1st dam WOW ME FREE , by Menifee. 5 wins, 2 to 4, $204,202, in N.A./U.S., Next Move H. [G3] (AQU, $63,840), Ladies H. [L] (AQU, $48,630), 3rd Shuvee H. [G2] (BEL, $15,000), Wide Country S. (LRL, $5,500). (Total: $215,739). Dam of 7 other registered foals, 6 of racing age, 6 to race, 2 winners-- Treasury Bill (c. by Lemon Drop Kid). 5 wins, 3 to 9, $318,707, 2nd San Vi - cente S. [G2] (SA, $30,000), Buddy Diliberto Memorial S. (FG, $10,000), 3rd Came Home S. (BHP, $8,622). Moon Launch (g. by Malibu Moon). Winner at 3 and 4, 2020, $46,417. 2nd dam DOUBLE WOW, by With Approval.
    [Show full text]
  • Fashionably Late
    drf.com/breeding DAILY RACING FORM Sunday, February 9, 2014 PAGE 11 fashionably late JOHN P. SPARKMAN As the stud career of the late, great Storm Cat began to wind down in the early 2000s, the Kentucky breeding indus- try needed a successor as the designated young sire of sires. The obvious choice seemed to be Unbridled’s Song, who had begun his stud career brilliantly, with Breeders’ Cup Distaff winner Unbridled Elaine, Grade 1 winner Songandaprayer, and multiple Grade 2 winner Even the Score in his first crop and Grade 1 winner Buddha in his second. As recently as the middle of last year, however, the investment the breeding industry made in sons of Unbridled’s Song looked like an expensive wager gone very wrong, since Even the Score, the sire of Dullahan and Take the Points, was his only son to have sired a Grade 1 winner. That lackluster record began to improve dramatically in the last half of the year, as Unbridled’s Song’s sons First Defence, Benoit & AssociAtes Dunkirk, and Rockport Harbor all added Fashion Plate wins the Las Virgenes Stakes on Feb. 1, becoming the first Grade 1 Grade 1 winners to their stud records. winner for Unbridled’s Song’s son Old Fashioned. After last Saturday’s Grade 1 Las Virgenes Stakes at Santa Anita, another Honest Man, both by Unbridled’s Song, with similar disdain in the 1 1/8-mile, name can be added to that list, a name that were only a few months away from their Grade 2 Remsen Stakes at Aqueduct a could turn out to be the most promising maiden victories.
    [Show full text]
  • Graydar Oxbow
    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
    [Show full text]
  • Stallion Synopsis For: Not This Time Prepared By: Alan Porter Prepared For: Taylor Made Stallions
    STALLION SYNOPSIS FOR: NOT THIS TIME PREPARED BY: ALAN PORTER PREPARED FOR: TAYLOR MADE STALLIONS INC Pedigree Consultants are able to help you in all facets of your thoroughbred investment. Not only are we able to proven mating advice but we are also able to advise on mare selection, management and promotion of stallions, and selection and purchase of racing and breeding stock. For more information on the services visit www.pedigreeconsultants.com, email [email protected] or call +1 859 285 0431. NOT THIS TIME The most brilliant two-year-old son of sire of sires, Giant’s Causeway, Not This Time was also arguably the fastest and most spectacular two-year-old of his crop. In addition to being by Storm Cat’s leading sire son, he is out of record-breaking graded and multiple stakes winning Miss Macy Sue – also dam of brilliant Breeders’ Cup Mile (gr. I) victor Liam’s Map – and descends from Ta Wee, a two-time Champion Sprinter who is half-sister to the legendary Dr. Fager. Giant’s Causeway has demonstrated an affinity for the Fappiano branch of Mr. Prospector, and Fappiano is particularly interesting here, as he is out of a mare by Dr. Fager, which should work extremely well with remarkable strong Tartan Farm/Genter heritage in the dam of Not This Time (which includes inbreeding to Dr. Fager’s brilliant half-sister, Ta Wee). We can note that Unbridled’s Song – a grandson of Fappiano – is the sire of Not This Time’s brilliant half-brother Liam’s Map.
    [Show full text]