PDF (Supplementary Figures)

PDF (Supplementary Figures)

Supplementary Information Insights into an Efficient Light-driven Hybrid P450 BM3 Enzyme from Crystallographic, Spectroscopic and Biochemical Studies Jessica Spradlin,1 Diana Lee,1 Sruthi Mahadevan,1 Mavish Mahomed,2 Lawrence Tang,1 Quan Lam,1 Alexander Colbert,1 Oliver S. Shafaat,3 David Goodin,2 Marco Kloos,4 Mallory Kato,1 Lionel E. Cheruzel1* 1 San José State University, Department of Chemistry, One Washington Square, San José, CA 2 Department of Chemistry, One Shields Ave., University of California Davis, Davis, CA. 3 Division of Chemistry and Chemical Engineering, California Institute of Technology, Pasadena, CA. 4 Department of Biomolecular Mechanisms, Max Planck Institute for Medical Research, Heidelberg, Germany. Table of Contents: Figure S1. Graphical representations of C-H---pi interactions with P382..……………………………p.S-2 Figure S2. Transient absorption traces for the various hybrid enzymes …………….………………...p.S-3 Figure S3. UV vis spectra for the substrate-free, NPG bound and reduced hybrid enzymes..….……..p.S-4 Figure S4. Michaelis-Menten saturation curves with 16-pNCA substrate………….…………...……..p.S-4 Figure S5. Partial sequence alignment of 40 human cytochrome P450 heme domains….……...……..p.S-5 S-1 Fig. S1. Graphical representations of C-H---π interactions between the photosensitizer and the P382 residue preserved during the motion of the 310 helix by 2.1 Å in the two molecules present in the asymmetric unit of the DMSO bound structure. S-2 Fig. S2. Transient absorption traces for the dF393A-1, dF393W-1 and sL407C-1 hybrid enzymes and the corresponding difference spectra for the substrate free (SF) and substrate bound (SB) forms (bottom panels). S-3 Fig. S3. UV-vis spectra of the substrate free (SF), N-palmitoylglycine bound (NPG bound) and electrochemically reduced (Reduced) of the hybrid enzymes. Fig. S4. A) Michaelis-Menten saturation curves for the photocatalytic activity of the four hybrid enzymes (dF393A-1, dF393W-1, sL407C-1, dQ403W-1) as a function of the 16-pNCA concentration; B) Total turnover numbers as nmol of products per nmol of enzymes at the end of the reaction. S-4 CYP102A1 EEFRPERF--ENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLKH CYP3A4 EKFLPERFSKKNKDNIDPYTYTPFGSGPRNCIGMRFALMNMKLALIRVLQN CYP2C9 EMFDPHHFLDEGGNFKKSKYFMPFSAGKRICVGEALAGMELFLFLT CYP2C8 NIFDPGHFLDKNGNFKKSDYFMPFSAGKRICAGEGLARMELFLFLT CYP2E1 EKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQH CYP1A2 RPERFLTADGTAINKPLSEKMMLFGMGKRRCIGEVLAKWEIFLFLAILLQ CYP2A6 QDFNPQHFLNEKGQFKKSDAFVPFSIGKRNCFGEGLARMELF CYP2D6 FHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQH CYP2B6 DAFNPDHFLDANGALKKTEAFIPFSLGKRICLGEGIARAELFLF CYP2C19 EMFDPRHFLDEGGNFKKSNYFMPFSAGKRICVGEGLARMELFLFLT CYP3A5 EEFRPERFSKKKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQN CYP2J2 DTFNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTE CYP1A1 FLPERFLTPDGAIDKVLSEKVIIFGMGKRKCIGETIARWEVFLFLAILLQ CYP1B1 FDPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISI CYP4V2 EEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRH CYP17A1 FMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQ CYP46A1 FNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQ CYP4A11 EVFDPSRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTL CYP4F12 EVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLH CYP24A1 QFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLAL CYP5A1 TFNPERF-TAEARQQHRPFTYLPFGAGPRSCLGVRLGLLEVKLTL CYP4B1 EVFDSLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCL CYP4A22 LEVFDPSRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNQLKVARALTL CYP2S1 EEFNPDRFLDADGRFRKHEAFLPFSLGKRVCLGEGLAKAEVFLFFTTILQ CYP46A FNPYRFGPGAPKPRFTYFPFSLGHHSCIGQQFAQMEVKVVMAKLLQ CYP4X1 FDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLH CYP4Z1 FNPLRFSRENSEKIHPYAFIPFSAGLRNCIGQHFAIIECKVAVALTL CYP2W1 QFNPGHFLDANGHFVKREAFLPFSAGRRVCVGERLARTELFLLFAGLLQ CYP27A1 PHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQ CYP2AC1P DTFNPEHFLNSKEKFIKREAFLPFQWGRRMCAGESFARKELFLFFTSLLQ CYP3A7 EKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQN CYP4F23P FDPENLQKTSPL---AFIPFSAVPRNCIGQTFAMAEMKVVLALTL CYP11B1 ERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKH CYP51A DFNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLR CYP26C1 DPERFGAAREDSRGASSRLHYIPFGGGARSCLGQELA CYP2F1 QEFNPEHFLDANQSFKKSPAFMPFSAGRRLCLGELLARMELFLYLTAILQ CYP4F11 EVYDPFRFNQENIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALTLLH CYP11B2 PFGFGMRQCLGRRLAEAEMLLLLHHVLKH CYP4F3 VYDPFRFD-PKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTL CYP4F9P EVYDPFRFDPENSKERSPLAFIPFSAGSXNCIGQAFAMAEMKVVLALTL CYP2R1 EVFHPERFLDSSGYFAKKEALVPFSLGRRHCLGEHLARMEMFLFFTALLQ Fig. S5. Partial sequence alignment indicating that the highlighted Q403 residue of the P450 BM3 enzyme (three residues away from the ligating cysteine) is highly conserved among human cytochrome P450 heme domains. S-5 .

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    5 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us