DOCSLIB.ORG

Case1152843710.Pdf (5.16

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Case1152843710.Pdf (5.16 GEMIN FUNCTION IN SMALL NUCLEAR RNP BIOGENESIS AND SPINAL MUSCULAR ATROPHY By KARL BRYAN SHPARGEL Submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy Thesis Advisor: Dr. A. Gregory Matera Department of Genetics CASE WESTERN RESERVE UNIVERSITY August, 2006 CASE WESTERN RESERVE UNIVERSITY SCHOOL OF GRADUATE STUDIES We hereby approve the dissertation of ______________________________________________________ candidate for the Ph.D. degree *. (signed)_______________________________________________ (chair of the committee) ________________________________________________ ________________________________________________ ________________________________________________ ________________________________________________ ________________________________________________ (date) _______________________ *We also certify that written approval has been obtained for any proprietary material contained therein. Table of Contents List of figures………………………………………………………………………….....6 Acknowledgements………………………………………………………………......…..8 Abbreviations………………………………………………………………………..…...9 Abstract………………………………………………………………………………….10 Chapter I: Introduction and Research Objectives………………………...…………12 Introduction………………………………………………………………………13 Spinal Muscular Atrophy…………………………………………...……13 The SMN complex……………………………………………………….16 snRNP biogenesis……………………………………………………..…18 The Cajal body…………………………………………………………...22 Dilemmas in SMA pathogenesis and snRNP biogenesis…………...……26 Research Objectives……………………………………………………...………29 Chapter II: Gemin proteins are required for efficient assembly of Sm-class RNPs………………………………………………………….30 Abstract………………………………………………………………………..…31 Introduction………………………………………………………………………32 Materials and Methods…………………………………………………………...35 Results and Discussion…………………………………………………………..38 3 Chapter III: Drosophila Gemin3 is essential for larval motor function, pupation, and viability………………………………….……56 Abstract…………………………………………………………………………..57 Introduction…………………………………………………………………...….58 Materials and Methods………………………………………………………...…62 Results………………………………………………………………………...….65 Discussion……………………………………………………………..…………85 Chapter IV: Discussion and future directions………………………………..………88 What factors regulate Cajal body homeostasis?....................................................89 Gemin proteins function in snRNP assembly, but by what mechanism?............................................................................................................91 Are Gemins required for additional snRNP biogenesis steps?..............................94 Can Gemin snRNP biogenesis defects promote Spinal Muscular Atrophy?................................................................................................95 Which SMN functions are required for appropriate neuromuscular development?................................................................................97 Does the primary SMA defect originate in neurons or muscle (or both)? ...............................................................................................................98 Why does snRNP biogenesis have such a profound effect on motor neurons?.....................................................................................................103 Appendix Chapter I: Control of Cajal body number is mediated by the coilin C-terminus……………………………………...108 Abstract…………………………………………………………………...….…109 Introduction……………………………………………………………….....….110 Materials and Methods……………………………………………………...…..114 Results…………………………………………………………………………..115 Discussion……………………………………………………………………....134 4 Appendix Chapter II: Exogenous Gemin4 expression enhances Gemin3 and SMN nuclear localization…………….……….138 Abstract…………………………………………………………...…………….139 Materials and Methods…………………………………….……………………140 Results and Discussion…………………………………………………………141 Bibliography…………………………………………………..……………………….147 5 List of Figures Chapter I Figure 1-1: Mutations in SMN1 result in SMA…………………………………..14 Figure 1-2: SMN forms a large macromolecular complex that interacts with Sm proteins………………………………………17 Figure 1-3: SMN protein domain structure………………………………………17 Figure 1-4: snRNP biogenesis overview…………………………………………21 Figure 1-5: The Cajal body functions in snRNP, snoRNP, and teRNP maturation and assembly………………………………..25 Figure 1-6: SMN is involved in several cellular functions………………………28 Chapter II Figure 2-1: SMN and Gemin protein levels are interdependent…………..