VIBRATION ANALYSIS OF CRACKED ALUMINIUM PLATES

by Asif Israr

THESIS SUBMITTED IN FULFILLMENT OF THE REQUIRMENTS FOR THE DEGREE OF DOCTOR IN PHILOSOPHY TO THE FACULTY OF ENGINEERING DEPARTMENT OF MECHANICAL ENGINEERING UNIVERSITY OF GLASGOW

© A. Israr June 2008

All Rights Reserved. This work may not be reproduced in whole or in part, by photocopy or other means, without the permission of the author.

This thesis is produced under the accordance of British Standards BS 4821:1990

Dedication

Tomyparentsandmyfamily

ii Author’s Declaration

AUTHOR’S DECLARATION

Attention is drawn to the fact that copyright of this thesis rests with its author.Thiscopyofthethesishasbeensuppliedontheconditionthatanyone who consults itis understood to recognise thatits copyright rests with the authorandthatnoquotationfromthethesisandnoinformationderivedfrom itmaybepublished,withoutpriorwrittenconsentoftheauthor.

Thisthesismaynotbeconsulted,photocopiedorlentbyanylibrarywithout the permission of the author for a period of two years from the date of acceptanceofthethesis.

iii Abstract

ABSTRACT

Thisresearchisconcernedwithanalyticalmodellingoftheeffectsofcracks in structural plates and panels within aerospace systems such as aeroplane fuselage,wing,andtailplanestructures,and,assuch,ispartofalargerbody ofresearchintodamagedetectionmethodologiesinsuchsystems.Thisstudy is based on generating a socalled reduced order analytical model of the behaviour of the plate panel, within which a crack with some arbitrary characteristicsispresent,andwhichissubjectedtoathatcausesitto vibrate.Inpracticesuchascenarioispotentially extremely dangerous as it canleadtofailure,withobviousconsequences.Theequationthatisobtained isintheformoftheclassicalDuffingequation,inthiscase,thecoefficients within the equation contain information about the geometrical and mass properties of the plate, the loading and boundary conditions, and the geometry, location, and potentially the orientation of the crack. This equation has been known for just over a century and has in the last few decades received very considerable attention from both the analytical dynamics community and also from the dynamical systems researchers, in particulartheworkofUeda,Thompson,inthe1970sand1980s,andThomsen inthe1990sandbeyond.Anapproximateanalytical solution is obtained by meansoftheperturbationmethodofmultiplescales.Thispowerfulmethod was popularized in the 1970s by Ali H.Nayfeh, and discussed in his famous books,‘ PerturbationMethods ’(1974)and‘ NonlinearOscillations ’(1979,with D.T.Mook),andalsobyJ.Murdock(1990),andM.P.Cartmell etal .(2003)and has been shown to be immensely useful for a wide range of nonlinear vibrationproblems.Inthisworkitisshownthatdifferentboundaryconditions can be admitted for the plate and that the modal natural frequencies are sensitivetothecrackgeometry.Bifurcatorybehaviourofthe cracked plate hasthenbeenexaminednumerically,forarangeofparameters.Themodel has been tested against experimental work and against a Finite Element model,withgoodcorroborationfromboth.Inallevents,thisisasignificant newresultinthefieldandonethatifimplementedwithinalargerdamage detectionstrategy,couldbeofconsiderablepracticaluse.

iv Acknowledgements

ACKNOWLEDGEMENTS

I would like to express my gratitude to all those people who made this researchpossibleandthosewhohavemademyexperienceintheUniversity onethatIwillalwaysrememberfondly.

FirstandforemostIwishtothankmysupervisor, Matthew Phillip Cartmell , JamesWattProfessorofMechanicalEngineering.Hehasbeensupportivesince the days I began working on this research as a postgraduate. Ever since, Matthewhassupportedmenotonlybyprovidingaresearchassistantshipover almost one year, but also academically and emotionally through the rough roadtofinishthiswork.ThankstohimIhadtheopportunitytodevelopanew analytical model. His patience, stimulating suggestions and encouragement helpedmeinallthetimeofresearchforandwritingofthisthesis.Healso gavemethemoralsupportandthefreedomIneededtomoveon.

IwanttothanktheInstituteofSpaceTechnology,Pakistan,whoprovidedme withascholarshipfortwoyearsandtheGoudieBequestoftheUniversityof Glasgow,UKfortheironeyearassistantshipforthiscourseofstudy.Allthe relevant facilities such as computing facilities, and laboratories associated withDepartmentofMechanicalEngineering,UniversityofGlasgowaregreatly appreciatedandacknowledged.

A special acknowledgement goes to Mrs. Pat Duncan , Secretary Faculty of Engineering office, and Mrs. Avril MacGregor , International Student Adviser fortheirfullcooperationandmyofficemateofthreeyears: Mr. Lawrence Atepor . He was a good friend ever since we began to share an office in October2005.

Igreatlythankmylatefatherandmymother,brothersandsistersfortheir affectionatesupportandloveduringthiscourseofstudy.Lastbutnotleast,I wanttothankmywifeforallthesupportthatshegavemeduringtheyearsI have been working on this research, especially all the holidays that she arranged to give me time to write, to think and to talk to her about this

v Acknowledgements subject.Especially,Iwouldliketogivemyspecial thanks to my lovely son Muhammad Rafae who made me laugh during critical circumstances, and enabledmetocompletethiswork.Withoutthem,Iwouldnothavebeenable toachievewhatIhavetoday.

A.Israr April,2008

vi List of Figures

LIST OF FIGURES

Figure 3-1: Isotropic plate loaded by uniform pressure and a small crack at the centre...... 41

Figure 3-2: In-plane and a crack of length 2 a at the centre of the plate element ...... 45

Figure 3-3: Two sided constraints and plate having a part-through crack at the centre ...... 46

Figure 3-4: Line Spring Model (LSM) representing the and tensile stresses for a part-through crack of length 2 a, after Rice and Levy, 1972...... 48

Figure 3-5: Isotropic plate loaded by arbitrary located concentrated force and small crack at the centre, and parallel to the x-axis ...... 52

Figure 3-6: Plate first mode natural frequency of aspect ratio 0.5/1 as a function of half-crack length...... 61

Figure 3-7: Plate first mode natural frequency as a function of the thickness of the plate for the half-crack length of 0.01 m...... 62

Figure 4-1: Linear and nonlinear response curves for three different cases of boundary conditions and half-crack length of 0.01 m...... 73

Figure 4-2: Comparison between linear and nonlinear model of the cracked rectangular plate and the boundary condition CCFF...... 74

Figure 4-3: The amplitude of the response as a function of the detuning parameter, σmn [rad/s] and the point load at different locations [m] of the plate element ...... 74

Figure 4-4: Nonlinear overhang in the form of the softening spring characteristic by the use of NDSolve within Mathematica™ for an aspect ratio of 0.5/1, and initial conditions zero...... 76

Figure 4-5: Three modes of vibration for an aluminium plate without a crack ..80

Figure 4-6: Three modes of vibration for an aluminium plate of sides 0.5x1 m and a half-crack length of 0.01 m...... 80

vii List of Figures

Figure 4-7: Three modes of vibration for an aluminium plate of sides 0.5x1 m and a half-crack length of 0.025 m...... 80

Figure 5-1: Dynamics 2 program code for the cracked plate model and a boundary condition SSSS ...... 88

Figure 5-2: Explanation of Lyapunov exponent...... 89

Figure 5-3: Bifurcation diagrams for three different cases of boundary conditions and a half-crack length of 0.01 m for the normalised control parameter, ω...... 93

Figure 5-4: Bifurcation diagrams for three different cases of boundary conditions and a half-crack length of 0.025 m for the normalised control parameter, ω...... 93

Figure 5-5: Bifurcation diagrams for three different cases of boundary conditions and a half-crack length of 0.01 m for the normalised excitation acceleration in the x-direction ...... 97

Figure 5-6: Bifurcation diagrams for three different cases of boundary conditions and a half-crack length of 0.025 m for the normalised excitation acceleration in the x-direction ...... 98

Figure 5-7: Dynamical system analysis for a half-crack length of 0.01 m and the boundary condition SSSS ...... 102

Figure 5-8: Dynamical system analysis for a half-crack length of 0.01 m and the boundary condition CCSS...... 103

Figure 5-9: Dynamical system analysis for a half-crack length of 0.025 m and the boundary condition SSSS ...... 104

Figure 5-10 : Dynamical system analysis for a half-crack length of 0.025 m and the boundary condition CCSS...... 105

Figure 5-11 : Poincaré map for the three boundary condition cases and a half- crack length of 0.01 m from the use of specialised code written in Mathematica™...... 106

Figure 5-12 : Time plots, and phase planes for a half-crack length of 0.01 m by the use of specialised code written in Mathematica™ and the boundary condition SSSS...... 107

viii List of Figures

Figure 5-13 : Time plots, and phase planes for a half-crack length 0.01 m by the use of specialised code written in Mathematica™ and the boundary condition CCSS...... 108

Figure 5-14 : Time Plots, and phase planes for a half-crack length 0.01 m by the use of specialised code written in Mathematica™ and the boundary condition CCFF ...... 109

Figure 6-1: Simple layout of the experimental setup ...... 112

Figure 6-2: Aluminium plate with crack at the centre...... 113

Figure 6-3: Complete assembly of the test rig...... 114

Figure 6-4: First mode shape for an un-cracked aluminium plate of aspect ratio 0.5/1...... 116

Figure 6-5: First mode shape for cracked aluminium plate of crack length 50 mm, and aspect ratio of the plate 0.5/1...... 116

Figure 6-6: Amplitude responses (in terms of voltage signals) for first mode of an un-cracked (white mesh area) and cracked (coloured mesh area) aluminium plates of aspect ratio 0.5/1...... 117

Figure 7-1: Comparison between method of multiple scales and that of numerical integration...... 120

ix List of Tables

LIST OF TABLES

Table 3-1: Natural frequencies of the cracked plate model for different boundary conditions and aspect ratios ...... 60

Table 3-2: Relative changes of the natural frequencies of the cracked simply supported plate for the first mode only...... 63

Table 4-1: Peak amplitudes for three sets of boundary conditions and two sets of half-crack length for a plate aspect ratio of 0.5/1 ...... 75

Table 4-2: Finite element analysis results ...... 81

Table 5-1: Data used for dynamical system analysis for various cases of boundary conditions and half-crack lengths...... 87

Table 5-2: Dynamics 2 command values for plotting...... 91

Table 6-1: Experimental results of first mode of vibration for an un-cracked and cracked aluminium plates ...... 117

x Tables of Contents

TABLE OF CONTENTS

AUTHOR’S DECLARATION ...... iii

ABSTRACT ...... iv

ACKNOWLEDGEMENTS ...... v

LIST OF FIGURES ...... vii

LIST OF TABLES...... x

TABLE OF CONTENTS ...... xi

NOMENCLATURE ...... xiv

Chapter 1 ...... 1

INTRODUCTION ...... 1

1.1 Motivation ...... 1

1.2 Overview ...... 2

1.3 Research Objectives...... 4

1.4 Outline and Methodology ...... 5

Chapter 2 ...... 7

LITERATURE REVIEW ...... 7

2.1 Historical Background...... 7

2.2 Nonlinear Theory ...... 10

2.3 Damage in Plate Structures...... 13

2.4 Finite Element Approach in Cracked Plate Structures ...... 21

2.5 Damage Detection Methodologies in Plate Structures ...... 23

2.6 Damaged Plates of Various Sizes and Shapes...... 26

2.7 Solution Methodologies...... 27

2.7.1 Perturbation Theory...... 31

2.7.2 The Method of Multiple Scales ...... 33

2.8 Dynamical Systems and Nonlinear Transitions to Chaos ...... 36

xi Table of Contents

Chapter 3 ...... 39

FORMULATION OF CRACKED PLATES...... 39

3.1 Governing Equation of Cracked Rectangular Plate ...... 39

3.2 Addition of In-plane or Membrane Forces ...... 44

3.3 Crack Terms Formulation...... 47

3.4 Galerkin’s Method for a Vibrating Cracked Plate ...... 51

3.5 Linear Viscous Damping ...... 58

3.6 Investigation of Natural Frequencies for Cracked Plate Model..... 59

Chapter 4 ...... 64

APPROXIMATE ANALYTICAL TECHNIQUES ...... 64

4.1 The Method of Multiple Scales...... 65

4.2 Analytical Results ...... 72

4.2.1 Linear and Nonlinear Response Curves...... 72

4.2.2 Comparison of Linear and Nonlinear Cracked Plate Model...... 73

4.2.3 Nonlinearity affects by changing the location of the Point Load...... 74

4.2.4 Damping Coefficient influences Nonlinearity ...... 75

4.2.5 Peak Amplitude ...... 75

4.3 Direct Integration – NDSolve within Mathematica™ ...... 75

4.4 Finite Element (FE) Technique – ABAQUS/CAE 6.7-1...... 76

4.4.1 Steps Taken to Perform FE Analysis...... 77

4.4.2 ABAQUS/CAE Results...... 79

Chapter 5 ...... 82

DYNAMICAL SYSTEM ANALYSIS...... 82

5.1 Dynamical System Theory...... 83

5.2 A Model of the Cracked Plate for Dynamical System Analysis..... 85

5.2.1 Nondimensionalisation ...... 85

5.3 Dynamics 2 - A Tool for Bifurcation Analysis...... 87

5.3.1 Bifurcation Analysis...... 89

xii Table of Contents

5.3.2 Lyapunov Exponents...... 89

5.3.3 Amplitude of response, x, as a function of normalised excitation frequency, ω and the Lyapunov exponent...... 91

5.3.4 Amplitude of response, x, as a function of normalised excitation acceleration and the Lyapunov exponent...... 94

5.3.5 Time plots, Phase planes, and Poincaré maps ...... 99

5.4 Specialised Numerical Calculation Code written in Mathematica™ ..…...... 106

Chapter 6 ...... 111

EXPERIMENTAL INVESTIGATIONS...... 111

6.1 Instrumentation ...... 111

6.2 Machining Procedure of the Crack in the Aluminium Plate...... 112

6.3 Test Setup...... 113

6.4 Experimental Results...... 115

Chapter 7 ...... 118

RESULTS AND DISCUSSION ...... 118

7.1 Analytical Results ...... 118

7.2 Numerical Results...... 121

7.3 Experimental Results...... 123

7.4 Conclusions...... 124

Chapter 8 ...... 125

CONCLUSIONS AND FUTURE RECOMMENDATIONS...... 125

8.1 Summary...... 125

8.2 Future Recommendations ...... 128

LIST OF REFERENCES...... 129

PUBLICATIONS ...... 150

LIST OF FIGURES IN APPENDICES ...... A-1

CONTENT OF APPENDICES ...... A-2

xiii Nomenclature

NOMENCLATURE

Symbols Description Units

D Flexuralrigidity Nm

E Modulusof Kgm2

υ Poisson’sratio w Transversedeflection m

InplaneorMembraneforcesperunitlength Nm1 nx , ny , nxy , nrs h Thicknessoftheplate m

forcesperunitlengthactingontheplate Nm1 Qx , Qy element

Loadperunitarea Nm2 Pz

Pointload N Pz

Bendingmomentsperunitlength Nmm1 Mx , My , Mxy ,Mrs

σ σ τ Bendingandshearstresses Nm2 x , y , xy

Bendingmomentduetocrackperunit Nmm1 My length

Inplaneforceduetocrackperunitlength Nm1 ny

σ Nominaltensileandbendingstressesatthe Nm2 rs and mrs

xiv Nomenclature

cracklocation

σ Nominaltensileandbendingstressesatthe Nm2 rs and mrs farsidesoftheplate a Halfcracklength m

α o α o αo= α o Nondimensionalbending,stretchingand bb , tt , bt tb stretchingbendingcompliancecoefficients

Characteristicormodalfunctionsofthe m Xm , Yn crackedplate

Arbitraryamplitude m Amn

ψ Timedependentmodalcoordinate m mn (t )

Lengthsofthesidesoftheplate m l1 , l2

λ γ Modeshapeconstants m, n , m, n m,n Modenumbers

ε ε Middlesurfacestrains x , y

Complexinplaneforcefunctions m4 F1mn , F2 mn

Complexmodalcomponent1 s2 Mmn

Complexmodalcomponent2 Kmn

Complexmodalcomponent3 m2 Gmn

Complexmodalcomponent4 m Pmn

xv Nomenclature

ω Naturalfrequencyofthecrackedplate rads1 mn

β Nonlinearcubicspringstiffness m2s2 mn ,C 3

HarmonicorperiodicLoad N Po ( t )

1 µ ,C 1 Dampingcoefficient Nsm

Ω Excitationfrequency rads1 mn

ε Perturbationparameterforthemethodof multiplescales

= ε n n=0:fasttimescales;n=1:slowtimescale s Tn t

εσ Detuningparameter rads1 mn b Realamplitude m

α Phaseangle radians

bp Peakamplitude m

λ Lyapunovexponent

CCFF Clampedclampedfreefree

CCSS Clampedclampedsimplysupportedsimplysupported

SSSS Allsidessimplysupported

FEM Finiteelementmethod

xvi Nomenclature

LSM Linespringmodel

BIFD No.ofiteratesforeachbifurcationparameter

BIFPI Preiteratesforeachbifurcationparameter

BIFV No.ofparametervaluesinbifurcationdiagram

CON Connectconsecutivedotsoftrajectories

IPP No.ofiteratesperplots

xvii Chapter 1: Introduction

Chapter 1

INTRODUCTION

______

1.1 Motivation

Nonlinearityinplatestructureshasbeenofgeneralinteresttothescientific andengineeringcommunitiesformanyyears.Thesestructureshavemultitude ofapplicationsinalmosteveryindustry.Theaircraftindustryhasshownmuch interestinthis,someoftheearlysolutionsweremotivatedbythisindustry [Trendafilova, 2005]. In electrical engineering, nonlinear behaviour is quite evidentinMicroElectroMechanicalSystems(MEMS)[Wei etal.,2005].Incivil engineering, this is also of interest and was illustrated in regard to the behaviour of window glass plating [Wang, 1948]. The current application whichisbeingworkedonatUniversityofGlasgowistopredictthenonlinear behaviourofparametricallyexcitedbeams,rotordynamics, and exchange tethers for space vehicle propulsion. Therefore, studying the dynamicresponse,boththeoreticallyandexperimentally,ofplatestructures with minor cracks under various loading conditions would help in understandingandexplainingthebehaviourofmorecomplex,realstructures undersimilarloading.

