
Aviva Systems Biology HNF4A Antibody - N-terminal region (ARP31946_P050) Product Number ARP31946_P050 Product Page http://www.avivasysbio.com/hnf4a-antibody-n-terminal-region-arp31946-p050.html Product Name HNF4A Antibody - N-terminal region (ARP31946_P050) Size 100 ul Gene Symbol HNF4A Alias Symbols HNF4, HNF4a7, HNF4a8, HNF4a9, HNF4alpha, MODY, MODY1, NR2A1, NR2A21, TCF, TCF14 Protein Size (# AA) 474 amino acids Molecular Weight 53kDa Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. NCBI Gene Id 3172 Host Rabbit Clonality Polyclonal Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml Official Gene Full Hepatocyte nuclear factor 4, alpha Name Description This is a rabbit polyclonal antibody against HNF4A. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire ([email protected]). Peptide Sequence Synthetic peptide located within the following region: MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNA Description of The protein encoded by this gene is a nuclear transcription factor which binds DNA as a Target homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms. Protein Interactions PIAS4; SUMO1; SUMO2; RNF4; SUB1; CREBBP; TBP; TAF9; TAF6; TADA2A; GTF2H1; GTF2B; ANP32B; MDM2; GPS2; PPARGC1A; HNF4A; NCOA6; SMAD4; SMAD3; PNRC2; COPS5; PNRC1; NR0B2; NRIP1; UBE2I; PROX1; NPPA; SREBF2; VDR; MAPK3; MAPK1; SIRT1; SREBF1; XPO1; SP1; HDAC3; T Reconstitution and For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in Storage small aliquots to prevent freeze-thaw cycles. Lead Time Domestic: within 1-2 days delivery International: 1-2 days *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges Blocking Peptide For anti-HNF4A (ARP31946_P050) antibody is Catalog # AAP31946 5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 1 Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human HNF4A Complete Anti-HNF4A (ARP31946_P050) computational species homology data Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HNF4A. Swissprot Id P41235 Protein Name Hepatocyte nuclear factor 4-alpha Publications Schmidt, D. et al. A CTCF-independent role for cohesin in tissue-specific transcription. Genome Res. 20, 578-88 (2010). ChIP-Seq, ChIP, Human, Pig, Dog, Sheep, Horse, Rabbit, Rat, Guinea pig, Mouse, Bovine, Zebrafish 20219941 Faure, A. J. et al. Cohesin regulates tissue-specific expression by stabilizing highly occupied cis-regulatory modules. Genome Res. 22, 2163-75 (2012). WB, Human, Pig, Dog, Sheep, Horse, Rabbit, Rat, Guinea pig, Mouse, Bovine, Zebrafish 22780989 Protein Accession NP_000448 # Purification Affinity Purified RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HNF4A. Nucleotide NM_000457 Accession # Replacement Item This antibody may replace item sc-101059 from Santa Cruz Biotechnology. Conjugation ARP31946_P050-FITC Conjugated Options ARP31946_P050-HRP Conjugated ARP31946_P050-Biotin Conjugated CB Replacement sc-101059; sc-126960; sc-35573; sc-35574; sc-374229; sc-6556; sc-6557; sc-8987 Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish Application WB Predicted Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: Homology Based 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93% on Immunogen Sequence Image 1: Human Lung Tumor Host: Rabbit Target Name: HNF4A Sample Tissue: Human Lung Tumor Antibody Dilution: 1.0ug/ml AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins. This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users. 5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 2.
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-