……..39 Figure 2-2: SMN, Gemin2, Gemin3, and Gemin4 are required for efficient Sm core assembly…………………………………..….41 Figure 2-3: Loss of SMN and snurportin results in breakdown of nuclear Cajal bodies………………………………………………44 Figure 2-4: SMN and Gemins regulate Sm core assembly in vivo………………48 Figure 2-5: SMA patient-derived SMN mutations are defective in Sm core assembly……………………………………………..…52 Figure 2-6: Supplemental figure…………………………………………………54 Chapter III Figure 3-1: Drosophila Gemin3 is conserved throughout helicase motifs..…..…66 Figure 3-2: dGemin3 interacts with dSMN in vitro and in vivo…………………68 Figure 3-3: Drosophila SMN and Gemin3 are required for efficient snRNA Sm core assembly…………………………...…….70 Figure 3-4: Smn and Gemin3 mutant larvae exhibit viability and pupation defects………………………………………...………74 6 Figure 3-5: Smn and Gemin3 mutants exhibit growth defects……………..…….77 Figure 3-6: Smn and Gemin3 mutant larvae exhibit defects in motor function…………………………………………………….79 Figure 3-7: Smn and Gemin3 mutants exhibit neuronal pathfinding defects…………………………………………..………80 Figure 3-8: Smnex33, SmD2, and Gemin3 interact genetically……………...…….83 Chapter IV Figure 4-1: Models for SMN complex function in snRNP Sm core assembly……………………………………..……...……..94 Figure 4-2: Experimental analysis of tissue specificity in SMA………….……103 Figure 4-3: Models for tissue specific SMA pathogenesis………………..……107 Chapter AI Figure A1-1: Deletion of the coilin self-association domain affects epitope recognition………………………………….……116 Figure A1-2: Coilin mutants display unregulated nuclear body formation…………………………………………………...119 Figure A1-3: Coilins from different species display variation in nuclear body formation…………………………………….….122 Figure A1-4: Schematic of human and mouse coilin………………...…………123 Figure A1-5: Mutations in mouse coilin affect nuclear body formation……….127 Figure A1-6: Ectopically expressed SMN produces numerous SMN foci……..132 Chapter AII Figure A2-1: Gemin3 overexpression localizes SMN to the Golgi complex…..142 Figure A2-2: Golgi dissociation alters Gemin3 localization………………...…143 Figure A2-3: Gemin4 overexpression imports Gemin3 and SMN into the nucleus……………………………...………..……145 7 Acknowledgements I would like to take this opportunity to thank my research advisor, Greg Matera. Greg’s enthusiastic approach to research has left a very positive impression on me. There were times when I doubted whether I would ever be able to finish my project, but Greg was always convinced that the end was somewhere within reach. He has been a great mentor and I will always cherish our discussions about research, life, or football. I also would like to thank all members of the Matera Lab who have been instrumental in my training as well as helping me keep my sanity. Thank you to my thesis committee for their advise in the direction of my project. I would like to thank my parents, Jerold and Shirley, and sisters, Sara and Rebecca, for their unending support and inspiration to follow my dreams in life. Finally and perhaps most importantly, I would like to thank my wife, Tarah. She has put up with all the late worknights, weekend trips to the lab, and life with a graduate student stipend. Throughout the tumultuous graduate school life, she has been my smile at the end of the day and continued to give me confidence that this graduation day will come. And a special thanks to her for giving me my son Jack, a fantastic graduation gift! 8 List of abbreviations ATP Adenosine triphosphate CB Cajal body CBC Cap binding complex DAPI 4′,6-diamidino-2-phenylindole DTT Dithiothreitol EDTA Ethylenediaminetetraacetic acid Gem3 Gemin3 GFP Green fluorescent protein GST Glutathione S-transferase GTP Guanosine triphosphate His Histidine IP Immunoprecipitation IPTG Isopropyl-beta-D-Thiogalactopyranoside m7G 7-methylguanosine mRIPA Modified radioimmunoprecipitaion assay myc c-Myc epitope NLS Nuclear localization signal NP-40 Nonidet-40 NPC Nuclear pore complex PBS Phosphate buffered saline PCR Polymerase chain reaction PHAX Phosphorylated adaptor for snRNA export PRMT5 Protein arginine methyltransferase rRNA ribosomal RNA RNA Ribonucleic acid RNP Ribonucleoprotein SMA Spinal Muscular Atrophy SMN Survival of Motor Neurons scaRNP small Cajal body specific RNP snRNA small nuclear RNA snRNP small