In this research, an approximate analytical model of a cracked plate is developed, and a study, both theoretically and experimentally of the nonlinear vibrations of a plate with a crack at the centre consisting of continuous line under transverse harmonic excitations with three sets of boundary conditions has been undertaken. In addition, the bifurcatory behaviourwithinthissystemhasbeeninvestigatedforanonlineartransition to chaos through the use of available software such as Dynamics 2 and by meansofcodewrittenin Mathematica™ .Therefore,theeventualgoalisto

1 Chapter 1: Introduction providean understanding of vibrationand dynamic system analysis of plate structuresassociatedwithacentrallylocatedcrack.

1.2 Overview

Plateandbeamstructuresarefundamentalelementsinengineeringandare used in a variety of structural applications. Structures like aircraft wings, satellites, ships, steel bridges, sea platforms, helicopter rotor blades, spacecraft antennae, and subsystems of more complex structures can be modelledasisotropicplateelements.Inthisdissertation,onlyaircraftwing structuresmodelledasanisotropicplatearediscussed.Theplatepanelson thetipsofaircraftwingsaremainlyundertransversepressure,andareoften subjectedtonormalandshearforceswhichactintheplaneoftheplate.The platepanelsmaynotbehaveasintendediftheycontainevenasmallcrack, orformofdamage,andsuchsmalldisturbancescancreateacompletelossof equilibriumandcausefailure.

Interesting physical phenomena occur in structures in the presence of nonlinearitieswhichcannotbeexplainedbylinearmodels.Thesephenomena include jumps, saturation, subharmonic, superharmonic, and combination resonances, selfexcited oscillations, modal interactions, periodic doubling, and chaos. These various phenomena have been discussed in most of the literaturetodate.Inreality,nophysicalsystem isstrictlylinearandhence linearmodelsofphysicalsystemshavelimitations of their own. In general, linear models are applicable only ina very restrictive domain suchas when the vibration amplitude is very small. Thus, to accurately identify and understand the dynamic behaviour of a structural system under general loadingconditions,itisessentialthatnonlinearitiespresentinthesystemalso be modelled and studied. Nayfeh and Mook (1979), Moon (1987), Cartmell (1990),Strogatz(1994),Thomsen(1997),Sathyamoorthy(1998)andMurdock (1999)explainvarioustypesofnonlinearitiesindetail,alongwithexamples. Here,someofthesenonlinearitiesarebrieflydescribedwhichcanbebroadly classified into two main categories i.e. geometric nonlinearity and material nonlinearity. The accurate representation of displacement may involve geometric nonlinearity. Geometricnonlinear problems may arise because of

2 Chapter 1: Introduction two reasons (a) the nonlinear strain–displacement relationship; (b) the nonlinearityinthegoverningdifferentialequationduetothecouplingofin plane and transverse displacement fields. As the deflection of the plate increases,thestretchingeffectbecomesmorepronouncedthanthebending effect,particularlywhentheedgesoftheplatearerestrained.Thesetypesof problems are also referred to as large deflection problems which result in nonlinear equations. There is another class of problem, where the strainrelationshipofthematerialofthestructureisnotlinear.Inthecaseof steel,linearityoccursuptotheyieldpoint,butbeyondthatitdeviatesfrom lineartononlinear.Thereforeitinvolvesnonlinearmaterialbehaviour.Many other types of nonlinearities exist in structures such as inertia, impacts, backlash,boundaryconditions,fluideffectsanddamping.

Plate structures undergoing transverse deflection can be classified into numerousregimesthatdescribethenatureoftheir behaviour and thus the characteristicsofthemathematicalproblem.Thisbehaviourcangenerallybe classified in the literature by carefully observation of the amount of deflectionincomparisontotheplatedimensions.Theseregimesinclude(a) small deflection theory (Linear) whichcan typically be used for deflections less than twenty percent of the thickness, (b) moderately large deflection theory(Nonlinear)isappliedwhenthedeflectionis a multiple of the plate thickness but much less than the plate side length, (c) and very large deflection theory (Highly Nonlinear) is applied when the deflection of the plate is similar in magnitude to the plate side length. These large deformations occur in structures subjected to shock loads, and can not be adequatelyanalysedbylineartheorysincethedeflectionofthepanelsdoes notremainsmallincomparisonwiththethickness. Depending on the plate classificationthesolutiontotheseproblemscanberelativelysimpleorhighly complex, and typically impossible without the implementation of approximating techniques. In this literature review, discussion will only be made of linear and moderately nonlinear systems, very large deflection is currently not pertinent to this work and subsequently will not be covered. Interestingly,themajorityofphysicalsystemsappeartobelongtotheclassof weakly nonlinear or quasilinear systems. For certain phenomena, these systems exhibit behaviour only slightly different from that of their linear

3 Chapter 1: Introduction counterpart.Inaddition,theycanalsoexhibitphenomenawhichdonotexist in the linear domain. Therefore, for weakly nonlinear structures, the usual startingpointisstilltheidentificationofthelinearnaturalfrequenciesand modeshapes.Then,intheanalysis,thedynamicresponseisusuallydescribed in terms of the linear natural frequencies and mode shapes. The effect of small nonlinearities is seen in the equations governing the amplitude and phaseofthestructure’sresponse.Weaknonlinearitycanbeseenforexample in wave drift forces, whereby waves generate steady forces on floating bodies.Wavedriftforcesaretypicallyproportionaltothesquareofthewave height,andcanbeanalysedwithaperturbationscheme.Whereas,strongor highlynonlinearsystemscannotbeanalysedwithaperturbationscheme.

At the turn of the 20th century, Henri Poincare made one of the first predictionsoftheexistenceofchaos,ofwhatisprosaically now called the butterfly effect. These chaotic or nonlinear systems exhibit surprising and complexeffectsthatwouldneverbeanticipatedbysomeonetrainedonlyin linear techniques. Nonlinearity has its most profound effects on dynamical systemsandcanbefoundinmuchoftheliterature.

1.3 Research Objectives

This research proposes a new analytical model for the nonlinear vibration analysisofanaircraftpanelstructuremodelledasanisotropiccrackedplate and based on classical plate theory with different possible boundary conditions including clamped – clamped – free – free (CCFF), clamped – clamped simply supported – simply supported (CCSS), and all sides simply supported(SSSS),andsubjectedtotransverseharmonicexcitation.Acrackis arbitrarilylocatedatthecentreoftheplate,consistingofacontinuousline. Thismodelisdevelopedbyassumingthattheeffects of rotary inertial and through thickness stresses are negligible. The emphasis, however, is to developanapproximateanalyticalmodelofthecrackedplate,whichisinthe formofsingledegreeoffreedomsystem.Secondly,anapproximatesolution technique is proposed by use of the method of multiple scales, and in addition, direct integration and finite element analysis in ABAQUS are also employedforcomparison.Thismodelcanalsobestudied for the nonlinear

4 Chapter 1: Introduction vibration analysis of the plate without the application of the transverse harmonicexcitation.Thirdly,dynamicalsystemsanalysisisperformedbythe use of commercially available software Dynamics 2 and Mathematica™ and generatesinterestinglycomplexphenomenafromthenonlineartransitionsto chaos.Finallytheresultsareverifiedviaexperimentalinvestigationsfollowed byusefulresultsandconclusions.

1.4 Outline and Methodology

InChapter2anextensiveliteraturereviewispresentedthatisrelatedtothe presentwork.

Theequationsofmotiongoverningthenonlinearvibrationsofisotropicplates arederivedwithpossibleboundaryconditions,usingtheequilibriumprinciple basedonclassicalplatetheory,inChapter3.Anarbitrary located crack at thecentreoftheplateisdefinedbyacontinuousline.Assumptionsusedin this derivation are also elaborated. The derived equations are used in the theoreticalanalysiswhichisexplainedinsubsequentchapters.Furthermore, thegoverningpartialdifferentialequationisconvertedintothetimedomain by defining the characteristic or modal functions depending upon the boundaryconditions,usingGalerkin’smethod 1.

InChapter4,anapproximateanalyticalsolutionisproposedviathemethodof multiple scales for the governing differential equation of the cracked plate subjectedtotransverseloading,forstudyingtheeffectofnonlinearitycaused bythecrackwithinplatestructures.Similarly,solutionoftheproblemisalso obtainedbydirectintegrationandfiniteelementanalysisinABAQUS.

InChapter5,thebifurcatorybehaviouroftheproposedcrackedplatemodel isdiscussedtoanalysethenonlineartransitiontochaosthroughtheuseof

1Galerkin’smethodisusedtoreducethesetof partial differential equations to a set of ordinarydifferentialequations,andthenitispossibletostudylinear,nonlinear,andchaotic behaviourofthesystem.Itusestheshapeorcharacteristicfunctionswhichdependuponthe boundaryconditionofthesystem.Galerkin’smethodcanbedividedintotwomaincategories such as PetrovGalerkin method and RitzGalerkin method. In the RitzGalerkin method the solutionisexpendedintermsofaserieswithunknowncoefficientswhichdependontimeand satisfy the given boundary conditions. In the PetrovGalerkin method the residual be orthogonal to each of the expansion functions, one may define a different set of test functionsandrequiretheresidualtobeorthogonaltoeachofthesetestfunctions.

5 Chapter 1: Introduction

Dynamics2 and Mathematica™ .Inthischapter,webrieflyintroducethechaos andsomeimportantpropertiesofchaoticsystemsincludingtimeplots,phase planes,Poincarémaps,bifurcationdiagrams,andtheLyapunovexponent.

An experimental study of the response of rectangular, aluminium CCFF crackedanduncrackedplatestotransverseharmonicexcitationsispresented inChapter6.

InChapter7,resultsanddiscussionsarepresentedandshowthatamodelof thecrackedplatewithdifferentboundaryconditionscanexhibitamultitude of nonlinear dynamical phenomena, followed by conclusions and future recommendationsinChapter8.

6 Chapter 2: Literature Review

Chapter 2

LITERATURE REVIEW

______

To cover some general historical background, we begin with a discussion of linearhomogenousbeamsandplates.Thisisfollowedbynonlinearaspectsof plates,briefcoverageofdamageinplatestructures,solutionmethodologies, andfinallyanintroductiontononlineartransitionstochaos.

2.1 Historical Background

Platetheory,anditsbehaviourinthedynamicand staticdomainshasbeen appliedtoreducevibrationandnoiseinstructuressincetheendofthe19th centurywhereitbeganwiththeworkofGermanphysicistChladni(1827)who discovered various modes of free vibrations experimentally [Szilard, 2004]. Sincethenithasdevelopedintoanescalatingandexpansivefieldwithawide variety of theoretical and empirical techniques, dealing with increasingly complicatedproblems.Thefirstmathematicalsolutionstothefreevibration problemofthemembranetheoryofplateswereformulatedbyEulerin1766 and his student Bernoulli in 1789. Lagrange developed the first correct governingequationforthefreevibrationofplatesin1813[Szilard,2004].The plate problem has progressed through history to the present, where it is commonly analyzed using the finite element method and other rigorously applied computational methods that are capable of accommodating many differentgeometriesandrangesofparameters.Naviercanbecreditedwith developing the first correct differential equation of plates subjected to distributedstaticlateralloadsin1836followedbyKirchhoffwhoderivedthe samedifferentialequationthroughtheuseofadifferentenergyapproachin 1887.Thefirstcorrectstatementofthedifferentialequationgoverningplate vibrations is attributed by Rayleigh to Sophie German in the early 19th century. In 1877, Rayleigh published the first edition of his famous book

7 Chapter 2: Literature Review

Theory of Sound and the second edition appeared in 1945, in which he proposedseminalmethodsfordeterminingnaturalfrequenciesofvibration.

Tomoticapresentedworkonthevibrationsofsquareplatesin1936.In1950, Young adopted the Ritz method to approximate the first six natural frequenciesforclampedsquareplates,andin1954,Warburtonproposedthe first comprehensive collection of solutions for rectangular plates. He used Rayleigh’smethodtoobtaintheapproximatefrequencyexpressionsforplates with a series of different boundary conditions. In addition to that a useful discussion on the mode shapes of rectangular plates, and the method for obtaining the mode shapes, were also a part of this paper. The frequency equationwasnotfullyexploreduntilsevenyearslaterbyMindlinin1960.To extendtherangeofapplicabilityofclassicaltheoriestohigherfrequencies, refineddynamictheoriesofbeamsandplateswereintroducedbyTimoshenko in 1921, and by Mindlin in 1951, respectively, and included the effects of transverse shear and rotary inertia. Mindlin not only generalised the Timoshenkobeamtheorytotheplate,butalsocomparedandcoordinatedthe resultsofhisplatetheorywiththosederivedbyLordRayleighfromelasticity theory.Thiswasoneofthefirstattemptstoestablishaconnectionbetween the exact dynamic elasticity theory and an approximate plate theory, by means of which the shear factor introduced in Mindlin’s theory could be determined.

Small deflection vibrations in plates have been widely studied due to the relative ease of obtaining solutions in these cases. Therefore a variety of literatureisavailableconcerningsuchlinearvibrationproblems.Amonograph onthevibrationofplateswaspublishedbyLeissain1969,reprintedin1993; inwhichhereviewedthecontemporaryliteratureonplatevibrations.Later, in 1973, this author presented a review paper on free vibrations of rectangular plates, and comparisons were made with Warburton’s useful approximate formulas of 1954. One of the classical references for plate problemsis TheoryofPlatesandShells byTimoshenko,1940,whichprovides anexpansiveamountofinformationonplatesandderivativesystems.Szilard, in2004,alsoprovidesanexcellentoverviewofthelinearplateproblemwith anemphasisonfinitedifferencetechniques.LauraandDuran,in1975,used thesimplepolynomialapproximationandGalerkin’smethodtodeterminethe

8 Chapter 2: Literature Review responseofaclampedplatesubjectedtoaharmonicexcitation.Theresults werepresentedintermsofamplitudesandbendingmomentsasafunctionof therelativefrequency(ratioofthefrequencies)fordifferentaspectratiosfor simply supported and clamped rectangular plates. For simply supported rectangularplatestheagreementoftheapproximatesolutionwiththeexact solutionfortherelativefrequencyof0.30andaspectratiosof1and2,were quite reasonable, while for clamped rectangular plates the results were in good agreement for a zero relative frequency. Jones and Milne applied an extended Kantorovich method in 1976, as proposed by Kerr in 1968 for the evaluationoftheeigenfrequenciesofvibrationofclampedrectangularplates in detail, and this was also applied for the cases of clamped – clamped – simplysupportedsimplysupported(CCSS)andclamped–clamped–clamped simply supported (CCCS) sets of boundary conditions. The results were comparedwiththoseofLeissafrom1973, andavery close agreement was found. Bhat investigated the vibration problem of rectangular plates with different boundary conditions in 1985 by using a set of characteristic orthogonal polynomials in the RayleighRitz method. The result when comparedwiththepublishedliteratureyieldedgoodagreementforthelower modesonly.Somedevelopmentsinthefiniteelementmethodhavebeenled byHanandPetyt etal. in1996(a)leadingtoanewapproachnowknownas the hierarchical finite element method (HFEM) for the study of linear vibrations of symmetrically laminated rectangular plates with clamped boundaryconditions.Theresultsshowedthatthesolutionsconvergedrapidly withtheincreaseinthenumberofpolynomialsused, which resulted in far fewer degree of freedom than those when used the conventional finite element method. These authors further investigated the same problem in 1996(b), however at this time they considered the analysis of forced vibration. The loads considered were harmonic acoustic plane waves impingingontheplatesurfaceinanormaldirectionandatgrazingincidence. These authors obtained the natural frequencies of five layer symmetrically laminated rectangular plates for different grazing incidents and found a decreasing trend of frequencies withthe increase ofincident. Furthermore, theyfoundthatthemaximumsurfacebendingstrainsmightnotoccuratthe middleoftheedgesduetothedistortedmodeshapes.

9 Chapter 2: Literature Review

Fan, in 2001, analyzed the transient vibration and sound radiation of a rectangularplatewithviscoelasticboundarysupportssubjectedtoanimpact loadingandobtainedthesoundradiationpressureinthetimeandfrequency domainbymeansoftheRayleighintegral.AuandWang,in2005,studiedthe dynamicresponsesintermsofsoundradiationfromtheforcedvibrationofan orthotropicplatewiththeeffectsofmovingmass,dampingcoefficient,and boundary conditions. Yagiz and Sakman, in 2006, observed the dynamic response of a bridge modelled as an isotropic plate under the effect of a movingloadwithallsidessimplysupported.Theyconsideredavehiclewith sevendegreesoffreedomsystemasthemovingload.Amathematicalmodel wasobtainedbytheuseofLagrange’sformulation, and used to investigate thedynamicresponseofthebridgeandvehicle.

