Anti-MED6 (full length) polyclonal antibody (DPABH-09976) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Immunogen Recombinant full length protein corresponding to Human MED6 aa 1-246.Sequence: MAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVV KMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQQRQSPAQVIPLADYYI IAGVIYQAPDLGSVINSRVLTAVHGIQSAFDEAMSYCRYHPSKGYWWHFK DHEEQDKVRPKAKRKEEPSSIFQ Isotype IgG Source/Host Mouse Species Reactivity Human Purification Protein A purified Conjugate Unconjugated Applications WB Format Liquid Size 50 μg Buffer pH: 7.20; Constituent: 100% PBS Preservative None Storage Shipped at 4°C. Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved GENE INFORMATION Gene Name MED6 mediator complex subunit 6 [ Homo sapiens ] Official Symbol MED6 Synonyms MED6; mediator complex subunit 6; mediator of RNA polymerase II transcription, subunit 6 homolog (S. cerevisiae); mediator of RNA polymerase II transcription subunit 6; NY REN 28; ARC33; hMed6; renal carcinoma antigen NY-REN-28; activator-recruited cofactor 33 kDa component; mediator of RNA polymerase II transcription, subunit 6 homolog; NY-REN-28; Entrez Gene ID 10001 Protein Refseq NP_005457 UniProt ID O75586 Chromosome Location 14q24.1 Pathway Developmental Biology; Fatty acid, triacylglycerol, and ketone body metabolism; Gene Expression; Generic Transcription Pathway; Metabolism; Metabolism of lipids and lipoproteins; PPARA Activates Gene Expression Function DNA binding; RNA polymerase II transcription cofactor activity; transcription coactivator activity; transcription factor binding; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-