nuclear RNP snoRNP small nucleolar RNP SPN snurportin teRNP telomerase RNP Tgs1 trimethylguanosine synthase TMG 2,2,7-trimethylguanosine Unrip unr interacting protein WT Wildtype 9 Gemin function in small nuclear RNP biogenesis and Spinal Muscular Atrophy Abstract By KARL BRYAN SHPARGEL The heart of genetics research lies in gaining knowledge and understanding of the effects that gene alterations have on human health and development. Ultimately, a thorough analysis of genetic diseases spanning from mutation identification to protein function will hopefully lead to the development of therapeutic treatments. Spinal Muscular Atrophy (SMA) is one of the most prevalent and dire genetic diseases. Hallmarks of the disease include degeneration of spinal motor neurons and skeletal muscular atrophy. The disease is particularly crippling
Load more

Recommended publications
  • GEMIN8 Antibody (C-Term) Blocking Peptide Synthetic Peptide Catalog # Bp17974b
    10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 GEMIN8 Antibody (C-term) Blocking Peptide Synthetic peptide Catalog # BP17974b Specification GEMIN8 Antibody (C-term) Blocking GEMIN8 Antibody (C-term) Blocking Peptide - Peptide - Background Product Information The protein encoded by this gene is part of Primary Accession Q9NWZ8 the SMNcomplex, which is necessary for spliceosomal snRNP assembly in thecytoplasm and pre-mRNA splicing in the nucleus. The GEMIN8 Antibody (C-term) Blocking Peptide - Additional Information encoded proteinbinds to both SMN1 and the GEMIN6/GEMIN7 heterodimer, mediatingtheir interaction. This protein is found in nuclear Gene ID 54960 Gemini of Cajalbodies (gems) and in the cytoplasm. Three transcript variantsencoding Other Names the same protein have been found for this Gem-associated protein 8, Gemin-8, Protein gene. [providedby RefSeq]. FAM51A1, GEMIN8, FAM51A1 GEMIN8 Antibody (C-term) Blocking Format Peptides are lyophilized in a solid powder Peptide - References format. Peptides can be reconstituted in solution using the appropriate buffer as Carissimi, C., et al. J. Biol. Chem. needed. 281(48):37009-37016(2006)Carissimi, C., et al. J. Biol. Chem. 281(12):8126-8134(2006) Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C. Precautions This product is for research use only. Not for use in diagnostic or therapeutic procedures. GEMIN8 Antibody (C-term) Blocking Peptide - Protein Information Name GEMIN8 Synonyms FAM51A1 Function The SMN complex plays a catalyst role in the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome.
    [Show full text]
  • Not Dicer but Argonaute Is Required for a Microrna Production
    Cell Research (2010) 20:735-737. npg © 2010 IBCB, SIBS, CAS All rights reserved 1001-0602/10 $ 32.00 RESEARCH HIGHLIGHT www.nature.com/cr A new twist in the microRNA pathway: Not Dicer but Argonaute is required for a microRNA production Gabriel D Bossé1, Martin J Simard1 1Laval University Cancer Research Centre, Hôtel-Dieu de Québec (CHUQ), Quebec City, Québec G1R 2J6, Canada Cell Research (2010) 20:735-737. doi:10.1038/cr.2010.83; published online 15 June 2010 Found in all metazoans, microRNAs A Canonical pathway B Ago2-dependent pathway or miRNAs are small non-coding RNA Nucleus Cytoplasm Nucleus Cytoplasm of ~22 nucleotides in length that com- Exp.5 Exp.5 pletely reshaped our understanding of gene regulation. This new class of gene pre-miR-451 regulator is mostly transcribed by the pre-miRNA RNA polymerase II producing a long stem-loop structure, called primary- or Ago2 pri-miRNA, that will first be processed Ago2 Dicer in the cell nucleus by a multiprotein TRBP complex called microprocessor to gen- erate a shorter RNA structure called Ago2 RISC precursor- or pre-miRNA. The precisely Ago2 RISC processed pre-miRNA will next be ex- ported into the cytoplasm by Exportin 5 and loaded onto another processing machine containing the ribonuclease III enzyme Dicer, an Argonaute protein Ago2 Ago2 and other accessory cellular factors mRNA mRNA (Figure 1A; [1]). Dicer will mediate the Translation inhibition Translation inhibition cleavage of the pre-miRNA to form the mature miRNA that will then be bound Figure 1 (A) Canonical microRNA biogenesis. In mammals, the pre-miRNA is by the Argonaute protein to form, most loaded onto a multiprotein complex consisting minimally of Dicer, Tar RNA Bind- likely with other cellular factors, the ef- ing Protein (TRBP) and Ago2.