2.2 Nonlinear Deflection Theory

Many formulations for nonlinear deflection theory have been proposed and testedtogiveaclosedformsolutiontotheproblem.Higherdeflections,of the order of approximately a tenth the thickness of the plate, can cause stiffening of the structure that cannot be predicted by linear theory. The creditforuncoveringthenonlineartheorythatsatisfactorilyaccountsforboth bendingandstretchingoftheplateisgiventoG.Kirchhoff(1824–1887).The final form of the nonlinear differential equations governing the moderately largedeflectionbehaviourofastaticallydeflectedplatewaspublishedbyVon Karmanin1910.Areviewconcerningthenonlinearvibrationanalysisofplates and shells was presented by Leissa in 1984, followed by Sathyamoorthy in 1988,andwhosummarisedworkonnonlinearvibrationsofplatesfrom1983 to 1986, including 99 published references. The nonlinear analysis of plates has led to the production of famous reference books such as Nonlinear Analysis of Plates by Chia, 1980, and Nonlinear Oscillations by Nayfeh and Mookin1979.

Oneofthefirststudiesdealingwiththeproblemofnonlinearplatevibrations was due to Chu and Hermann in 1956. They obtained a solution for the nonlinearfreevibrationsofrectangularelasticplates with fixed and hinged edges through the use of a perturbation method and the principle of

10 Chapter 2: Literature Review conservationofenergy.Later,in1961,YamakiusedaGalerkinapproachto obtainthesolutionsforrectangularplatessimplysupportedonalledgesand clampedonalledges.Berger,in1955,derivedasimplifiedsetofequations describing the large deflection of plates. He solved several static problems andconcludedthathissimplifiedtheorygaveresultsinsubstantialagreement with more elaborate methods. Wah, in 1963, employed an approximate formulationbasedonBerger’shypothesisof1955forthenumericalsolutionof rectangular plates with various boundary conditions for large vibration amplitudes. He plotted his results for relative time period and bending stressesasafunctionoftheratiooftheamplitudeandthicknessoftheplate for various values of the aspect ratios. Srinivasan, in 1965, used the Ritz– Galerkinmethodtostudythecaseofhingedhingedbeamsandcircularplates withdifferentboundaryconditionsatlargevibrationamplitudes.Stanišićand Payne introduced a technique in 1968 which was based on the Galerkin approachfordeterminingthenaturalfrequenciesofrectangularplateswith discretemassesaddedforsimplysupportedandclampedboundaryconditions. Theirresultsindicatedtheexpectedtrendthatnaturalfrequenciesdecreased with the added mass whereas the deflections and stresses of the plate increased. Rehfield, in 1973, developed an approach for analysing the nonlinear free vibrations of elastic structures by the use of Hamilton’s principleandaperturbationprocedure,andthiswasextendedtothecaseof forced vibration of beams and rectangular plates. Mei applied the finite elementmethodin1973forthepredictionoflarge amplitude free flexural vibrations of beams and plates with various boundary conditions. The nonlinearityconsideredwasduetolargedeflections,andnotduetononlinear stressstrain relationships, and the results showed the hard spring nonlinear characteristics as the dimensionless amplitude increased. Various analytical formulations of the problem of largeamplitude free vibration behaviour of simply supported beams with immovable ends based on the Rayleigh–Ritz technique were formulated by Singh et al. in 1990. At the same period, another model based on Hamilton’s principle and spectral analysis was proposedfornonlinearfreevibrationsofthinstraightstructuresbyBenamar etal. in1990;thiswasappliedtoclampedclampedbeams,homogeneousand symmetricallylaminatedfullyclampedrectangularplatesin1991,andfurther extendedtofullyclampedthinplatesin1993.Thesestudiesshowedthatthe

11 Chapter 2: Literature Review mode shapes were amplitude dependent. The general trends of the mode shapechange were an increaseof the displacement, orcurvature, near the edges, and flattening near the centre of the beam or plate. However, the theoretical models employed in these studies considered transverse displacements only and neglected the effects of inplane displacements. At thestartofthe21 st century,thismodelhasbeenextendedandimprovedto determinethegeometricallynonlinearfreeandforcedvibrationsofclamped clamped and simply supported beams by El Kadiri et al. in 2002(a). In this model,thenonlinearfreevibrationproblemwasreducedtothesolutionofa setofnonlinearalgebraicequations,whichwasperformednumericallyusing appropriatealgorithmsinordertoobtainasetofnonlinearmodeshapesfor the structure. They were considered in each case with the corresponding amplitudedependent nonlinear frequencies. This approach was also applied inordertodeterminetheamplitudedependentdeflectionshapesassociated withthenonlinearsteadystateperiodicforcedresponse.Theauthorsapplied the same procedure for determining the first and second nonlinear mode shapes of fully clamped rectangular plates in 2002(b), and in 2003 they proposed an improved form for determining the geometrically nonlinear response of rectangular plates which were excited by concentrated, or distributedharmonicforces.Thisapproachwasappliedtothecasesoffully clamped(CCCC),simplysupportedandclampedclampedsimplysupported (SCCS) rectangular plates. Similarly, these studies showed that the relative frequencywasafunctionoftheratiooftheamplitudeandthicknessofthe plate.FurtherstudiesshowedthatElBikri etal. extendedBenamar’smodel in2003todeterminethefundamentalnonlinearmodeshape,theassociated amplitudedependentnaturalfrequencies,andtheflexuralstressdistribution of a clamped – clamped simply supported simply supported (CCSS) rectangularplate.Later,Beidouri etal. extendedthismodelin2006tothe casesofclampedsimplysupported–clampedsimplysupported(CSCS)and clamped simply supported simply supported simply supported (CSSS) rectangular plates and determined iteratively the amplitude dependence of the first nonlinear mode shapes for aspect ratios of 0.66 and 1.5, and for various vibration amplitudes. Han and Petyt in 1997(a) developed the HFEM for the geometrically nonlinear vibration analysis of thin laminated rectangularplateswithclampedboundaryconditionstostudythevariationof

12 Chapter 2: Literature Review thenaturalfrequenciesandthemodeshapeswiththechangeofvibrational amplitude. They observed the hardening spring effect for the fundamental modeofrectangularisotropicplatesandcomparedthe nonlinear frequency ratiosforthefirstandhighermodeswithfullyclampedboundaryconditions with,withoutinplanedisplacementsandwiththeaverageofinplanestrains. The first and higher modes of isotropic and laminated plates were also reportedin1997(b).

ThelargedeflectiontheoryfortheMindlinplatewasemployedbyWangand Kuo in 1999 for the examination of the nonlinear vibration of the plate inducedbythecouplingofmovingloadswiththeweightoftheplate.Inthe initialpartofthestudiesoneoftheequationsofstaticequilibriumduetothe weightofthe plate was derived and secondly, staticresponsesoftheplate wereaccountedforinderivingtheequationsofmotionoftheplate.Static anddynamicfindingswerepresentedforasimplysupportedsquareplateof length20mandthicknessof10cm.Staticresultsshowedthatthedeviation in amplitude between the large deflection theory and the small deflection theory increasedas the thickness decreased, and similarly itincreased with theareaoftheplate.Resultsalsoshowedthatchangesindynamictransverse deflectionanddynamicbendingmomentbetweenthelargedeflectiontheory andthesmalldeflectiontheoryaresignificantforthinplateswithlargearea.

2.3 Damage in Plate Structures

Crackspresentaseriousthreattotheperformanceofstructures.Mostfailures areduetomaterialfatigue.Itisforthisreasonthatmethodsallowingearly detection and localisation of cracks are of the utmost necessity for smooth runningandlongevityofmachinesandstructures.Thedynamicresponsesof rectangularplateswithcracks,orminorirregularitiesunderdifferentloading conditions, have been investigated in the past by many researchers for differentboundariesconditions,andvariousmethodshavebeenproposedto deal with the problem. Nevertheless fewer material has been published on the vibration analysis of cracked plates. Dimarogonas, in 1996, reported a comprehensive review of the vibration of cracked structures. This author covered a wide variety of areas that included cracked beams, coupled

13 Chapter 2: Literature Review systems,flexiblerotors,shafts,turbinerotorsand blades, pipes and shells, empirical diagnoses of machinery cracks, and bars and plates with a significantcollectionofreferences.Irwin,in1962,examinedapartthrough crack in a plate subjected to tension and derived a relation for the crack stressfieldparameterandthecrackextensionforceattheboundariesofa flatellipticalcrack.Gross etal.,in1964,describedintheirtechnicalreport thatstressintensityfactorscanbeobtainedbyaboundaryvaluecollocation procedure applied to the Williams stress function for a single edge notch tensionspecimen.Theresultswerepresentedintermsofnondimensionalised stressintensityfactorsandratioofthecracklengthtothespecimenwidth, and this showed an increasing trend with the increase of crack ratio. Moreover,atsmallratiosofcracklengthtospecimen width (0.150.40) the resultswereingoodagreementwithotherauthors’ results,andabove0.40 differences in their results were implicitly due to bending, which was not takenintoaccountintheiranalyticalsolutions.

ThevibrationsofacrackedrectangularplatewerefirstinvestigatedbyLynn and Kumbasar in 1967, who used a Green's function approach to obtain a homogenousFredholmintegralequationofthefirstkindwhichsatisfiedthe mixed edge condition along a fictitious line partially formed by the crack. Lynn and Kumbasar used the Krylov and Bogolivbov method to solve the integralequationfornarrowcracks,andforasimplysupportedplateonall sides. The result was presented in terms of variations of frequencies with respect to different crack lengths, and the relative moment distributions along the uncracked segments. The dynamic characteristics of centrally locatedcrackedplatesintensionwereanalyzedbyPetytin1968bytheuseof the finite element displacement method. In addition, the effect of an increaseinthewidthoftheplatewasdescribedandthisshowedthedecrease inamplitudeintheareaofthecrackandtheincreaseinthecurvatureofthe plateintheregionofthecracktip.Theresultswerepresentedintermsof frequencies vs. crack length, and stresses and defections vs. length of the plate. Okamura et al. , in 1969, obtained the lateral deflection, the load carrying capacity, and the stress intensity factor of a rectangular cross section singleedge cracked column with hinged ends under compression. Theycomparedanuncrackedcolumnwithacrackedcolumn,andexamined

14 Chapter 2: Literature Review theeffectofacrackonloadcarryingcapacityanddeflections,withtheratio of crack length to column width, andtheratio ofcolumn width to column length as important parameters. In particular these authors considered the effectofcomplianceduetobending,andignoredthe effect of compliance duetorotationinducedbytheaxialload.StahlandKeer,in1972,aswellas Aggarwala and Ariel, in 1981, solved the eigenproblem of simply supported platesbyusinghomogeneousFredholmintegralequationsofthesecondkind bytakingthestresssingularityatthecracktipsintoaccount.Theseauthors presented methods which were limited to crack locations that allowed the problemtobereducedtoadualseriesequation,howevertheprocedureof themodelinvolvedlotsofcomputation.AggarwalaandArielpointedoutthat thefrequencyappearedtobehigherwhenthecracksstartedfromoutsideof the plate as compared to the case when cracks started from inside. The reason for this discrepancy was explained for the cracks starting from the outside,thatinthelimitingcasewhentheyreachedthecentre,onaccountof symmetrythecondition ∂w/ ∂ x (where w isthetransversedisplacementof theplate)mustbesatisfiedatthecentre,whichwasnotapplicablewhenthe cracksstartedfromthecentre.RiceandLevy,in1972, introducedthe line springmodelthatreducedthetrulythreedimensionalproblemtooneusing two dimensional plate or shell theory. This approach is computationally inexpensivecomparedtofullthreedimensionalmodels, and, within certain restrictions, provides acceptable accuracy. They employed two dimensional generalisedplanestresses,andusedKirchhoff’splatebendingtheorieswitha continuously distributed line spring to represent a partthrough crack, and alsochosecompliancecoefficientstomatchthoseofanedgecrackedstripin plane strain. The line of discontinuity was of length 2 a and the plate was subjectedtoremoteuniformstretchingandbendingloadsalongthefarsides of the plate. These authors computed the force and moment across the crackedsectiontodeterminethestressintensityfactor,andthesolutionto the problem was characterised in terms of the Airy stress function. Their resultsshowedthat Krs K rs (where Krs isthestressintensityfactorforanall over crack, and Krs isthestressintensityfactorofanedgecrackin plane strain for the same relative depth lo h , and for remote tensile or bending load)approachesunitywithanincreaseintheratioofcracklengthtoplate

15 Chapter 2: Literature Review

thickness 2a h .Furthermore,atsmallvaluesofrelativedepth lo h ,theratio

Krs K rs approachesunityforsmallvaluesof 2a h .MoreoverRiceandLevy, 1972, pointed out that the line spring approximation appears to be most appropriate along regions where the crack depth varies slowly. Hirano and Okazaki,in1980,andNezu,in1982,appliedafiniteFouriertransformtothe differentialequationsgoverningtheproblemoftheplatesinwhichonepair ofsimplysupportededgeswasperpendiculartothe lineofthecrack.They obtained a system of integral equations which possessed the unknown discontinuitiesofthedeflectionandslopeacross the crack. These unknown quantities wereexpanded intoa Fourier series. The results were presented for symmetric and antisymmetric cases of their proposed models with excellentconclusions.

BendingofacrackedrectangularplatewasfirstinvestigatedbyKeerandSve in 1970. Their analysis was limited to such a location of the crack that allowedreductionoftheproblemtoadualseriesequation.Hencethecrack was confined to a position along the symmetry axis. They formulated the problem as dual series equations and used a modification of the technique proposedbyWestmannandYangin1967toobtainasolutionin terms of a Fredholm integral equation of the second kind. Keer and Sve studied three cases comprising two collinear external cracks of equal length, an internal centrallylocatedcrack,andasingleexternalcrack.Inallthesecasesthetwo plateboundariesperpendiculartothelineofthecrackweresimplysupported andclamped.Theauthorsfoundthattherewasachangeinstrainenergydue to the crack for both support cases, and for different aspect ratios of the plate. By comparing the two support conditions it was concluded that the clamping will tend to decrease the possibility of fracture since the strain energyreleaserateissmaller.AnanalogousmethodwasappliedbyStahland Keerin1972fortheanalysisofnaturalvibrationandstabilityofrectangular platesandwasboundedbythesimilarlimitationsencountered by Keer and Sve in 1970. Solecki, in 1975, attempted to remove existing restrictions by developingamethodthatwouldallowthestudyofrectangular plates with arbitrarilylocatedcracks.Solecki,in1983,extendedthisworkanddeveloped a method to study the natural flexural vibration of simply supported rectangularplateswithanarbitrarilylocatedcrackparalleltooneedge,and

16 Chapter 2: Literature Review the method was based on the combination of finite Fourier transformation andofthegeneralizedGreenGausstheorem.Asimplysupportedrectangular platewithacentrallylocated,andoffcentre,crackwasdiscussedasoneof the examples. Numerical data was not obtained however, partially because the singularity of the curvature at the tips was not explicitly isolated. Rossmanith, in 1985, used the Westergaard stress function approach and solvedforthestressintensityfactorofassociated,centrallylocated,cracked platebendingproblems.

Rectangular plates with cutouts are frequently found in engineering structures and these cutouts are principally made for saving weight, for venting,foralteringthenaturalfrequenciesandforprovidingaccessibilityto otherpartsofthestructures.Manyauthorshaveinvestigatedthesetypesof structures and a few of them are mentioned here. Ali and Atwal, in 1980, used Rayleigh’s method to study the natural vibration of rectangular plates withcutouts.Acomparisonoftheresultsobtained from Rayleigh’s method and those obtained from the finite element method indicated that the maximumdiscrepancybetweenthetworesultswasoftheorderof1011%for thefirstmode,andincreasedasthemodenumberincreased.Toreducethe percentage discrepancies in their results they proposed a correction factor depending on the cutout size, and modified the deflection shape function which reduced the values from the corresponding finite element results to below5%.Similarly,Lee etal. ,in1990,proposedanalternatemethodforthe prediction of natural frequencies of rectangular plates with an arbitrarily located rectangular cutout, and the plate was simply supported along one pair of opposite edges with any other boundary conditions in force at the remainingedges.Thedeflectionfunctionwaschosentosatisfyall,orpartof, theinternalfreeedgeconditionsalongthefouredgesofthecutout,whereas the deflection function assumed by Ali and Atwal, 1980, was continuous throughoutthewholedomainoftheplate,includingthecutout.Symmetric andantisymmetricmodesofvibrationwereconsideredinordertoformulate theproblem,andtheresultscomparedwiththosefromfiniteelement.

