A1CF DNAxPab Symbol: A1CF

Gene Alias: ACF, ACF64, ACF65, APOBEC1CF, ASP, Catalog Number: H00029974-W01P MGC163391, RP11-564C4.2 Regulation Status: For research use only (RUO) Gene Summary: Mammalian mRNA Product Description: Rabbit polyclonal antibody raised undergoes site-specific C to U deamination, which is against a full-length human A1CF DNA using DNAx™ mediated by a multi-component enzyme complex Immune technology. containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene. The Immunogen: Full-length human DNA gene product has three non-identical RNA recognition motifs and belongs to the hnRNP R family of Sequence: RNA-binding . It has been proposed that this MEAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLL complementation factor functions as an RNA-binding EKENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLF subunit and docks APOBEC-1 to deaminate the EDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSN upstream cytidine. Studies suggest that the may KVEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFVGGI also be involved in other RNA editing or RNA processing PKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGF events. Alternative splicing occurs at this locus and three AFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEP full-length transcript variants, encoding three distinct EVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNIKP isoforms, have been described. Additional splicing has GAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDG been observed but the full-length nature of these SPIEVTLAKPVDKDSYVRYTRGTGGRGTMLQGEYTYS variants has not been determined. [provided by RefSeq] LGQVYDPTTTYLGAPVFYAPQTYAAIPSLHFPATKGHL SNRAIIRAPSVRGAAGVRGLGGRGYLAYTGLGRGYQV KGDKREDKLYDILPGMELTPMNPVTLKPQGIKLAPQIL EEICQKNNWGQPVYQLHSAIGQDQRQLFLYKITIPALA SQNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDG GDGTMATAAAAATAFPGYAVPNATAPVSAAQLKQAVT LGQDLAAYTTYEVYPTFAVTARGDGYGTF

Host: Rabbit

Reactivity: Human

Applications: Flow Cyt-Tr, IF-Ex, IF-Tr, WB-Tr (See our web site product page for detailed applications information)

Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols

Purification: Protein A

Storage Buffer: In 1x PBS, pH 7.4

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID: 29974

Page 1/1

Powered by TCPDF (www.tcpdf.org)