    [Show full text]
  • Role of Cajal Bodies and Nucleolus in the Maturation of the U1 Snrnp in Arabidopsis
    CORE Metadata, citation and similar papers at core.ac.uk Provided by PubMed Central Role of Cajal Bodies and Nucleolus in the Maturation of the U1 snRNP in Arabidopsis Zdravko J. Lorkovic´*, Andrea Barta Max F. Perutz Laboratories, Department of Medical Biochemistry, Medical University of Vienna, Vienna, Austria Abstract Background: The biogenesis of spliceosomal snRNPs takes place in both the cytoplasm where Sm core proteins are added and snRNAs are modified at the 59 and 39 termini and in the nucleus where snRNP-specific proteins associate. U1 snRNP consists of U1 snRNA, seven Sm proteins and three snRNP-specific proteins, U1-70K, U1A, and U1C. It has been shown previously that after import to the nucleus U2 and U4/U6 snRNP-specific proteins first appear in Cajal bodies (CB) and then in splicing speckles. In addition, in cells grown under normal conditions U2, U4, U5, and U6 snRNAs/snRNPs are abundant in CBs. Therefore, it has been proposed that the final assembly of these spliceosomal snRNPs takes place in this nuclear compartment. In contrast, U1 snRNA in both animal and plant cells has rarely been found in this nuclear compartment. Methodology/Principal Findings: Here, we analysed the subnuclear distribution of Arabidopsis U1 snRNP-specific proteins fused to GFP or mRFP in transiently transformed Arabidopsis protoplasts. Irrespective of the tag used, U1-70K was exclusively found in the nucleus, whereas U1A and U1C were equally distributed between the nucleus and the cytoplasm. In the nucleus all three proteins localised to CBs and nucleoli although to different extent. Interestingly, we also found that the appearance of the three proteins in nuclear speckles differ significantly.
    [Show full text]
  • Localization of Condensin Subunit XCAP-E in Interphase Nucleus, Nucleoid and Nuclear
    1 Localization of condensin subunit XCAP-E in interphase nucleus, nucleoid and nuclear matrix of XL2 cells. Elmira Timirbulatova, Igor Kireev, Vladimir Ju. Polyakov, and Rustem Uzbekov* Division of Electron Microscopy, A.N.Belozersky Institute of Physico-Chemical Biology, Moscow State University, 119899, Moscow, Russia. *Author for correspondence: telephone. 007-095-939-55-28; FAX 007-095-939-31-81 e-mail: [email protected] Key words: XCAP-E; nucleolus; condensin; nuclear matrix; Xenopus. Abbreviations: DAPI , 4’, 6 diamidino-2-phenylindole; DNP, deoxyribonucleoprotein; DRB, 5,6-dichloro-1b-d-ribofuranosylbenzimidazole; SMC, structural maintenance of chromosomes; XCAP-E, Xenopus chromosome associated protein E. 2 Abstract The Xenopus XCAP-E protein is a component of condensin complex In the present work we investigate its localization in interphase XL2 cells and nucleoids. We shown, that XCAP-E is localizes in granular and in dense fibrillar component of nucleolus and also in small karyoplasmic structures (termed “SMC bodies”). Extraction by 2M NaCl does not influence XCAP-E distribution in nucleolus and “SMC bodies”. DNAse I treatment of interphase cells permeabilized by Triton X-100 or nucleoids resulted in partial decrease of labeling intensity in the nucleus, whereas RNAse A treatment resulted in practically complete loss of labeling of nucleolus and “SMC bodies” labeling. In mitotic cells, however, 2M NaCl extraction results in an intense staining of the chromosome region although the labeling was visible along the whole length of sister chromatids, with a stronger staining in centromore region. The data are discussed in view of a hypothesis about participation of XCAP-E in processing of ribosomal RNA.