TheLineSpringModel(LSM)hasbeenrigorouslytreatedbymanyresearchers sinceitwasinitiallyproposedbyRiceandLevyin1972.WenandZhixe,in 1987,suggestedamodifiedlinespringmodelbytakingintoaccountthenon

17 Chapter 2: Literature Review localeffectofthedeformationforthelinespringforthefractureanalysisof partthrough and slender cracks under tension and shearing. These authors investigatedtheaccuracyandtherelationshipoftheLSMbetweenReissner’s theory of plates and shells and Kirchoff’s theory, and calculated the stress intensity factors under different loading conditions and geometry of the crackedbody.Twosetsofproblemswerediscussed;aninfiniteplatewithan embeddedsymmetricellipticalcrackundertension,andarectangularsurface crack under uniform shearing, and it was found that the relative error increased with the increase of the ratio of crack depth to plate thickness. Oliveira etal. ,in1991,describedtheIntegratedLineSpringElement,which wasdesignedtobeassociatedwithSemiloofshellelementsforthesimulation ofthestructuralbehaviouroftheremainingligamentinapartthroughcrack inathinshell.Thisshellelementwasusedtodeterminethestressintensity factorforinternalandexternalsemiellipticalcracksinarbitraryshellsunder mode I, II and III load conditions. Liu et al. , in 1999, obtained a three dimensionalboundaryelementmethodwithmixedboundaryconditionsfora nonlinearsurfacecrackanalysis,andusedtheLSMfortheformulationofthe problemandstudiedthefractureparameter Jintegralofanonlinearsurface crack. They also presented a predictorcorrector method for the nonlinear compliance matrix of the mixed boundary condition. The authors gave examplestoillustratetheirproposedmethod,inthefirstcaseathickplate with a semielliptical surface crack with maximum crack depth of 0.6 was considered and the results showed that the plastic J integral appeared at aroundanormalisedloadof0.6,andafter0.9theresultsseemedtoshowa big difference,as compared with existingsolutions, whereas inthecaseof thesecondexampleinwhichahollowcylindercontained a circumferential external crack of constant depth, plastic behaviour was observed around a normalised load of 0.65, and uncertainty occurredafter 0.85. Therefore, it wasconcludedthatthismethodwasnotsuitableforasurfacecrackproblem withlargescaleplasticdeformation.Zeng et al. ,in1993,developedanew LSMbasedontheboundaryelementmethodtofindthesurfaceflawsinthe plate in the form of crack. The virtual crack extension technique was employedtoobtainthestressintensityfactorattheintersectionofthecrack frontandfreesurface.Theseauthorsfoundbydetailinvestigationsthatthe stressintensityfactoratthecrackfrontfreesurfaceintersectionwasbarely

18 Chapter 2: Literature Review acceptable. Cordes and Joseph, in 1995, analyzed the LSM and used it to determinethestressintensityfactorsforthesurfaceandinternalcracksina Reissner plate that contained residual stresses. Such stresses are usually caused by intentional or unintentional activities during manufacturing and installation,andneedtobedeterminedtoensurethatthematerialresponds inasafe,predictablemannerduringitslifetime.Theseauthorspresenteda series of results for different crack length and depth, and compared their resultswiththeLSMclassicaltheory(theIrwinmodelof1962)andthefinite element model, which showed that the current model results ranged from 0.60.8%higher,whereastheaveragepercentagedifferencewasfoundtobe 4.2%.Thediscrepancyincreasedslightlyastheorderoftheloadingincreased. GoncalvesandCastroreviewedtheLSMin1999,anditsimplementationinthe finiteelementprogrami.e.ABAQUS.Somepartthroughcrackconfigurations inplateswerestudiedandtheseauthorsobtainedthestressintensityfactors forthecaseofpuretensionandpurebending.ItwaspointedoutthattheLSM doesnottakeintoaccountthecurvatureofthecrackfrontandisnotagood approximationneartheendswherethecrackintersectsthefreesurfaceand incaseswherethecrackdepthvariesrapidly.

Liew etal. ,in 1994, employedthe decomposition method to determinethe vibration frequencies of cracked plates with any combination of boundary conditions.Theyassumedthecrackedplatedomaintobeanassemblageof smallsubdomainsandusedtheappropriatefunctionstoobtainagoverning eigenvalue equation. The results were plotted and compared with those of otherauthorsforasymmetricandantisymmetricplatemode,fortwosetsof crack locations. Ramamurti and Neogy, in 1998, applied the generalized Rayleigh–Ritzmethodtodeterminethenaturalfrequencyofacrackedblade ofaturbomachine,modelledasacrackednonrotatingcantileveredplate.It wasfoundthroughtheirresultsthatthecrackedfrequencieswerelowerthan the corresponding uncracked frequencies, although the authors were not satisfiedwiththesefindingsandarguedthatthenaturalfrequencyisnota goodcriterionfordamagedetection.SimilarlyNeogyandRamamurti,in1997, proposedamodelofadamagedblade,andthedamagewasintheformof nonpropagatedcrackfordeterminingthenaturalfrequency,howeveratthis time they modelled a blade as a rotating shell. In their findings, they

19 Chapter 2: Literature Review observedthattheeffectofrotationinthefirstmode was very pronounced but the effect of the crack was marginal, and so rotation failed to alter considerably the pattern of frequency reduction. In the case of the second andthirdmodesboththecrackandtherotationproducednoticeableeffects andtherelativelylargereffectofrotationtothedecreaseinfrequencywas observed. Therefore, it was concluded from these results that the small cracksinturbineblades,whenmodelledasacantileveredplate,cannoteasily bedetectedbythenaturalfrequencycriterion.

Atthestartofthe21stcentury,KhademandRezaee,in2000(a),introduceda newtechniqueforthevibrationanalysisofcrackedplatesandconsideredthe effectofcomplianceduetobendingonly.Laterin2000(b),theyestablished an analytical approach for damage in the form of a crack in a rectangular plateusingtheapplicationofexternalloadfordifferentboundaryconditions. Theyconcludedfromtheirresultsthatthepresenceofacrackataspecific depthandlocationwouldaffecteachofthenaturalfrequenciesdifferently. Wang et al. , in 2003, extended a boundary collocation method based on complex variable theory which was proposed for calculating the stress intensity factors of cracks in a finite plate. Five examples including a rectangular/circular plate with a central crack, a rectangular plate with a slantedcrack,asimplysupportedplatewithacentralcrackandaplatewith two cracks were discussed, and it was concluded that good agreement for shortcrackswasevidentwiththoseobtainedbyothermethods.WuandShih, in2005,theoreticallyanalyzedthedynamicinstabilityandnonlinearresponse ofsimplysupportedcrackedplatessubjectedtoaperiodicinplaneload.The incremental harmonic balance method was applied to solve the nonlinear temporalmodel.Theirresultsindicatedthatthestabilitybehaviourandthe responseofthesystemweregovernedbythecracklocationoftheplate,the aspectratio,conditionsofinplaneloading,andthe amplitudeof vibration. Theyalsoexplainedthatincreasingthecrackratioi.e.theratioofthecrack length to the length of the edge where the crack lies or/and the static component of the inplane load decreases the natural frequency of the system. Purbolaksona et al. , in 2006, proposed a dual boundary element method for the geometrically nonlinear analysis of a square cracked plate with fully clamped and simply supported boundary conditions. The results

20 Chapter 2: Literature Review showedthatthenormalisedstressintensityfactorsinthemembraneofthe plateincreasesignificantlyafterafewincrementsoftheload.However,in bendingthenormalisedstressintensityfactorsdecreaseifcomparedwiththe linearresults.

2.4 Finite Element Approach in Cracked Plate Structures

TheFiniteElementMethod(FEM)hasalsobeenemployedforthestudyofthe vibrationofcrackedstructuresandisveryusefulinanalysingrealengineering constructions. Cracked plates can be modelled in many ways using FEM. Circularorpennyshapedcracksandanellipticalcrackcompletelyembedded inafinitethicknessplatesubjectedtouniformtensionwereanalyzedbyRaju andNewmanin1979usingathreedimensionalFEmodel.Isoparametricand singular elements were used in combinations to model elastic bodies with cracks. Thecalculated stress intensity factors forthesecrackconfigurations werecomparedwiththeexactsolutionstoverifythevalidityoftheFEMas used,andconcludedthatthestressintensityfactors for embedded circular andellipticalcracksweregenerallyabout0.41%belowtheexactsolutions. However,fortheellipticalcrackthecalculatedstressintensityfactorsinthe regionofthesharpestcurvatureoftheellipsewereabout3%higherthanthe exactsolution.

Markström and Storàkers, in 1980, obtained a solution which was based on separatingthenodesoftheelementsonbothsidesofthecrack.Thebuckling characteristics of cracked elastic plates subjected to uniaxial tensile loads wereanalyzedbytheaidofaFEMwhichwasbasedupon linear bifurcation theory.Centrallycrackedplatesandsomeedgecrackedmembersweretested in detail and the results were presented for the symmetric and anti symmetricmodeofcrackedplates.In1983,Alwarand Nambissan proposed thatstressintensityfactorscanbeobtainedforfinite rectangular plates by the use of FE techniques. Three dimensional isoparametric singular brick elementswereusedtoanalysethebendingofplateswithcracks.Thisanalysis showedthevaluesofstressintensityfactortobeabout510%higherthanthe two dimensional analysis and these authors found that the stress intensity factorvariedinanonlinearfashionacrosstheplatethickness.

21 Chapter 2: Literature Review

Qian et al. ,in1991,builtaFEMofcrackedplatesusingthe integral ofthe stress intensity factor, and used this to solve the vibration problem of a damagedplate,onewithacrackatthecentreofa simplysupportedanda cantilever type square plate. In these cases mesh subdivision in the neighbourhood of the crack tip was unnecessary, and the time of the numericalcomputationswasshort.Theseauthorscomparedtheirresultswith the model of Solecki (1983) with good agreement. Krawczuk, in 1993, presentedaFEmodelbasedonthestiffnessmatrix for a rectangular plate andshellconsistingofathrough,nonpropagating,opencrack.Hestudiedthe effects of the crack length and location on the changes of the eigenfrequencies of the simply supported and cantilever rectangular plate. Thecentreofthecrackwaslocatedinthemiddleofthespanoftheelement and assumed a linear normal stress and constant shear stress distribution acrossthecrackelement.Itcanbeconcludedfromthisworkthatdecreasing naturalfrequenciesareafunctionofthelengthandlocationofthecrack,the modesshape,andtheboundaryconditionsoftheplate.Later,in1994similar findings were obtained except that Krawczuk showed the influence of the crack length and its location upon the amplitudes of the transverse forced vibration for aluminium cantilevered cracked plates and beams, and found thatanincreaseinthetransverseforcedvibrationamplitudeofthecracked platewasafunctionofthecracklocationanditslength.Furtherstudiesshow thatKrawczuk etal. introducedelastoplasticpropertiesintocrackedplates in 2001. Su et al. , in 1998, extended the fractal two level finite element method(F2LFEM)toanalyzethefreevibrationofa thin cracked plate with arbitrary boundary conditions. The results for a simply supported centre cracked square plate subjected to edge moments for three modes of vibrationswerecomparedwiththemodelofStahlandKeer(1972).

SaavedraandCuitinosuggestedin2002animprovedFEmodelforstudyingthe dynamicbehaviourofatestrotoraffectedbythepresenceofacrackinthe shaft. The results indicated that changes in the shaft orbits with rotational speedweretheindicationofcrackidentification.Itwasalsoobservedthatat a subharmonic resonance experienced a peak when the rotating speed coincidedwithhalfofthefirstnaturalfrequencyofthesystem.Furthermore, these authors observed another characteristic that was an important

22 Chapter 2: Literature Review indicationoftheexistenceofacrackinthecaseoflowrotationalspeedwhen the unbalance effects were negligible, and found that the vibration at the excitation frequency was due to the crack. Numerical results were in good agreement between the analytical model and the experimental work. Fujimoto et al. ,in2003,reportedavibrationanalysisofrectangular plates subjectedtoatensileloadandcontainingacentrallylocatedcrackalongthe line of symmetry perpendicular to the direction of the tensile load. These authorsusedtheFEMforfindingtheeigenvalueanalysis,andthebodyforce method was implemented for inplane stress analysis associated with the eigenvalueanalysis.Theirnumericalandexperimentalresultsconfirmedthat thenatural frequencies of all vibration modes increased monotonously with increaseintensileload,whereastherateofincreasingfrequencydepended uponthemodeshapes.Itwasalsoobservedthatthismethodwaswellsuited totheplatewithalongcrackandthatthisshowednoticeablevariationsof modeshapesforasmallrangeoftensileload.Failureassessmentofacracked platesubjectedtobiaxialloadingwaspresentedbyKim etal. in2004.Their analyseswerebasedontwodimensionalandthreedimensionalelasticplastic finite element analysis, while the through thickness and semi elliptical surface crack was considered in the plate. It was found that the effect of biaxiality on crack tip stress triaxiality was more pronounced for a thicker plateandinthecaseofsemiellipticalsurfacecracks,thecrackaspectratio wasfoundtobemoreimportantthantherelativecrackdepth,andtheeffect ofbiaxialityoncracktipstresstriaxialitywasfoundtobemorepronounced nearthesurfacepointsalongthecrackfront.

2.5 Damage Detection Methodologies in Plate Structures

Thefieldofdamagedetectionhasreceivedconsiderableattentionduringthe pastfewyearsandamajorcollectionofliteratureisnowavailable.Cawley andAdams,in1979(a),proposedamethodwhichdescribedanondestructive assessmentoftheintegrityofstructuresusingmeasurementofthestructural naturalfrequencies.Thismodelwasbasedonreducingtheelasticcoefficients oftheelementatthecracklocation.Themaindisadvantageofthismethod was that the reduced elastic coefficients were not related to the real dimensionsofthecrack.Itwasshownhowmeasurements made at a single

23 Chapter 2: Literature Review pointinthestructurecouldbeusedtodetect,locateandroughlytoquantify damageinawidevarietyofoneandtwodimensionalstructures.In1979(b) these authors developed an experimental method to estimate the location and depth of the damage from the changes in the natural frequencies. Cornwell et al. , in 1999, used a strain energy method to detect and locate damageinplatelikestructures.Thismethodrequiredthemodeshapesofthe structurebeforeandafterdamage.Thealgorithmwasfoundtobeeffective inlocatingareaswithstiffnessreductionsaslowas10%usingrelativelyfew modes.

In2002,YanandYamdetecteddamagesincompositeplatesbyusingwavelet analysis to decompose the dynamic responses. An application of spatial wavelettheorytodamageidentificationinstructures was initially proposed by Liew and Wang in 1998. The damage was in the form of crack and considered a simply supported beam with a transverse onedge non propagating open crack for modelling the problem. They calculated the waveletsalongthelengthofthebeambasedonthenumericalsolutionforthe deflectionofthebeam.Thedamagelocationwasthenindicatedbyapeakin the variations of some of the wavelets along the length of the beam. Krawczuk et al. , in 2003, and later in 2004, applied a versatile numerical approachfortheanalysisofwavepropagationanddamagedetectionwithin crackedplates.Theyconsideredthespectralplateelementasatoolforthe investigationofsuchphenomenaandshowedthatwhenapropagatingwave runstothecracklocationoftheplateitdividesitselfintotwosignals,which show an indication of the damage section. Chang and Chen, in 2004, presentedaspatialwaveletapproachfordamagedetectioninarectangular platewithclampededgesonfoursides.Inthismethodtheonlyneedwasfor spatiallydistributedsignalsintermsofdisplacement,ormodeshapesofthe rectangular plate after damage. These spatially distributed signals can be obtainedby FEMand can then beanalysed by wavelet transformation. The resultsshowedthatthedistributionsofthewaveletcoefficientscanidentify damage position by showing a peak at this location. However, some indications of damage were also observed at the clamped edges of the rectangularplate.Therefore,itwasconcludedthatitwasveryhardtodetect the crack position at the edges. In 2004, Epureanu and Yin monitored

24 Chapter 2: Literature Review structural health while employed vibration based damage detection. They investigated a panel excited by flow induced loads and considered the nonlinearityresultedfromthestretchingandbendingofthepanel.Thepanel was modelled as a one dimensional, homogenous, isotropic and elastic thin platewithspringsupportedendpoints.Thismethodusedprobabilitydensity functionsfordeterminingthestructuralresponse.Theseauthorsarguedthat nonlinearities interfered with linear behaviour, and small parameter variationsweredifficulttodetectusinglinearmethods,andthatthislackof sensitivityarosefromthefactthatlinearmethodsminimizedtheinfluenceof nonlinearities. Vibration based damage detection and location in an aircraft wingscaledmodelwasstudiedbyTrendafilovain2005.Inthisstudylocalised anddistributeddamagewasconsidered,andasimplifiedFEMinANSYSwas usedtomodeltheproblemforthevibrationresponse.Thewingwassplitinto fivevolumesforthepurposeofanalysingthedamagedetectionforthefirst tennaturalfrequencies.Itwasshownthatthecracksoflengthlessthanhalf ofthewingwidthareundetectableinthecaseoflocaliseddamage,whilstin thecaseofdistributeddamagedamagelessthan30%inanyofthevolumes was not detectable using natural frequencies. The author proposed in her concluding remarks that changes in the lower modal frequencies were affectedbydamageclosetothewingroot,andtheirchangesdecreasedwhen thedamagemovedtowardsthewingtip,orconverselythehigherfrequencies were more affected by damage close to the wing tip and their changes increasedwhendamagemovedfromthewingroottowardsthetip.Laterin 2006, Trendafilova et al. applied a similar technique for vibration based damagedetectioninaircraftpanelsmodelledasisotropicplateswithacrack atsomespecifiedlocation,andtheyobtainedextremelygoodresults.

The modal frequencies are often used as a principal parameter for determininghowastructurewillrespondtoaknowndynamicforcing,or,as the main parameter for vibration health monitoring of structures. In this connection,Gorman etal. ,in2006,usedthemodalfrequenciesapproachfor thevibrationhealthmonitoringofacoupledplate/fluidinteractingsystem.A theoreticalanalytical method based on the Galerkin method was developed for the frequency–modal analysis and the theory was further extended to

25 Chapter 2: Literature Review describethenaturalcoupledmodesintermsoftherelativeenergyassociated witheachofthetwosubsystemsoftheplateandthefluid.

