Produktinformation

Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien

Weitere Information auf den folgenden Seiten! See the following pages for more information!

Lieferung & Zahlungsart

Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic PCGF5 monoclonal antibody (M01), clone 3C10

Catalog # : H00084333-M01 規格 : [ 100 ug ] List All

Specification Application Image

Product Mouse monoclonal antibody raised against a partial recombinant Western Blot (Transfected lysate) Description: PCGF5.

Immunogen: PCGF5 (NP_115749.2, 51 a.a. ~ 148 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence: NDCPRCGNQVHETNPLEMLRLDNTLEEIIFKLVPGLREQELERESEFWKK NKPQENGQDDTSKADKPKVDEEGDENEDDKDYHRSDPQIAICLDCLRN enlarge

Host: Mouse Western Blot (Recombinant protein) Reactivity: Human Immunofluorescence Isotype: IgG2a Kappa

Quality Control Antibody Reactive Against Recombinant Protein. Testing:

enlarge

Sandwich ELISA (Recombinant protein)

enlarge Western Blot detection against Immunogen (36.52 KDa) . ELISA Storage Buffer: In 1x PBS, pH 7.4

Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction:

MSDS: Download

Datasheet: Download

Applications

Western Blot (Transfected lysate)

Page 1 of 3 2020/7/14 Western Blot analysis of PCGF5 expression in transfected 293T cell line by PCGF5 monoclonal antibody (M01), clone 3C10.

Lane 1: PCGF5 transfected lysate(29.7 KDa). Lane 2: Non-transfected lysate. Protocol Download

Western Blot (Recombinant protein) Protocol Download

Immunofluorescence

enlarge this image Immunofluorescence of monoclonal antibody to PCGF5 on HeLa cell . [antibody concentration 10 ug/ml]

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged PCGF5 is 0.3 ng/ml as a capture antibody. Protocol Download

ELISA

Gene Information

Entrez GeneID: 84333

GeneBank NM_032373 Accession#:

Protein NP_115749.2 Accession#:

Gene Name: PCGF5 Page 2 of 3 2020/7/14 Gene Alias: MGC16202,RNF159

Gene polycomb group ring finger 5 Description:

Gene Ontology: Hyperlink

Other OTTHUMP00000020085,ring finger protein (C3HC4 type) 159 Designations:

Related Disease Alzheimer Disease Genetic Predisposition to Disease

Page 3 of 3 2020/7/14