    [Show full text]
  • EIF2C2 Monoclonal Antibody (M01), Clone 2E12-1C9
    EIF2C2 monoclonal antibody (M01), clone 2E12-1C9 Catalog # : H00027161-M01 規格 : [ 100 ug ] List All Specification Application Image Product Mouse monoclonal antibody raised against a full length recombinant Western Blot (Cell lysate) Description: EIF2C2. Immunogen: EIF2C2 (AAH07633.1, 483 a.a. ~ 859 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: MPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAE VKRVGDTVLGMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLP enlarge QGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATV Western Blot (Transfected RVQQHRQEIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQV lysate) LHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIP AGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQI LTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTS GQSNGRDHQALAKAVQVHQDTLRTMYFA Host: Mouse enlarge Reactivity: Human Western Blot (Recombinant Isotype: IgG1 Kappa protein) Quality Control Antibody Reactive Against Recombinant Protein. Immunofluorescence Testing: enlarge Immunohistochemistry (Formalin/PFA-fixed paraffin- embedded sections) Western Blot detection against Immunogen (68.03 KDa) . Storage Buffer: In 1x PBS, pH 7.4 enlarge Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: Sandwich ELISA (Recombinant protein) MSDS: Download Interspecies Mouse (100); Rat (99) Antigen Sequence: enlarge Datasheet: Download ELISA Publication Reference RNAi Knockdown (Antibody validated) 1. TDP-43 aggregation induced by oxidative stress causes global mitochondrial imbalance
    [Show full text]
  • Mir-125 in Normal and Malignant Hematopoiesis
    Leukemia (2012) 26, 2011–2018 & 2012 Macmillan Publishers Limited All rights reserved 0887-6924/12 www.nature.com/leu SPOTLIGHT REVIEW MiR-125 in normal and malignant hematopoiesis L Shaham1,2, V Binder3,4,NGefen1,5, A Borkhardt3 and S Izraeli1,5 MiR-125 is a highly conserved microRNA throughout many different species from nematode to humans. In humans, there are three homologs (hsa-miR-125b-1, hsa-miR-125b-2 and hsa-miR-125a). Here we review a recent research on the role of miR-125 in normal and malignant hematopoietic cells. Its high expression in hematopoietic stem cells (HSCs) enhances self-renewal and survival. Its expression in specific subtypes of myeloid and lymphoid leukemias provides resistance to apoptosis and blocks further differentiation. A direct oncogenic role in the hematopoietic system has recently been demonstrated by several mouse models. Targets of miR-125b include key proteins regulating apoptosis, innate immunity, inflammation and hematopoietic differentiation. Leukemia (2012) 26, 2011–2018; doi:10.1038/leu.2012.90 Keywords: microRNA; hematopoiesis; hematological malignancies; acute myeloid leukemia; acute lymphoblastic leukemia MicroRNAs (miRNAs) are 21–23-nucleotide non-coding RNAs that nucleotides with the seed region of miR-125b (ebv-miR-BART21-5p, have crucial roles in fundamental biological processes by ebv-miR-BART8 and rlcv-miR-rL1-25). In humans, as in most of the regulating the levels of multiple proteins. They are transcribed genomes, there are two paralogs (hsa-miR-125b-1 on chromosome as primary miRNAs and processed in the nucleus by the RNase III 11 and hsa-miR-125b-2 on chromosome 21), coding for the same endonuclease DROSHA to liberate 70-nucleotide stem loops, the mature sequence.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Building the Interphase Nucleus: a Study on the Kinetics of 3D Chromosome Formation, Temporal Relation to Active Transcription, and the Role of Nuclear Rnas