2.6 Damaged Plates of Various Sizes and Shapes

Thepastliteraturecoversdifferenttypesofplatestructuresfromrectangular to circular shapes for the analysis of damage detection. Shawki et al. , in 1989,formulatedthepowerlawlinespringmodelfordeepcracksinafully plasticsemiinfinitebodysubjectedtoremotetensionandbendingtofindthe stressintensityfactorsandtheyimplementedthemodelwithintheABAQUS FE program. These authors also applied the LSM to three dimensional structural problems with semielliptical surface cracks which revealed the shiftingoftheloadingaxiswithincreasingloadsandindicatedthechangein thelocalratioofbendingtotension.Lee,in1992,introducedamethodbased on Rayleigh’s principle and the subsectioning of plate domains for the determinationofthefundamentalfrequencyofannularplates.Thismethod canbeappliedtoannularplateswithvariousboundaryconditions,however, onlythefirstnaturalfrequencyoftheplatecanbedetermined.Theresults showedthatthefundamentalfrequencyincreaseswhenthecrackislocated nearoneofthetwoedgesandontheotherhandthefundamentalfrequency decreases with increasing crack length for a crack located near the centre between the two edges. The determination of the dynamic stress intensity factor(DSIF)instructureshavingastationarycrackcanprovideinformation aboutcrackpropagationasreportedbyPolyzos etal. in1994.Theyemployed a frequencydomain boundary element method for the computation of the DSIFforcrackedviscoelasticplatesinconjunctionwiththenumericalLaplace transformandthecorrespondingprincipleoflinearviscoelasticityalongwith quarterpoint boundary elements. Their results showed that viscoelasticity generallyreducedtheplateresponse.

Lele and Maiti, in 2002, extended the work of crack location detection in short beams based on frequency measurement by taking into account the effectsofrotationalinertiaandsheardeformation.Aseriesofcasestudies waspresentedtojustifythisworkfordifferentlocationsofthecrackinthe shortbeam.Theresultspresentedinthispaperwerenotsoencouragingdue

26 Chapter 2: Literature Review tothefactthattheerrorsinthenaturalfrequencies were in a reasonable rangeforfirstmode,whilsttheerrorincreasedforsecondandthirdmodesof vibration.Bamnios etal. ,in2002,investigatedtheinfluenceofatransverse opencrack inbeams using mechanical impedanceunder different boundary conditions,bothanalyticallyandexperimentally.Theseauthorsmodelledthe crackbyanappropriateequivalentspringconnectingthetwosegmentsofthe beam.Theresultsofthisworkshowedthatthemechanicalimpedanceofthe beamstronglydependsonthesizeandlocationofthecrack.Thelocationof thecrackwasfoundbytheindicationofjumpsintheslopeoftheresponse curve depending upon the crack’s depth. The proposed method lacked accuracyforsmallcracksof a/w <0.20( aisthedepthofthecrackand w is theamplitude).HoribeandWatanabe,in2006,proposedaninversemethod thatusedageneticalgorithm(GA)fortheidentificationofwidthandposition of the cracks derived from changes in the natural frequencies in plate structures. In this method, the natural frequencies were calculated by FEM whichwasbasedontheBogner,FoxandSchmidtmodel and employed the response surface method (RSM) for minimising the processing time. They discussed two types of crack in the analysis comprised internal and edge cracks for a cantilever, and a plate with two ends clamped. The results showed that the proposed method provides satisfactory identification of cracks in plates and explained the fact that the problem within the approximation accuracy of the interpolation function, and rapid changes in naturalfrequencycouldnotberesolvedduetocoarselatticepointintervals.

2.7 Solution Methodologies

Differentialequationsolutionforbeamsandplatesisavasttopicwithmany variations, although there is a consistent stream of more popular methods. These can be broken down into two solution groups the first being exact analytical solutions and the second being approximate solutions. A limited numberofexactsolutionsexistandtheseareforfairly specific conditions. There are 21 independent boundary conditions that can be applied to rectangular plates. Leissa, in 1973, detailed these boundary conditions for rectangularplates,pointingoutthattheonlyexactsolutionsknownwerefor thesixcasesofplateswithsimplysupportedoppositeedges.Later,Leissa,in

27 Chapter 2: Literature Review

1993,studiedawiderangeofplatesandexplainedhowtoobtainthemode shapes and natural frequencies. Navier also proposed an exact method to solvetheseequationsusingadoubleFourierseries [Szilard, 2004]. Navier’s solution, or Levy’s solution,is valid for plates with simply supported edges andstillremainsthebasicapproachforthesolutionofplates.Inmethodsfor thesolutionofplateproblemswhicharenotbasedondifferentialequations, the beam function with free edges can be successfully applied, however, wherethesolutionisbasedondifferentialequationsoftheplate,thebeam function for free edges will give incorrect results, as discussed by Mukhopadhyayin1979,whopresentedanumericalmethodforthesolutionof rectangularplateshavingdifferentedgeconditionsandloading.

The most common and readily available solutions are those of the approximate techniques. These range from the familiar RayleighRitz technique [Warburton, 1954] to the hierarchical finite element technique [HanandPetyt,1996].InthecaseofWarburton'sand Leissa's analysis they usedtheRayleighRitztechniqueinconjunctionwithbeamfunctionstoobtain approximate solutions for the remaining 15 boundary conditions [Leissa, 1973]. This technique is still widely used and can be found in a large assortment of the literature, referenced in Leissa's monograph (1993). Similarly,theRitzmethodwasappliedbyYoungin1950,andinvestigatedthe setoffunctionsdefiningthenormalmodesofvibrationofauniformbeam, andthisauthorobtainedasolutionfortheplateproblemwithmorethanone setofboundaryconditions.NagarajaandRao,in1953,andStanišië,in1957, obtainedanapproximatesolutiontothedynamicalbehaviourofrectangular plates for different boundary conditions. In these studies the RayleighRitz andGalerkinmethodswereadoptedfortheanalysis.

The wide use of the finite difference technique to obtain solutions to problems of mathematical physics is also evident in the beam and plate literature. Szilard, in 2004, details this technique for multiple plate applicationsinhisfamousbook, TheoriesandApplicationsofPlateAnalysis , inordertodevelopthistechniquetoplateswithirregularboundariesandalso plates with orthotropic properties. In the 1970s and early 1980s nonlinear plate elements were being developed using the FE techniques. The finite element technique is currently a popular technique within the field of

28 Chapter 2: Literature Review numerical solutions. One of the more recent finite element solution techniques for the linear plate problem is the hierarchical finite element method(HFEM)[Han&Petyt,1996,andRibeiro&Petyt,1999].Theseauthors showed that this technique can be advantageous in that it reduces the numberofdegreesoffreedomthatmustbeusedtoyieldanaccurateresult, when compared with the linear finite element method. They also used the harmonicbalancemethodinconjunctionwithHFEM.The HFEM, which uses highorder polynomial displacement functions, allowstheentireplatetobe modelled with one element. This technique is illustrated for both isotropic and laminated plates by Han and Petyt in 1997. Later, Leung and Zhu, in 2004,appliedthesametechniquefortheanalysisofnonlinearfreeandforced vibrationofskewandtrapezoidalMindlinplates.

PrabhakaraandChia,in1977,usedthemethodofFouriercosineseriesand appliedittoanalyzethedynamicofvonKarmantypeequationsoftheplate with all clamped and all simply supported stress free edges. These results showedthatthenonlinearfrequencyincreasedwithitsamplitudeandhence onlyahardeningtypeofnonlinearitywasobserved.

Wykes, in 1982, used Electronic Speckle Pattern Interferometry methods (ESPI)tomeasurethedynamicsurfacedisplacementfollowedbyWang etal. , in1996,whousedESPItechniqueforvibrationmeasurement,andcompared three image processing methods based on time averaged techniques comprised the videosignal addition method, the videosignalsubtraction method, and the amplitudefluctuation method, and found that amplitude fluctuation method produced the best visibility. Liu and Lam, in 1994, providedavaluabletechniquefordetectinghorizontalcracksanddetermined boththelengthanddepthofthecrackbyexcitingtheanisotropiclaminated plate with harmonic loads moved along the plate surface. Numerical experimentswereundertakenbyusingthestripelementmethod.

Solutionsforthenonlinearequationshavebeenexaminedextensivelyinthe literature. These solutions are substantially more complicated in the geometrically nonlinear case than those discussed for the linear problem. However,someofthesamesolutiontechniquesareappliedinthenonlinear caseasappliedinthelinearvariant,withlittlemodification.Exactsolutions

29 Chapter 2: Literature Review tothenonlinearplateareobviouslydifficulttoobtain.Totheauthor’sbest knowledge,noexactsolutionsexistforthedynamicbehaviourofnonlinearly deflecting rectangular plates, but approximate solution techniques exist for some nonlinear plate problems. Generally these solutions either use approximatingfunctions,ortheseassumecertaintermstobenegligible,or theseusesomeformoffinitediscretisationmethod.Chia,in1980,published anexcellentcompilationofinformationonnonlinearplates,andmanyofthe methods needed to solve different plate problems, in his book, Nonlinear Analysis of Plates . One of the very prominent techniques found in the literature is attributed to Berger, in 1955, andconsequently referred to as Berger’sformulation.Writingthestandardenergyexpressionatthemidplane of the plate, Bergerassumed that the second strain invariant is negligible. Thisthenresultsindecouplingandlinearisationofthe governing equations. Although,thecaveatwiththisassumptionisthatthereisnodirectphysical interpretationofthevalidityoftheassumptionused.Manyotherauthorsuse the Berger technique in their analysis of a multitude of plate problems. In Leissa'smonograph(1993)othertechniquesareillustratedwhichextendthe Berger technique to include the vibrational behaviour of these nonlinear plates. Part of this approach is to assume a solution based on the spatial modesandonsomefunctionintime.Thishasbeenshown,inthisthesis,to reducetothewellknownDuffingoscillatorproblem.

Anotherverypopulartechniqueisthedoubleseries,typicallyaFourierseries, although in some cases a one term or singlemode solution is used for the transverse deflection [Han and Petyt, 1997]. Teng et al. , in 1999, used a Fourier series to obtain a governing equation for nonlinear plates that is exactly the well known Duffing equation. Lighthill's extension of the perturbationmethodwasthenusedandatransientsolution for rectangular platesunderblastloadingwasobtained.

Hamilton's principle has also been applied by Benamar et al. (1990) to examinethechangesinmodeshapesandfrequenciesofvibrationinnonlinear clampedplatesandbeams.Adependenceonmodeshapes and frequencies was found, curvatures near the clamped edge increased as the deflection increased.Alsospatialdistortionwasanalysedanditwasfoundthatthereis an interaction at large deflection between the first and higher order odd

30 Chapter 2: Literature Review symmetricmodes.Thistechniquewasalsoappliedtosymmetricallylaminated rectangular plates by Beidouri (2006), and by El Bikri (2003) to rectangular plates with a combination of simply supported and clamped boundary conditions.

Vibrationsolutionsfordamagedplateshavebeeninvestigated using various methodsinthepast,ashasalreadybeendiscussed in detail in section 2.3. Each solution techniqueis of some form of special relevance and treatment involvessomeparticulartypeofapproximations.A briefintroductiontothe methodsusedfollowson.ThefinitedisplacementmethodwasusedbyPetyt (1968)andthefiniteFouriertransformwasusedbyHirnoandOkazaki(1980), Nezu(1982)andSolecki(1975)fortheiranalyses. AliandAtwal(1980)used Rayleigh’s method for studying the natural vibration of rectangular plates with cutouts, followed by the work of Ramamurti and Neogy (1998) who applied the RayleighRitz method for damaged plate structures. The finite elementmethodisafastgrowingtechniquewhichhasalsobeenappliedto cracked plates by many researchers, such as Raju and Newman (1979), MarkströmandStoràkers(1980),Qian etal. (1991),Krawczuk(1992),Su etal. (1998),SaavedraandCuitino(2002),andFujimoto(2003)etc.

Themethodtobeappliedinthisdissertationistheperturbationmethodof multiplescales.Ithasbeenpreviouslyappliedinlinearcaseofparametrically excited systems, and nonlinear cases for different structures. However, no literature has been found for its use in the case of damage in the form of cracksinplates.Comparisonsaremadewithotherpapersandexperimental results, and some reasonable agreement between the solutions has been found,whichisdiscussedfurther.

2.7.1 Perturbation Theory

Thedevelopmentofbasicperturbationtheoryfordifferentialequationswas fairly complete by the middle of the 19th century, when the French astronomer, mathematician and physicist Pierre Simon Laplace (1749–1827) wasthefirsttouseperturbationmethodstosolvetheproblemofequilibrium ofalargeweightlessdroponaplane.ItwasatthattimethatCharlesEugène Delaunay(1816–1872)wasstudyingtheperturbativeexpansionfortheEarth

31 Chapter 2: Literature Review

MoonSun system, and discovered the socalled problem of small denominators.

The perturbation method is only capable of treating problems with weak nonlinearity, and quickly becomes difficult to work with when calculating higherorderapproximations,thereforeothertechniquesmustbeexploredin ordertoobtainresultsforstrongernonlinearity.Manyperturbationmethods havebeenenvisagedintheresolutionofnonlinear problems. These include such well established methods as Incremental Harmonic Balance (IHB), Averaging, KrylovBogolioubov (KB), KrylovBogolioubovMitropolski (KBM), LindstedtPoincaré(LP)andtheMethodofMultipleScales(MS).

ManyauthorssuchasLauandCheung(1981),Lau etal. (1984),andPierreand Dowell (1985) have all applied the IHB method to various problems in nonlinear dynamics. In addition, Pierre et al. , in 1985, proposed a multi harmonic analysis of a dry, friction damped system using the IHB method, wheretheyfoundthattheIHBmethodcanyieldvery accurate results over thetimedomainmethods.Ferri,in1986,showedtheequivalenceoftheIHB methodandtheharmonicbalanceNewtonRaphsonmethod.CheungandLu, in 1988, presented a development of a simple algorithm for the implementation of the harmonic balance method for solving a nonlinear dynamicsystem.Theversatilityofthisalgorithmisdemonstratedforavariety of nonlinear vibration responses, namely, the combination resonances of hingedclamped beam, the nonlinear effect on the degenerate vibration modesofasquareplateandthenonlinearoscillationofthinrings.Jezequel et al. in 1990, proposed a nonlinear synthesis in the frequency domain by using the RitzGalerkinNewtonRaphson method in conjunction with IHB method.

A perturbation solution has also been investigated by Chu and Herrmann (1956) where the dynamic wF formulation ( w and Farethedeflectionand stressfunctionsrespectively)wasused.Adoublesineserieswasusedforthe deflectiontermandadoublecosineserieswasusedforthestressfunction term,butonlythefirstmodeshapewasaccountedfor.LynnandKumbasar (1967)usedtheKrylovandBogoliubovmethodtosolvetheintegralequation for the vibration analysis of cracked rectangular plates. Rehfield (1973)

32 Chapter 2: Literature Review appliedHamilton’sprincipleandaperturbationprocedure forthenonlinear free vibrations of beams and rectangular plates. Nayfeh (1979) used the perturbationmethodofmultiplescalestosolvethedifferentialequationsfor symmetricallyexcitedcircularandrectangularplates,anddocumentedthisin thefamousbook NonlinearOscillations .NiyogiandMeyers,in1981,applied theperturbationtechniquetothenonlineardynamicresponseoforthotropic plates and found good agreement with other available numerical results of thetime.Chati etal. ,in1997,usedtheperturbationmethodtopredictthe nonlinearnormalmodesofvibrationandtheassociatedperiodofthemotion in a cracked beam. Teng et al. , in 1999, used the LindstedtPoincaré perturbation method and the Fourier series method for analysing the nonlineardynamicsofasquareplatesubjectedtoblastloading.Resultswere plotted for an exponentially decaying load function at various times, and central deflection and bending moments were noted. Wu and Shih (2005) analyzedthedynamicinstabilityandnonlinearresponseofsimplysupported crackedplatessubjectedtoperiodicinplaneloadbytheuseoftheIHB.

2.7.2 The Method of Multiple Scales

Thehistoryofmultiplescalesismoredifficulttochroniclethan,sayboundary layertheory.Thisisbecausethemethodissogeneralthatmanyapparently unrelatedapproximationproceduresarespecialcasesofit.Onemightargue that the procedure got its start in the first half of the 19th century. For example, Stokes, in 1843, used a type of coordinate expansion in his calculations of fluid flow around an elliptic cylinder. Most of these early effortswerelimited,anditwasnotuntilthelaterhalfofthe19thcentury thatPoincaré,in1886,basinghisideaontheworkofLindstedt(1882),made moreextensiveuseoftheideasunderlyingmultiplescalesinhisinvestigations intotheperiodicmotionofplanets.Hefoundthattheapproximationobtained from a regular expansion accurately described the motion for only a few revolutionsoftheplanet,afterwhichtheapproximationwasincorrect.The error was due, in part, to the contributions of the second term of the expansion.Hereferredtothisdifficultyasthepresenceofasecularterm.To remedy the situation, he expanded the independent variable with the intention of making the approximation uniformly valid by removing the

33 Chapter 2: Literature Review secular term. This idea is also at the heart of the modern version of the method. What Poincaré was missing was the introduction of multiple independentvariablesbasedontheexpansionparameter[Holmes,1995].

