ARP36414 P050) Data Sheet

ARP36414 P050) Data Sheet

SNRNP200 antibody - N-terminal region (ARP36414_P050) Data Sheet Product Number ARP36414_P050 Product Name SNRNP200 antibody - N-terminal region (ARP36414_P050) Size 50ug Gene Symbol SNRNP200 Alias Symbols ASCC3L1; BRR2; FLJ11521; HELIC2; RP33; U5-200KD Nucleotide Accession# NM_014014 Protein Size (# AA) 2136 amino acids Molecular Weight 244kDa Product Format Lyophilized powder NCBI Gene Id 23020 Host Rabbit Clonality Polyclonal Official Gene Full Name Small nuclear ribonucleoprotein 200kDa (U5) This is a rabbit polyclonal antibody against SNRNP200. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: GDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMSSKKKDLHPR Pre-mRNA splicing is catalyzed by the spliceosome, a complex of specialized RNA and protein subunits that removes introns from a transcribed pre-mRNA segment. The spliceosome consists of small nuclear RNA proteins (snRNPs) U1, U2, U4, U5 and U6, together with approximately 80 conserved proteins. U5 snRNP Description of Target contains nine specific proteins. This gene encodes one of the U5 snRNP-specific proteins. This protein belongs to the DEXH-box family of putative RNA helicases. It is a core component of U4/U6-U5 snRNPs and appears to catalyze an ATP-dependent unwinding of U4/U6 RNA duplices. Mutations in this gene cause autosomal- dominant retinitis pigmentosa. Partner Proteins CHMP1B,MEGF10,SMNDC1,YWHAB,YWHAG,APC,CD2BP2,MCC,MEPCE,MYC,PIN1,PRKAB1,RNPS1,RN U11,RNU12-2P,SMNDC1,SNRNP40,SNRPB,SRRM1,TCEA1,USP39,YWHAG,tat Reconstitution and Add 50 ul of distilled water. Final anti-SNRNP200 antibody concentration is 1 mg/ml in PBS buffer with 2% Storage sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-SNRNP200 antibody is Catalog # AAP36414 Swissprot Id O75643 Protein Name U5 small nuclear ribonucleoprotein 200 kDa helicase Protein Accession # NP_054733 Purification Affinity Purified Species Reactivity Human, Bovine, Rat, Pig, Horse, Rabbit, Guinea pig, Mouse, Zebrafish Application WB Predicted Homology Based on Immunogen Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79% Sequence Human COLO205 WB Suggested Anti-SNRNP200 Antibody Titration: 1.0 ug/ml Positive Control: COLO205 Whole Cell Image 1 __________________________________________________________________________________________________________________________________________________________________ This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users..

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    2 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us