    University of Massachusetts Medical School eScholarship@UMMS GSBS Dissertations and Theses Graduate School of Biomedical Sciences 2020-07-28 Building the Interphase Nucleus: A study on the kinetics of 3D chromosome formation, temporal relation to active transcription, and the role of nuclear RNAs Kristin N. Abramo University of Massachusetts Medical School Let us know how access to this document benefits ou.y Follow this and additional works at: https://escholarship.umassmed.edu/gsbs_diss Part of the Bioinformatics Commons, Cell Biology Commons, Computational Biology Commons, Genomics Commons, Laboratory and Basic Science Research Commons, Molecular Biology Commons, Molecular Genetics Commons, and the Systems Biology Commons Repository Citation Abramo KN. (2020). Building the Interphase Nucleus: A study on the kinetics of 3D chromosome formation, temporal relation to active transcription, and the role of nuclear RNAs. GSBS Dissertations and Theses. https://doi.org/10.13028/a9gd-gw44. Retrieved from https://escholarship.umassmed.edu/ gsbs_diss/1099 Creative Commons License This work is licensed under a Creative Commons Attribution-Noncommercial 4.0 License This material is brought to you by eScholarship@UMMS. It has been accepted for inclusion in GSBS Dissertations and Theses by an authorized administrator of eScholarship@UMMS. For more information, please contact [email protected]. BUILDING THE INTERPHASE NUCLEUS: A STUDY ON THE KINETICS OF 3D CHROMOSOME FORMATION, TEMPORAL RELATION TO ACTIVE TRANSCRIPTION, AND THE ROLE OF NUCLEAR RNAS A Dissertation Presented By KRISTIN N. ABRAMO Submitted to the Faculty of the University of Massachusetts Graduate School of Biomedical Sciences, Worcester in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSPOPHY July 28, 2020 Program in Systems Biology, Interdisciplinary Graduate Program BUILDING THE INTERPHASE NUCLEUS: A STUDY ON THE KINETICS OF 3D CHROMOSOME FORMATION, TEMPORAL RELATION TO ACTIVE TRANSCRIPTION, AND THE ROLE OF NUCLEAR RNAS A Dissertation Presented By KRISTIN N.
    [Show full text]
  • Nuclear Bodies Reorganize During Myogenesis in Vitro and Are
    Homma et al. Skeletal Muscle (2016) 6:42 DOI 10.1186/s13395-016-0113-7 RESEARCH Open Access Nuclear bodies reorganize during myogenesis in vitro and are differentially disrupted by expression of FSHD-associated DUX4 Sachiko Homma1, Mary Lou Beermann1, Bryant Yu1, Frederick M. Boyce2 and Jeffrey Boone Miller1,3* Abstract Background: Nuclear bodies, such as nucleoli, PML bodies, and SC35 speckles, are dynamic sub-nuclear structures that regulate multiple genetic and epigenetic processes. Additional regulation is provided by RNA/DNA handling proteins, notably TDP-43 and FUS, which have been linked to ALS pathology. Previous work showed that mouse cell line myotubes have fewer but larger nucleoli than myoblasts, and we had found that nuclear aggregation of TDP-43 in human myotubes was induced by expression of DUX4-FL, a transcription factor that is aberrantly expressed and causes pathology in facioscapulohumeral dystrophy (FSHD). However, questions remained about nuclear bodies in human myogenesis and in muscle disease. Methods: We examined nucleoli, PML bodies, SC35 speckles, TDP-43, and FUS in myoblasts and myotubes derived from healthy donors and from patients with FSHD, laminin-alpha-2-deficiency (MDC1A), and alpha-sarcoglycan- deficiency (LGMD2D). We further examined how these nuclear bodies and proteins were affected by DUX4-FL expression. Results: We found that nucleoli, PML bodies, and SC35 speckles reorganized during differentiation in vitro, with all three becoming less abundant in myotube vs. myoblast nuclei. In addition, though PML bodies did not change in size, both nucleoli and SC35 speckles were larger in myotube than myoblast nuclei. Similar patterns of nuclear body reorganization occurred in healthy control, MDC1A, and LGMD2D cultures, as well as in the large fraction of nuclei that did not show DUX4-FL expression in FSHD cultures.