VarioussimilarmethodswerelaterrediscoveredbysuchworkersasWhittaker (1914), Schrödinger (1926), and Lighthill (1949) in the contexts of various different applications. Several variants of the method of Lindstedt and Poincaréhavebeenwidelyusedformallyintheapplied literature since the early 1950s. The books by Nayfeh (1973), Nayfeh and Mook (1979), and Kevorkian and Cole (1981) contain numerous references to this literature. ParticularnotecanbemadeoftheworkofSturrock(1957),Kuzmak(1959), Cole and Kevorkian (1963), Cole (1968), and Levey and Mahony (1968), in which multiscale methods were used in the study of various important oscillation problems, although error estimates are not included in these references. Morrison (1966) and Perko (1969) proved a certain equivalence between the twovariable method of Kevorkian and Cole and the averaging methodofKrylov,Bogoliubov,andMitropolsky,therebyprovidingsucherror estimatesindirectly,becausesuchestimateshadbeengivenfortheaveraging methodinBogoliubovandMitropolsky(1961)andPerko(1968)[Smith,1985]. Classical perturbation methods generally break down because of resonances thatleadtowhatarecalledsecularterms.Thefirstschemetoaddressthis problem is what van Dyke (1975) refers to as the method of strained coordinates. Nayfeh (1986) gave an overview of the perturbation methods usedtoobtainanalyticalsolutionsofnonlineardynamicalsystems.

Intermsofuseful,generic,engineeringapplications,themethodofmultiple scalesisusedtostudythelocaldynamicsofweaklynonlinearsystemsabout anequilibriumstate.Toobtainanapproximateanalyticalsolutionofaweakly nonlinear continuous system, one can either directly apply a perturbation method to the governing partial differential equations of motion and boundary conditions, or first discretise the partial differential system to obtainareducedordermodelandthenapplyaperturbationmethodtothe nonlinear ordinary differential equations of the reduced order model. The formerprocedureisusuallyreferredtoasthedirectapproach.Applicationof the method of multiple scales, or any other perturbation method, to the reducedorder model, obtained by the Galerkin, or other discretisation

34 Chapter 2: Literature Review procedures, of a weakly nonlinear continuous system with quadratic nonlinearitiescanleadtobothquantitativeandqualitativeerroneousresults. This is primarily associated with the names of Pakdemirli, Nayfeh S., and Nayfeh (1995), Nayfeh and Lacarbonara (1997), Alhazza and Nayfeh (2001), EmamandNayfeh(2002),andNayfehandArafat(2002).Thedirectapproach iscompletelydevoidofthisproblem.Also,suchaproblemdoesnotexistfor systems with just cubic nonlinearities. Lacarbonara, in 1999, showed that quadratic nonlinearities produce a secondorder contribution from all of the modes to the system response in the case of a primary resonance. Hence, reducedorder discretisation models may be inadequate to describe the dynamics of the original continuous system in the presence of quadratic nonlinearities.Nayfeh,in1998,proposedamethodforconstructingreduced order models of continuous systems with weak quadratic and cubic nonlinearities that overcomes this shortcoming of the discretisation procedures. Application of the method of multiple scales to dynamical systems expressed in secondorder form can lead to modulation equations thatcannotbederivedfromaLagrangianintheabsence of dissipation and externalexcitation,whichiscontrarytotheconservativecharacterofthese dynamical systems. More specifically, this problem is encountered while determining approximate solutions of nonlinear systems possessing internal resonances to orders higher than the order at which the influence of the internalresonancefirstappears,asassociatedwiththeworkofRega etal. , (1999).Interestingly,transformingthesecondordergoverningequationsinto asystemoffirstorderequationsandthentreatingthemwiththemethodof multiplescalesyieldsmodulationequationsderivablefromaLagrangian,and is presented in Nayfeh (2000) and Nayfeh and Chin (1999), and Malatkar (2003).

AccordingtoNayfeh(1973),'themethodofmultiplescalesissopopularthat itisbeingrediscoveredjustaboutevery6months'.YasudaandTorii,in1987, alsousedmultiplescalestoobtaintheoscillationcharacteristicsofasquare membranenearaprimaryresonancewithonenodallineandshowedthatthis methodmatchedexperimentresults.Althoughtosimplifytheanalysis,mode shapescomposedofamultipleoftwosinefunctionswereusedandonlythe (1,2)and(2,1)modeswereaccountedfor.LeeandPark,in1999,investigated

35 Chapter 2: Literature Review aweaklynonlinear,harmonicallyexcited,springpendulumsystem,whichis knowntobeagoodmodelforavarietyofengineeringsystems.Rahmanand Burton, in 1989, proposed a version of the method of multiple scales which can be used to determine the periodic, steady state,primaryresponseofa singledegreeoffreedom,lightlydamped,weaklynonlinear,forcedoscillator. Acomprehensivereviewofthemethodofmultiplescaleshasbeencompiled byCartmell etal. ,in2003,inwhichtheyexaminedtheroleoftermordering, theintegrationofthesmallperturbationparameterwithinsystemconstants, nondimensionalisation and timescaling, series truncation, inclusion and exclusionofhigherordernonlinearities,andtypicalproblemsinthehandling ofsecularterms.Theseauthorsshowedinacomparative example that the formoftheadoptedpowerseriesandtheorderingtermscanhaveamajor bearingonthestructureofthesolution,withclear suggestion for accuracy andphysicalrelevance.Theythengavesuggestionsonhowonecandealwith orderingbybasingitonsomesortofphysicalappreciationoftheproblemin termsofhardandsoftorstrongandweakquantitieswithintheequationof motion such as damping mechanisms, excitation amplitudes, and the coefficientsofnonlinearterms.Atpresent,themethodofmultiplescaleshas been computerised by means of specialised packages within Mathematica™ code constructed by Khanin and Cartmell (1999), Khanin et al. (2000) and Khanin and Cartmell (2001) with parallelisation strategies introduced for reasonsofoptimisation.

2.8 Dynamical Systems and Nonlinear Transitions to Chaos

Chaostheorybeganasafieldofphysicsandmathematics dealing with the structure of turbulence and the selfsimilar forms of fractal geometry. It stems, in part, from the work of Edward Lorenz, in 1960, of MIT, a meteorologist,whosimulatedweatherpatternsonacomputer.Thetheoryof chaos brings the principles of quantum physics to the pragmatic world. At present,itisrelativelyeasytomapchaoticbehaviourbytheuseofvarious availablesoftware.Thenewlydiscoveredunderlyingordertochaossparked new interest and inspired more research in the field of chaos theory. The recentfocusofmostoftheresearchonchaostheoryis specifically on non

36 Chapter 2: Literature Review equilibriumstatisticalmechanicsanditsapplicationstoquantumsystems,and inparticulartonanosystems.

The founder of geometric dynamics is universally acknowledge to be Henri Poincaré (1854–1912), who alone among his contemporaries saw the usefulnessofstudyingtopologicalstructureinthephasespaceofdynamical trajectories.ThetheoreticalfoundationslaidbyPoincaréwerestrengthened byG.D.Birkhoff(1844–1944);but,apartfromafew instances such as the stability analysis of Lyapunov, Poincaré’s ideas seemed to have had little impactonapplieddynamicsforalmosthalfacentury. In 1927, Van der Pol andVanderMarkreportedirregularnoiseinexperimentswithanelectronic oscillator. It has been well mentioned that chaotic vibrations occur when somestrongnonlinearityexits.Someexamplesofnonlinearitiesthatcanbe observedinmanyphysicalsystemsare;nonlinearelasticorspringelements, damping,boundaryconditionsetc.Inmechanicalcontinua,nonlineareffects arise from a number of different sources which includes kinematics, constitutiverelations,boundaryconditions,nonlinearbodyforces,geometric nonlinearities associated with large deformations in structural solids. [Thompson(1986),andMoon(1987)]

Wolf etal. ,in1985,presentedatechniquewhichestimatedthenonnegative Lyapunov exponents from experimental data. Lyapunov exponents are the average exponential rates of divergence or convergence of nearby orbits in phasespace.Theyarepositiveforchaos,zeroforamarginallystableorbit, andnegativeforaperiodicorbit.Itmeansthatanattractorforadissipative systemwithoneormorepositiveLyapunovexponentsissaidtobestrangeor chaotic. Wolf et al. tested this method on famous model systems such as thoseofHénon(1976),Rössler(1976),Lorenz(1989),theRösslerhyperchaos (1979) problem and MacKeyGlass (1997) with known Lyapunov spectra and observed that deterministic chaos can be distinguished in some cases from externalnoiseandtopologicalcomplexity.

TheworkbyMaestrello,FrendiandBrownin1992demonstratedthenonlinear vibrationandnonlinearacousticradiationofatypicalaircraftfuselagepanel forced by plane acoustic waves at normal incidence, and investigated their findingbothexperimentallyandnumerically.Numerically,thenonlinearplate

37 Chapter 2: Literature Review equationswereintegratedthroughtheuseofanapproximate method. The motionnormallystartsperiodicallyandeventuallybecomeschaoticwithtime by the increase of the pressure level. A good agreement between the experimentalandnumericalresultswereobtained,whichshowedthatwhena panel is excited at a resonant frequency by plane acoustic waves, linear, nonlinearandchaoticresponsescanbeobtainedbychangingtheintensityof the loading. Guitiérrez and Iglesias, in 1998, introduced a Mathematica™ package for analyzing discrete and continuous systems, and much of the attentionwasfocusedoncontrollingthechaoticbehaviourofthesesystems. This program is capable of obtaining the periodic points and the stability regions of nonlinear systems, as well as bifurcatory analysis and Lyapunov exponents. These author’s results showed a good numerical results for the logistic and Hénon maps as well as for the Duffing and Rössler systems. Alighanbari and Hashemi, in 2003, reformulated the integrodifferential aeroelastic equations of motion for an airfoil in an investigation of the potential nonlinear dynamical behaviour of the model. The bifurcation analysiswasperformedfortheairfoilcontaininga cubic nonlinearity in the pitchstiffnessundertheactionofatwodimensionalincompressibleflow.An approximatetechniqueintheformoftheDefectControlledMethodandAUTO softwarepackagewereemployedfortheanalysis.Lyapunovspectrawerealso calculated to predict and confirm the chaotic behaviour of the airfoil. The result showed good agreement between two methods. Xiao et al. , in 2006, derivedthenonlinearequationsofmotionbasedonReissnerplatetheoryand theHamiltonvariationalprincipleformoderatethickness rectangular plates withtransversesurfacepenetratingcracksonanelasticfoundation,underthe action of external excitation and from these they investigated the bifurcations and chaotic motion. These nonlinear equations were solved by theuseoftheGalerkinandtheRungeKuttaintegration techniques. It was seenfromtheseresultsthattheplate’smotionbifurcatedandthenmovedto more complex motions with the increase of external excitation amplitude. ThePoincarémapsshowedadoubleperiodmotionforanondimensionalised crack position of 0.1 and crack depth of 0.3, and this turned into chaotic motionwiththeincreaseinnondimensionalisedcrackposition.

38 Chapter 3: Formulation of Cracked Plates

Chapter 3

FORMULATION OF CRACKED PLATES

______

Inthischapter,wederivetheequationofmotionforagivensetofboundary conditions governing the nonlinear vibrations of an isotropic plate with an arbitrarilylocatedpartthroughcrackatthecentreoftheplate,consistingof a continuous line. The equilibrium principle is followed to derive the governing equation of motion in order to get a tractable solution to the vibration problem. Principally, the effects of rotary inertia and through thickness shear stress are neglected. Galerkin’s method is applied to reformulatethegoverningequationofthecrackedplatesintotimedependent modal coordinates. The simplifying assumptions, and their validity, are describedasandwhentheyaremadeduringthederivationoftheequations. Berger’sformulationisusedtogeneratetheformfortheinplaneforcesand makethemodeldifferentialequationofmotionnonlinear.

3.1 Governing Equation of Cracked Rectangular Plate

Theclassicalformofthegoverningequationofrectangularplateisrigorously treatedbyTimoshenko(1940),Leissa(1993),andSzilard (2004), and so, by neglectingtheeffectofrotaryinertiaandthroughthicknessshearforces,it canbestatedthat:

∂∂∂444  ∂∂∂ 222 ∂ 2 www+ +=−ρ www + + + w + D2  hnnnPx y2 xy z . ∂∂∂∂xxyy4224  ∂ t 2 ∂ x 2 ∂ y 2 ∂x ∂ y (3.1-1)

where w isthetransversedeflection, Pz istheloadperunitareaactingat ρ thesurface, isthedensity, h isthethicknessoftheplateand nx , ny , nxy aretheinplaneormembraneforcesperunitlength. D istheflexuralrigidity

39 Chapter 3: Formulation of Cracked Plates andcanbedefinedas D= Eh 312(1 − υ 2 ) ; E isthemodulusofelasticity,and υ isthePoisson’sratio.

Initially,thederivationofthegoverningequationoftheplatehavingapart throughcrackconsistingofacontinuouslineoflength2 awhichislocatedat thecentreandparalleltothe xdirectionoftheplateasdepictedinFigure3 1 is performed by considering that the cracked plate is linear with the following basic assumptions. Later, the governing equation of the cracked plate transforms into nonlinear form by the application of Berger’s formulation.

1. The plate is made of a perfectly elastic, homogeneous, isotropic material and has a uniform thickness h which is considered small in comparisonwithitsotherdimensions.

2. AllstraincomponentsaresmallenoughtoallowHooke’slawtohold.

3. Thenormalstresscomponentinthedirectiontransverse to the plate surface is small compared with other stress components, and is neglectedinthestressstrainrelationship.

4. Shear deformation is neglected in this case and it is assumed that sectionstakennormaltothemiddlesurfacebeforedeformationremain planeandnormaltothedeflectedmiddlesurfaceoftheplate.

5. Theeffectoftherotaryinertia,shearforcesandinplaneforceinthe

ydirectioni.e. ny and nxy areneglectedmainlytomaketheproblem moretractable.

h  Forrelativelythickplates > 20  ,where histheplatethicknessand lisan l  average length in its plane, the effects of shear deformation and rotary inertia become significant, as explained by Leissa (1978). Moreover, in vibration problems, the effect of rotary inertia and shear deformation corresponding to higher modes are more pronounced than on those corresponding to lower modes, and also yields mathematical complexity. In

40 Chapter 3: Formulation of Cracked Plates thepresentmodel,thefirstmodeisdiscussedinmoredetail,thereforethe assumptionmadethattheeffectoftherotaryinertia,andshearforcesare bothnegligibleisapplicableinthesubsequentderivation.

The equilibrium equations are obtained by resolving the forces in the z directionandtakingmomentsaboutthe x and yaxes.Theforcesactingon theplateelementareshowninFigure31.

Summingtheforcesalongthe zaxisleadsto,

∂Q ∂Q ∂2 =−++x −++y + = ρ w ∑Fzxx0;()() Qdy Q dxdyQdx yy Q dydx Pdxdy z h dxdy , ∂x ∂ y ∂ t 2 (3.1-2)

where Qx and Qy aretheforcesperunitlengthwhichareprojectedalongz ρ direction, isthedensity, h isthethicknessand Pz istheloadperunitarea actingoverthesurfaceoftheplate.

Later,this Pz isreplacedbyapointload Pz basedontheapplicationofthe appropriatedeltafunctioninequation(3.48)tomakeitcompatiblewiththe experimentalconfiguration.Furthermore,inpractice,itisstraightforwardto implementthistypeofloading.

