Mouse anti-Human BST1 polyclonal antibody (DPAB-DC2996) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description Bone marrow stromal cell antigen-1 is a stromal cell line-derived glycosylphosphatidylinositol- anchored molecule that facilitates pre-B-cell growth. The deduced amino acid sequence exhibits 33% similarity with CD38. BST1 expression is enhanced in bone marrow stromal cell lines derived from patients with rheumatoid arthritis. The polyclonal B-cell abnormalities in rheumatoid arthritis may be, at least in part, attributed to BST1 overexpression in the stromal cell population. Immunogen BST1 (AAH12095.1, 1 a.a. ~ 318 a.a) full-length recombinant protein with GST tag. The sequence is MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRN KNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPL SDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVML NGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQ YSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL Source/Host Mouse Species Reactivity Human Conjugate Unconjugated Applications WB (Recombinant protein), ELISA, Size 50 μl Buffer 50 % glycerol Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION Gene Name BST1 bone marrow stromal cell antigen 1 [ Homo sapiens (human) ] Official Symbol BST1 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Synonyms BST1; bone marrow stromal cell antigen 1; CD157; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2; BST-1; cADPr hydrolase 2; NAD(+) nucleosidase; ADP-ribosyl cyclase 2; bone marrow stromal antigen 1; cyclic ADP-ribose hydrolase 2; Entrez Gene ID 683 Protein Refseq NP_004325 UniProt ID Q10588 Chromosome Location 4p15 Pathway Nicotinate and nicotinamide metabolism; Pancreatic secretion; Salivary secretion; Function NAD(P)+ nucleosidase activity; NAD+ nucleosidase activity; transferase activity; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.