    [Show full text]
  • Nuclear Domains
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Cold Spring Harbor Laboratory Institutional Repository CELL SCIENCE AT A GLANCE 2891 Nuclear domains dynamic structures and, in addition, nuclear pore complex has been shown to rapid protein exchange occurs between have a remarkable substructure, in which David L. Spector many of the domains and the a basket extends into the nucleoplasm. Cold Spring Harbor Laboratory, One Bungtown nucleoplasm (Misteli, 2001). An The peripheral nuclear lamina lies Road, Cold Spring Harbor, NY 11724, USA extensive effort is currently underway by inside the nuclear envelope and is (e-mail: [email protected]) numerous laboratories to determine the composed of lamins A/C and B and is biological function(s) associated with thought to play a role in regulating Journal of Cell Science 114, 2891-2893 (2001) © The Company of Biologists Ltd each domain. The accompanying poster nuclear envelope structure and presents an overview of commonly anchoring interphase chromatin at the The mammalian cell nucleus is a observed nuclear domains. nuclear periphery. Internal patches of membrane-bound organelle that contains lamin protein are also present in the the machinery essential for gene The nucleus is bounded by a nuclear nucleoplasm (Moir et al., 2000). The expression. Although early studies envelope, a double-membrane structure, cartoon depicts much of the nuclear suggested that little organization exists of which the outer membrane is envelope/peripheral lamina as within this compartment, more contiguous with the rough endoplasmic transparent, so that internal structures contemporary studies have identified an reticulum and is often studded with can be more easily observed.
    [Show full text]
  • Biogenesis of Nuclear Bodies
    Downloaded from http://cshperspectives.cshlp.org/ on September 30, 2021 - Published by Cold Spring Harbor Laboratory Press Biogenesis of Nuclear Bodies Miroslav Dundr1 and Tom Misteli2 1Department of Cell Biology, Rosalind Franklin University of Medicine and Science, North Chicago, Ilinois 60064 2National Cancer Institute, National Institutes of Health, Bethesda, Maryland 20892 Correspondence: [email protected]; [email protected] The nucleus is unique amongst cellular organelles in that it contains a myriad of discrete suborganelles. These nuclear bodies are morphologically and molecularly distinct entities, and they host specific nuclear processes. Although the mode of biogenesis appears to differ widely between individual nuclear bodies, several common design principles are emerging, particularly, the ability of nuclear bodies to form de novo, a role of RNA as a struc- tural element and self-organization as a mode of formation. The controlled biogenesis of nuclear bodies is essential for faithful maintenance of nuclear architecture during the cell cycle and is an important part of cellular responses to intra- and extracellular events. he mammalian cell nucleus contains a mul- seems to act indirectly by regulating the local Ttitude of discrete suborganelles, referred to concentration of its components in the nucleo- as nuclear bodies or nuclear compartments plasm. (reviewed in Dundr and Misteli 2001; Spector In many ways, nuclear bodies are similar 2001; Lamond and Spector 2003; Handwerger to conventional cellular organelles in the cy- and Gall 2006; Zhao et al. 2009). These bodies toplasm. Like cytoplasmic organelles, they con- are an essential part of the nuclear landscape tain a specific set of resident proteins, which as they compartmentalize the nuclear space defines each structure molecularly.
    [Show full text]
  • Module IV Nucleus
    Module IV Nucleus Structure and functions of interphase nucleus, Nuclear membrane, pore complex, structure and functions of nucleolus Chromosomes – Structure; Heterochromatin, Euchromatin, Nucleosomes, Nucleus is the most important part of the cell situated in the cytoplasm. All the cellular activities are controlled by it. Nucleus is a directing and organizing unit without which the cell could not exist. It was discovered by Robert Brown (1831) in flowering plants and is now recognized as the structure that contains the hereditary material of the cell. The study of nucleus or karyosome constitutes karyology. The location of nucleus varies in the cell depending upon the species. Usually it is situated in the centre of the cell surrounded on all sides by cytoplasm. In green algae, Acetabularia, it shows various positions, though mainly present in the basal part of cell. Generally the nuclei are scattered in the cytoplasm. Morphology: 1. Shape: The shape of nucleus is variable according to cell type. It is generally spheroid but ellipsoid or flattened nuclei may also occur in certain cells. The nuclear margins are generally smooth but they may be lobulated bearing small infoldings of nuclear membrane as in leucocytes. In certain white blood corpuscles the nucleus is dumbbell-shaped and exhibits variation during life history stages. In human neutrophil, it is trilobed. 2. Number: Mostly cell contains a single nucleus, known as mononucleate cell. Cells containing two nuclei are known as binucleate cells (e.g., Paramecium), and cells of cartilage and liver. Sometimes more than two nuclei (3 to 100 nuclei) are present in a single cell.
    [Show full text]