O x dx z, w Qy + My M y y M Qx yx

Mxy ∂ dy Pz Mxy Mx M+ dx xy ∂x ∂ + Mx Mx dx ∂x h / 2 ∂Q Q+ x dx h / 2 x ∂x ∂ ∂ Myx Qy M+ dy Middle surface Q+ dy yx ∂ y ∂y y ∂M ∂ M M+y dy + M + y dy Crack of length 2 a y∂y y ∂ y Figure 3-1: Isotropic plate loaded by uniform pressure and a small crack at the centre

41 Chapter 3: Formulation of Cracked Plates

Therefore, ∂Q ∂Q ∂2w x +y =ρh − P . (3.1-3) ∂x ∂ y ∂ t 2 z

Themomentequilibriumaboutthe yaxisgives,

∂M ∂M =−++x − ++ yx ∑My0; Mdy x ( M x dxdyMdx ) yx ( M yx dydx ) ∂x ∂ y (3.1-4) ∂Q dx dx −+(Qx dx ) dyQdy − = 0. x∂x 2 x 2

1 ∂Q Aftersimplification,thetermcontaining y (dx ) 2 dy isneglected,sinceitis 2 ∂x asmallquantityofhigherorder.Therefore,

∂M ∂M x +yx = Q , (3.1-5) ∂x ∂ y x andhence, ∂2M∂2M ∂ Q x+yx = x . (3.1-6) ∂x2 ∂∂ yx ∂ x

Similarly,themomentequilibriumaboutthe xaxiscanbewrittenas,

∂M ∂ M ∑M=0;() M + MdxM −+ (y dyM ++ y dydxMdy ) − x yyy∂y y ∂ y xy (3.1-7) ∂M ∂ Q dy dy ++(Mxy dxdy )( ++ Q y dy ) dxQdx + = 0. xy∂x y ∂ y 2 y 2

1 ∂Q Aftersimplification,thetermcontaining y (dy ) 2 dx isneglected,sinceitis 2 ∂y asmallquantityofhigherorder.Therefore,

∂M ∂ M ∂ M −y − y + xy =− Q , (3.1-8) ∂y ∂ y ∂ x y andso, ∂2M ∂ 2 M ∂ 2 M ∂ Q (3.1-9) −y − y + xy =− y . ∂y2 ∂ y 2 ∂∂ xy ∂ y

42 Chapter 3: Formulation of Cracked Plates

where My is the bending moment per unit length due to the crack at the centreoftheplateandthisistreatedlaterinsection3.3.Now,substituting equations(3.16)and(3.19)intoequation(3.13),gives,

∂2M ∂2M ∂ 2 M ∂ 2 M ∂2w x +2 xy ++= y y ρh − P (3.1-10) ∂x2 ∂∂∂ xyy 222 ∂ y ∂ t z

where Mx , My and Mxy arethebendingmomentsperunitlengthalongthex and ydirectionsandcanbedefinedas

h / 2 = σ Mx∫ x Zdz (3.1-11) −h / 2

h / 2 = σ My∫ y Zdz (3.1-12) −h / 2 and, h / 2 = τ Mxy∫ xy Zdz (3.1-13) −h / 2

σ σ τ Also, x , y and xy arethestressesalongthe xand ydirectionsoftheplate andthesecanbewrittenas

∂2 ∂ 2  σ= −EZ w + υ w x   (3.1-14) 1−υ 2 ∂x 2 ∂ y 2 

∂2 ∂ 2  σ= −EZ w + υ w y   (3.1-15) 1−υ 2 ∂y 2 ∂ x 2 

and, EZ∂2 w τ=()1 − υ (3.1-16) xy 1−υ 2 ∂x ∂ y

σ σ τ Substitutingthequantities x , y and xy fromequations(3.114),(3.115) and (3.116) into equations (3.111), (3.112) and (3.113) respectively, we getthefollowingformof Mx , My and Mxy ,

43 Chapter 3: Formulation of Cracked Plates

∂2 ∂ 2  = −w + υ w Mx D   (3.1-17) ∂x2 ∂ y 2 

∂2 ∂ 2  = −w + υ w My D   (3.1-18) ∂y2 ∂ x 2  and, ∂2w M=− M =− D ()1 − υ (3.1-19) xy yx ∂x ∂ y where D istheflexuralrigidityandcanbestatedas D= Eh 3/12(1 − υ 2 ) ; E is themodulusofelasticity,and υ isthePoisson’sratio.

Expressing the moments in terms of the curvatures, as given in equations (3.117),(3.118)and(3.119)to(3.110),leadstothefollowingresult,

∂4 ∂∂ 44  ∂ 2 ∂2M w+ ww + =−ρ w +y + D2  h P z. (3.1-20) ∂x4 ∂∂∂ xyy 224  ∂∂ t 2 y 2

3.2 Addition of In-plane or Membrane Forces

Inplane forces occur when the displacements of the plate parallel to its middle surface are constrained by the supports, and we naturally assume smalldisplacementsthroughout.Occasionally,membraneforcesapplyatthe boundaries and are usually caused by temperature variations, prestressing andlargedeflection.Themagnitudeofthemembraneforcesareafunctionof theboundaryconditions.Thisiseasilyvisualisedbyconsideringtwodifferent plates,oneclampedalongitsedgestopreventanytranslationorrotationand theothersimplysupportedalongitsedgesallowingonlyrotation.Forequal maximumdisplacements,thedeflectedsurfacelengthoftheclampedplateis greaterthanthatofthesimplysupportedplate,resultinginhighermembrane forces.

ConsideringtheequilibriumofthedxdyelementinFigure32,andgiventhat = it is subjected toinplane forces nx , ny , nxy n yx and ny (caused by the crackatthecentreoftheplate)perunitlength,thensincetherearenobody

44 Chapter 3: Formulation of Cracked Plates forces, the projection of the membrane forces on the xaxis leads to the following,

∂n ∂n −++ndy( nx dxdy ) −++ ndx ( nyx dydx ) = 0, (3.2-1) x x∂x yx yx ∂ y

Therefore, ∂n ∂n x +yx = 0. (3.2-2) ∂x ∂ y

O x z, w dx

y n dx + yx (ny n y ) dx Crack of length 2 a nxy dy ∂  dy + nx nx dx  dy ∂x  nx dy

∂n  h + xy nxy dxdy  ∂x 

∂n  ∂n ∂ n  + yx +y + + y nyx dy  dx ny dyn y dydx  ∂y  ∂y ∂ y 

Figure 3-2: In-plane forces and a crack of length 2a at the centre of the plate element

Similarly,alongthe yaxiswefindthat,

∂n ∂ n  ∂ n −−++y ++ y −++xy = ()ny ndx y n y dyn y dydxndy  xy n xy dxdy 0. ∂y ∂ y  ∂ x (3.2-3) leadingto, ∂n ∂ n ∂ n y+ y + xy = 0 (3.2-4) ∂y ∂ y ∂ x

Theequilibriumofthedxdyelementinthe zdirectionisconsiderednext.Itis arbitrarilyassumedthatthelefthandandrearedgesoftheplateelementare fixedandlieinthe xy plan,asshowninFigure33.Otherboundaryconditions areequallypossible.

45 Chapter 3: Formulation of Cracked Plates

∂n  ∂2 w ∂n ∂ n  ∂ 2 w ∑Fxy( , ) =+ nx dxdy  dx ++ ny dyn ++ y dydx  dy z x ∂∂xx  2 y ∂ y y ∂∂ yy  2 ∂n  ∂2w ∂ n  ∂ 2 w ++nxy dxdy  dx ++ nyx dydx  dy , xy ∂x  ∂∂ xyyx ∂ y  ∂∂ yx (3.2-5)

So,afterneglectinghigherorderquantities,weobtain,

∂2w ∂ 2 w ∂ 2 w ∂ 2 w ∑Fxyn(,)= + n + n + 2. n (3.2-6) z x∂x2 y ∂ y 2 y ∂ y 2 xy ∂∂ xy

O x dx z, w + (ny n y ) dx y nyx dx

n dy ∂2w xy ∂2w dx dx ∂ 2 ∂x ∂ y x dy n dy ∂2w x dy ∂  ∂ ∂ + nx x y nx dxdy  ∂x  ∂n  ∂2 + xy w nxy dxdy  dy ∂x  ∂y2 h ∂n ∂ n  n+y dy + n + y dy  dx ∂n  Crack of length 2 a y∂ y ∂  + yx y y  nyx dy  dx ∂y 

Figure 3-3: Two sided constraints and plate deformation having a part-through crack at the centre

Thus, it can be deduced from equation (3.26) that the effect of the membraneforcesonthedeflectionisequivalenttoanassumedlateralforce, denoted here by Fz ( x , y ) . Adding this to the lateral forces in the governing equation, and noting that this force acts just in the xdirection, then the termsinthe yand xy directionscanbeneglected;leadingtothefinalversion ofequation(3.120)whichnowtakesthefollowingform:

∂∂∂444  ∂∂ 22∂2M ∂ 2 www+ +=−ρ ww + ++y w + D2  hnx nP y z . (3.2-7) ∂∂∂∂xxyy4224  ∂ t 2 ∂∂ xy 22 ∂ y 2

Equation(3.27)istheequationofmotionforthecrackedvibratingplate,and = forthecaseoffreevibration Pz 0 .Thevalueof w shouldbesuchthatit mustsatisfytheboundaryconditionsattheedgesoftheplate.

46 Chapter 3: Formulation of Cracked Plates

3.3 Crack Terms Formulation

Machinesandstructuralcomponentspotentiallyrequirecontinuousmonitoring forthedetectionofcracksandcrackgrowthforensuring an uninterrupted service in critical installations. Cracks can be present in structures due to various reasons such as impact, fatigue, corrosion and external and environmental factors like temperature, relative humidity, rainfall and the general properties of structures. Complex structures such as aircraft, ships, steel bridges, sea platforms etc., all use metal plates. The presence of a crackdoesnotonlycausealocalvariationinthestiffness,butcanaffectthe mechanicalbehaviouroftheentirestructuretoaconsiderableextent.Cracks presentinvibratingcomponentscanleadtocatastrophicfailure.[Neogyand Ramamurti (1997), Ramamurti and Neogy (1998), Trendafilova (2005), Trendafilova etal. (2006)].Forthesereasons,thereisaneedtounderstand thedynamicsofcrackedstructures.Thevibrationcharacteristicsofstructures canbeusefulforonlinedetectionofcrackswithoutactuallydismantlingthe structure.Inparticular,thenaturalfrequenciesandmodeshapesofcracked platescanprovideinsightsintotheextentofdamage.

In the present theory, the Rice and Levy (1972) model is used for the formulationofthecrackterms.ThisapproachisbasedonKirchoff’sbending theoryforthinplatesandshells.Theassumptionsinvolvedinthistheorylead toimportantsimplificationsinthegoverningequations. Accurate values for thestressintensityfactorsinpartthroughcrackedplatescanbecalculated, providedthatthecrackisnottoodeep.RiceandLevy, 1972, obtained an approximaterelationshipbetweennominaltensileandbendingstressesatthe location of the crack. These two relations are taken after some rearrangement,andthenbymakinguseoftherelationshipswithinequations = σ (3.38)and(3.39)itcanbeshownthat mrs6 rs .Arepresentationofthese stressesisgiveninFigure34.

2a σ= σ , rs αo+ α o − υ 2 + rs (3.3-1) ()6tb tt (1 )h 2 a

47 Chapter 3: Formulation of Cracked Plates and, 2a m= m . rs α o  rs bt +αo +−+ υ υ (3.3-2) 3bb  (3 )(1 )h 2 a 6 

σ We define rs and mrs as the nominal tensile and bending stresses σ respectively,atthecracklocationandonthesurfaceoftheplate, rs and

mrs arethenominaltensileandbendingstressesatthefarsidesoftheplate, α o α o h is t hethicknessoftheplate, a isthehalflengthofthecrack,and bb , tt , αo= α o bt tb arethenondimensionalbendingcompliance,stretchingcompliance and stretchingbending compliance coefficients at the crack centre, respectively.

O x σ rs y m rs

2a

mrs σ rs

Figure 3-4: Line Spring Model (LSM) representing the bending and tensile stresses for a part-through crack of length 2 a, after Rice and Levy, 1972

Theserelationshipsshowthatthenominaltensileandbendingstressesatthe crack location can be regarded as a function of the nominal tensile and bendingstressesatthefarsideoftheplate.ItisworthnotingthatOkamura etal. (1969)andKhademandRezaee(2000)alsorestrictedtheiranalysisto theeffectsofbendingcompliance,andthusavoidedthecouplingeffectby ignoring the stretching compliance. These three compliance coefficients dependuponthecrackdepth d toplatethickness h andvanishwhen d = 0 . It has been shown by Rice and Levy (1972) thatin general the compliance coefficientisafunctionoftheratioofcrackdepthtoplatethickness,andcan becalculatedas:

48 Chapter 3: Formulation of Cracked Plates

α= αo −2 λµ = λµ ()Xλµ 1 X ;, bt , (3.3-3)

= where X x1 a is a dimensionless variable introduced for simple approximation. x1 showsthevaluesalongcracklengthand a isthehalfcrack length.Also, λ, µ = b , t areintermediatevariablesproposedbyRiceandLevy, = 1972, for algebraic simplification. Let set x1 a 2 then the dimensionless compliancecoefficientatthecentreofthecrackedplatetakesthisform,

αo = α λµ 1.1547λµ , (3.3-4)

Theappropriatecompliancecoefficients, αλµ , may then be calculated from thefollowingrelation,notingthattheseequationswereoriginallypresented asbeingfortherange 0<ζ =d / h < 0.7 [Okamura etal. (1969),RiceandLevy (1972), and Khadem and Rezaee (2000)]. In the present analysis, we take ζ = 0.6 ,leadingtocalculationofthecompliancecoefficientsasfollows:

1.98− 0.54ζ1 + 18.65 ζ 2 − 33.70 ζ 3 + 99.26 ζ 4  α= ζ 2   , (3.3-5) tt  5 6 7 8   −211.90ζ + 436.84 ζ − 460.48 ζ + 289.98 ζ 

1.98− 3.28ζ1 + 14.43 ζ 2 − 31.26 ζ 3 + 63.56 ζ 4  α= ζ 2 bb   , (3.3-6) −103.36ζ5 + 147.52 ζ 6 − 127.69 ζ 7 + 61.50 ζ 8  and, 1.98− 1.91ζ1 + 16.01 ζ 2 − 34.84 ζ 3 + 83.93 ζ 4  α= α = ζ 2 bt tb   . (3.3-7) −153.65ζ5 + 256.72 ζ 6 − 244.67 ζ 7 + 133.55 ζ 8 

Thismeansthatuniformlydistributedtensileandbendingstressesareatthe twosidesofthecracklocation,andthesetensileandbendingstressescanbe expressed in term of tensile and bending force effects. Therefore, we can write the tensile and bending stresses at the far sides as, [Rice and Levy, 1972],

+ n 1 h / 2 (3.3-8) σ=rs = τ rs∫ rs (,,)x y z dz , h h −h / 2

49 Chapter 3: Formulation of Cracked Plates

+h / 2 =6 = 6 τ mrs2 M rs 2 ∫ zxyzdz rs (,,) , (3.3-9) h h −h / 2 where r, s = 1,2 are intermediate variables required for algebraic simplification. nrs and Mrs aretheforceandmomentperunitlengthinthe y τ directionatthefarsidesoftheplate,respectively,and rs (x , y , z ) isthestress state. Subsequently, the force and moment were calculated from two dimensional plane stress plate bending theory, with the cracked section representedasacontinuouslinespringhavingitscompliancematchedtothat oftheedgecrackedstripinplanestrainasshowninFigure34.Accordingly, wecanwriteequations(3.31)and(3.32)intheformofforceandmoment as,

2a n= n , rs αo+ α o − υ 2 + rs (3.3-10) ()6tb tt (1 )h 2 a and, 2a M= M , rs α o  rs bt +αo +−+ υ υ (3.3-11) 3bb  (3 )(1 )h 2 a 6 

where nrs and Mrs are the force and moment per unit length in the y directionatthecracklocationoftheplate,respectively.

ItisevidentfromtheworkofRiceandLevy(1972)thatwhentwoforcesare actingontheplateelementtostretchandbendit,theresultsoftheirwork show that the Airy stress function satisfies the compatibility condition in a regionwherethebodyforcefieldiszero.Here,itisveryusefultomention thatthepresenttheory,andthemodelofRiceandLevy,arebothbasedon classical plate theory; therefore the force and moment obtained from equations(3.310)and(3.311)aretherequiredtermsandareaddedintothe crackedplatemodelwithanegativesignbecausedamagecausesareduction intheoverallstiffnessoftheplatestructure,aphenomenonwhichcanalso beseeninmostoftheliterature,suchasthatofKeerandSve(1970),Stahl andKeer(1972),Solecki(1983),andKhademandRezaee(2000).Therefore, wecanwrite,

50 Chapter 3: Formulation of Cracked Plates

2a n≡− n =− n , y rs αo+ α o − υ 2 + rs (3.3-12) ()6tb tt (1 )h 2 a and, 2a M≡− M =− M , y rs α o  rs bt +αo +−+ υ υ (3.3-13) 3bb  (3 )(1 )h 2 a 6 

Substituting the values of ny and My from equations (3.312) and (3.313) intoequation(3.27),sothegoverningequationoftheplatewithacrackat thecentreextendstothefollowingform,

∂4wwwww ∂∂ 44  ∂ 2 ∂ 2 2 a ∂2M D+2 +  =−ρ hnP + +− rs ∂x4 ∂ x 2 ∂ y 2 ∂ y 4 ∂ t 2x ∂ x 2 z α o  ∂ y 2   bt +αo +−+ υ υ 3bb  (3 )(1 )h 2 a 6  2a∂2 w − n . αo+ α o − υ 2 + rs ∂ 2 ()6tb tt (1 )h 2 a y (3.3-14)

Asthebendingstressesatthefarsidesoftheplatearedefinedby,

∂2 ∂ 2  = −w + υ w Mrs D   , (3.3-15) ∂y2 ∂ x 2  then equation (3.315) can be substitutedintoequation (3.314) to get the finalform,

∂4 ∂∂ 44  ∂ 2 ∂ 2 w+ ww + =−ρ w + w + D2  hnPx z ∂x4 ∂∂∂ xyy 224  ∂ t 2 ∂ x 2 ∂4w ∂ 4 w  2aD +υ  (3.3-16) ∂y4 ∂ y 2 ∂ x 2  2a∂2 w + − n . α o  ()6αo+ α o (1 − υ 2 )h + 2 a rs ∂y 2 bt +αo +−+ υ υ tb tt 3bb  (3 )(1 )h 2 a 6 

3.4 Galerkin’s Method for a Vibrating Cracked Plate

Solutionsbasedonlinearmodelsareconsideredadequateformanypractical andengineeringpurposesalthoughitisrecognized that linearised equations

51 Chapter 3: Formulation of Cracked Plates usually provide no more than a first approximation. Linearised models of vibratingsystemsareinadequateincaseswheredisplacementsarenotsmall. Inaddition,problemstreatedbynonlineartheoryexhibitnewphenomena,for examplethedependenceoffrequencyofvibrationonamplitudethatcannot be predicted by means of linear theories. Moreover, an example of such a sourceofnonlinearityisacrackwithinaplate,whichcanleadtoprofound changesinthevibrationalresponseofthesystem.

O l1 x

yo

l2 Pz

xo

h y z, w Crack of length 2a

Figure 3-5: Isotropic plate loaded by arbitrary located concentrated force and small crack at the centre, and parallel to the x-axis

Galerkin’s Method is applied to reformulate the governing equation of the cracked plate intotime dependent modal coordinates by the application of given boundary conditions, and Berger’s formulation is used to express formally the inplane forces, which can then be used to transform the governingequationofthecrackedplateintoanonlinearsystem,whichiswell explained in the following section. To accomplish this we consider the rectangularplateofFigure35,oflength l1 inthe xdirectionand l2 inthe y directioncontainingacrackwhichconsistsofacontinuouslineoflength2 a locatedatthecentreandparalleltothe xdirectionoftheplate.Apointload

Pz based on the application of the appropriate delta function (in equation

(3.48))isintroducedatthearbitrarylocationof (xo , y o ) .

Thesolutionforthegoverningdifferentialequationoftheplatesubjectedto transverse loading is obtained by defining the characteristic functions

52 Chapter 3: Formulation of Cracked Plates depending upon the boundary conditions of the plate. The basic model for solutionistheoneinwhichalledgesaresimplysupported,whileforother boundaryconditionstheprincipleofsuperpositionholds[Timoshenko(1940), andBerthelot(1999)].Themostgeneralformofthetransversedeflectionof theplateis,

∞ ∞ wxyt(,,)= AXYψ (), t (3.4-1) ∑n=1 ∑ m = 1 mn m n mn

where Xm and Yn arethecharacteristicormodalfunctionsofthecracked ψ rectangular plate, Amn is an, as yet, arbitrary amplitude and mn (t ) is the timedependentmodalcoordinate.

The appropriate expressions for the characteristic or modal functions are givenbelowandsatisfythestatedboundaryconditionsoftheplate.Forall cases l1 and l2 are the lengths of the sides of the plate along the x and y directionsrespectively.Threeboundaryconditioncasesaregivennext.These boundaryconditionshavebeentreatedbydifferentresearchers,andafewof themareasfollows:Thecaseinwhichtwoadjacentedgesareclampedwhile theothertwoedgesarefree(CCFF)wasexaminedby Thimoshenko (1940), Young(1950),NagarajaandRao(1953),inthemonograph of Leissa (1993), andBerthelot(1999).Theconditioninwhichtwoadjacentedgesareclamped whiletheothertwoedgesaresimplysupported(CCSS)wasexaminedbyIwato (1951),andtheoneinwhichallsidesaresimplysupported(SSSS)wasstudied bySzilard(2004),andYagizandSakman(2006).

Boundary Condition 1 .Twoadjacentedgesareclampedwhiletheothertwo edgesarefree–CCFF

λx  λ x  λ x  λ x  =m − m −γ m − m Xm cos cosh m  sin  sinh   , (3.4-2) l1  l 1  l 1  l 1 

λy  λ y  λ y  λ y  =n − n −γ n − n Yn cos cosh n  sin  sinh   . (3.4-3) l2  l 2  l 2  l 2 

53 Chapter 3: Formulation of Cracked Plates

λ γ The m, n and the m, n are the mode shape constants and can be found in standardreferencetextsuchasLeissa(1993),andBerthelot(1999).

Boundary Condition 2 .Twoadjacentedgesareclampedwhiletheothertwo edgesarefreelysupported–CCSS

∞ ∞ mxmxππ1 mx π 3 mx π  X =sin sin = cos − cos , m ∑m=1 ∑   (3.4-4) ll1122m=1 2 l 1 2 l 1 

∞ ∞ nynyππ1 ny π 3 ny π  Y =sin sin = cos − cos . n ∑n=1 ∑   (3.4-5) ll2222n=1  2 l 2 2 l 2 

Boundary Condition 3 .Allsidesaresimplysupported–SSSS

∞ mπ x  X = sin , m ∑m=1   (3.4-6) l1 

∞ nπ y  Y = sin . n ∑n=1   (3.4-7) l2 

The lateral load Pz at position (xo , y o ) can be readily expressed as follows [Fan,2001]

=δ − δ − Pzo Pt()( xx o )( yy o ) . (3.4-8)

Substituting the definition of w( xyt , ,) from equation (3.41) and Pz from equation(3.48)intoequation(3.316)andrearrangingtheterms,weget,

 ∂4XXYYX ∂ 4 ∂ 4 ∂ 2 2a ∂ 2 Y   mY+2 m n + n XnY − m + nXn  ∂∂∂∂∂4n 2 2 4 m x 2 n αo+ α o − υ 2 + rs ∂ 2 m  xxyyx()6tb tt (1 )h 2 a y    4 4 ψ D  2a ∂Y ∂ X Y   Amn ( t ) − Dn X + υ m n  4m 2 2   α o  ∂y ∂ y ∂ x   3bt +αo (3 +−+ υ )(1 υ )h 2 a   bb    6   ∂2ψ (t ) = −ρh AXY + Pt( ) δ(xx− ) δ ( yy − ). ∂t 2 mn m n o 0 o (3.4-9)

54 Chapter 3: Formulation of Cracked Plates

In1955,Bergerdeterminedthedeflectionofaplatebyneglectingthestrain energyduetothesecondinvariantofthemiddlesurfacestrainsandwhenthe deflectionisoftheorderofmagnitudeofthethicknessoftheplate.Thiscan beusedtoobtainformsfortheinplaneforces nx and nrs perunitlengthin the x and ydirectionrespectively.Bergershowedthatthisapproach works wellforcombinationsofsimplysupportedandclampedboundaryconditions. WenoteinpassingthatWah,in1964,andRamachandranandReddy,in1972, also applied Berger’s formulation efficiently for analysing the nonlinear vibrationsofundampedrectangularplates.

To derive the inplane forces, the middle surface strains in the x and y directionscanbetakenasgivenby[Timoshenko,(1940)],

∂ ∂ 2 ε =u + 1  w  x   , (3.4-10) ∂x2  ∂ x 

2 ∂v1  ∂ w  ε = +   , (3.4-11) y ∂y2  ∂ y  where uand varethedisplacementsinthe xand ydirectionsrespectively.

Accordingly,wecanwritetheinplaneforcesas,[Timoshenko,(1940)],

Eh n =()ε + υε , (3.4-12) x1−υ 2 x y

Eh n =()ε + υε . (3.4-13) rs1−υ 2 y x

Substitutingequations(3.410)and(3.411)intoequations(3.412)and(3.4 13),weget,

2 n h 2 ∂∂uv1 ∂ w  2 1  ∂ w  x =+υ +  + υ   , (3.4-14) 12Dxy∂∂ 2 ∂ x  2  ∂ y  andthereforefor y,

55 Chapter 3: Formulation of Cracked Plates

2 n h 2 ∂∂vu1 ∂ w  1  ∂ w  2 rs =+υ +  + υ   . (3.4-15) 12Dyx∂∂ 2 ∂ y  2  ∂ x 

Wemultiplyequations(3.414)and(3.415)bydxdyandintegrateoverthe platearea,andthenimposetheconditionsthat uand vvanishattheexternal boundariesandaroundthecrackduetosymmetry,leadingto,

2 l1 l 2 2 n h2 ll 1 ∂w   ∂ w   x 1 2 =  + υ    dxdy , (3.4-16) 12D 2 ∫∫ ∂ x ∂ y 0 0     

2 and, l1 l 2 2 n hll2 1 ∂w   ∂ w   rs 1 2 =  + υ    dxdy . (3.4-17) 12D 2 ∫∫ ∂ y ∂ x 0 0     

Applyingthedefinitionof w( xyt , ,) fromequation(3.41)weget,

= 2ψ 2 nx DF1 mn A mn mn ( t ) , (3.4-18)

where the quantity Amn is a modal peak amplitude function,normalisedin thiscasetounity,

2 2 l1 l 2   6 ∞ ∞ ∂X   ∂ Y  =m2 + υ n 2 F1mn ∑ ∑   Yn  Xdxdy m  , (3.4-19) hll2 n=1 m = 1 ∫∫ ∂ x ∂ y 1 2 0 0      and, = 2ψ 2 nrs DF2 mn A mn mn ( t ), (3.4-20)

2 2 where l1 l 2   6 ∞ ∞ ∂Y   ∂ X  =n2 + υ m 2 F2 mn ∑ ∑   Xm  Ydxdy n  . (3.4-21) hll2 n=1 m = 1 ∫∫ ∂ y ∂ x 1 2 0 0     

Substitutingtheinplaneforces nx and nrs fromequations(3.418)and(3.4 20) into equation (3.49), multiplying each part of equation (3.49) by the modalfunction Xm and Yn foroneofthethreeexampleboundaryconditions mentionedabove,andthenintegratingovertheplatearea,wefindthat,

56 Chapter 3: Formulation of Cracked Plates

ψ+ ψ + ψ 3 = Mmnɺɺ mn() tK mn mn () tG mn mn () tP mn . (3.4-22)

where l1 l 2 ρh ∞ ∞ M= A XYdxdy2 2 , (3.4-23) mn∑n=1 ∑ m = 1 mn∫∫ m n D 0 0

   iv  l1 l 2 ′′ ′′ ∞ ∞ 2a()υ XY+ YX = iv ++−′′ ′′ iv mn n m  KAXYXYYXmn∑ ∑ mn m n2 m n n m Xm Y n dxdy , n=1 m = 1 ∫∫  α o   0 0  3bt +αo (3 +−+ υ )(1 υ )h 2 a   bb    6   (3.4-24)

l1 l 2  2  ∞ ∞ 2aF X YY ′′ =3 −′′ 2 + 2 mn m n n  Gmn∑= ∑ = A mn∫∫ FXXY1 mn m m n dxdy , n1 m 1  ()6αo+ α o (1 − υ 2 )h + 2 a  0 0  tb tt  (3.4-25)

∞ δ − = The integral of the delta function is given by ∫ Xm()( x x xdx0 ) X m () x o . −∞ Therefore,theforceterminequation(3.422)canbeexpressedas

P( t ) P= o Q , (3.4-26) mnD mn where = Qmn XxYy m(0 ) n ( 0 ). (3.4-27)

Equation(3.422)isintheformofthewellknownDuffingequationcontaining acubicnonlinearterm,andcanberestatedas

λ ψɺɺ ()t+ ωψ2 () t + βψ 3 () t = mn Pt (), (3.4-28) mn mn mn mn mnD o where K ω2 = mn mn , (3.4-29) Mmn

G β = mn mn , (3.4-30) Mmn

57 Chapter 3: Formulation of Cracked Plates

Q λ = mn mn , (3.4-31) Mmn

ω β and mn isthenaturalfrequencyofthecrackedrectangularplate. mn isthe nonlinearcubictermandcanbeeitherapositive(hardspring)oranegative (softspring)dependinguponthesystemparameters.

3.5 Linear Viscous Damping

Dampingisessentiallyanonlinearphenomenon.Linearviscousdampingisan idealization, which provides a term proportion to velocity. Hysteretic damping, Coulomb dry friction, aerodynamic drag, etc. are examples of nonlineardamping.

Nowifitisassumedthatthesystemisattachedtoanonlinearspringunder the influence of weak linear viscous damping µ , then the equation of the modeloftherectangularcrackedplatebecomes,

λ ψɺɺ()2t+ µψ ɺ () t + ωψ2 () t + βψ 3 () tPt = mn (). (3.5-1) mn mn mn mn mn mnD o

Lettingtheloadbeharmonic,suchthat,

= Ω Ptpo() cos mn t (3.5-2) leadsto,

λ ψɺɺ()2t+ µψ ɺ () t + ωψ2 () t + βψ 3 () tpt =mn cos Ω . (3.5-3) mn mn mn mn mn mnD mn

Thisproblemisnottoohardtonondimensionalise,however,physicalunitsof the parameter are used throughout this dissertation, because there are no significantscaleeffects,ordatacomplicationswhichwouldotherwiserequire theoneofformalnondimensionalisation.

58 Chapter 3: Formulation of Cracked Plates

3.6 Investigation of Natural Frequencies for Cracked Plate Model

Here, we consider a test plate made of aluminium alloy 5083. 5083 is an internationaldesignationusedforclassification.Thisaluminiumalloycontains 5.2% magnesium, 0.1% manganese and 0.1% chromium. In the tempered condition,itisstrongandretainsgoodformabilityduetoexcellentductility. Ithashighresistancetocorrosion,andisusedforvariousapplicationssuchas shipbuilding, aircrafts, rail cars, vehicle bodies, pressure vessels etc. It has low density and excellent thermal conductivity common to all aluminium alloysandhasthefollowingmaterialproperties:

Modulusofelasticity, E =7.03x10 10 N/m 2

Density, ρ =2660kg/m 3

Poisson’sratio, υ = 0.33

Whilethegeometricpropertiesoftheplateare

Lengthalongxdirection, l1 =0.5m,Lengthalongydirection, l2 =1m

Halfcracklength, a=0.01–0.025mandthicknessoftheplate, h=0.01m and, p = 10 Nisthechosenloadmagnitudeactinguponthesurface of the = plate at some arbitrary specified point given here by x0 0.375 m and = µ = y0 0.75 m,andwithadampingfactorof 0.08 .

The natural frequencies without and with a crack for different boundary conditionsandaspectratioshavebeencalculatedandtabulatedinTable31. ItmaybeseenfromTable31thatthepresenceofthecrackatthecentreof the plate significantly influences the natural frequency of the first mode of theplate,inallthreecases.

59 Chapter 3: Formulation of Cracked Plates

First Mode Natural Frequency, ωmn [rad/s] for a Half-crack Length, a = 0.01 and 0.025 [m] Lengths Twoadjacentedges ofthe Twoadjacentedges clamped,theother Alledgessimply sidesof clamped,theother twosimplysupported supported(SSSS) the twofree(CCFF) (CCSS) plate

l1 l2 cracked cracked cracked un un un cracked cracked cracked [m] [m] 0.01m 0.025m 0.01m 0.025m 0.01m 0.025m

1 1 80.46 77.39 74.10 445.67 432.51 418.58 77.58 75.54 73.39

0.5 1 231.06 229.95 228.80 1161.77 1154.27 1146.53 193.95 192.54 191.09

1 0.5 231.06 213.85 194.61 1161.77 1089.98 1011.04 193.95 183.18 171.42

0.5 0.5 321.85 309.54 296.38 1782.66 1730.04 1674.31 310.32 302.17 293.57

Table 3-1: Natural frequencies of the cracked plate model for different boundary conditions and aspect ratios

In the subsequent section results are plotted for the first mode and three cases of boundary conditions. The natural frequency is influenced if the geometry ofthe plate ischanged,inparticularits length and thickness, in additiontotheeffectofthehalfcracklength.Figure36showsthedecrease inthenaturalfrequencyaswegoontoincreasethehalfcracklengthforthe sameparametersasconsideredearlier.Thesechangesareverysmallforsmall halfcracklengths,asonewouldexpect.

60 Chapter 3: Formulation of Cracked Plates

231 1160 230.5 1157.5

230 1155

[rad/s] 1152.5 229.5 mn 1150 ω 229 1147.5 1145 228.5 0 0.005 0.01 0.015 0.02 0.025 0.03 0 0.005 0.01 0.015 0.02 0.025 0.03 a [m] a [m] (a) CCFF (b) CCSS

194

193.5 1000

193 800 CCSS 192.5 600 SSSS [rad/s] CCFF 192

mn 400

191.5 ω 200 191 0 0 0.005 0.01 0.015 0.02 0.025 0.03 0 0.005 0.01 0.015 0.02 0.025 0.03 a [m] a [m] (c) SSSS (d) Combined effect

Figure 3-6: Plate first mode natural frequency of aspect ratio 0.5/1 as a function of half-crack length

Similarly,itmaybeseenfromFigure37thatbyincreasingthethicknessof theplatethenaturalfrequencyofthefirstmodealsoincreasesfordifferent valuesofhalfcracklength.Thismeansthatthisnaturalfrequencyisdirectly relatedtothethicknessoftheplate.

The present theory can also be verified with existing linear theories as proposedbydifferentauthors,namely,StahlandKeer(1972),Solecki(1983), Qian etal .(1991),Krawczuk(1993),andKrawczuk etal. (1994)and(2001) forthevibrationanalysisofcrackedplates.Letusconsiderasquareplateof sides 0.1 m x 0.1 m made of steel having a material properties such as, young’s modulus, E = 2.04x10 11 N/m 2, Poisson’s ratio, υ = 0.3, and mass density, ρ = 7860 kg/m 3.Thethicknessis0.001mandtheplateissimply supported from all sides. In general, linear models are applicable only in a veryrestricteddomainsuchaswhentheamplitudeofvibrationisverysmall asdiscussedinchapter1,whereasnonlinearmodelscapturealargerangeof phenomenasuchasjumps,modalinteractions,periodicdoublingandchaos. Thereforeby the implication of thenonlinear model one may see all these

61 Chapter 3: Formulation of Cracked Plates phenomena,andthisisdiscussedinchapters4and 5 for the model ofthe crackedplate.

200 1000

800 150 600 100 [rad/s]

mn 400 ω 50 200

0 0 0 0.002 0.004 0.006 0.008 0.01 0 0.002 0.004 0.006 0.008 0.01 h [m] h [m] (a) CCFF (b) CCSS

1000 150

800 CCSS 100 600 [rad/s] CCFF SSSS

mn 400 50 ω 200

0 0 0 0.002 0.004 0.006 0.008 0.01 0 0.002 0.004 0.006 0.008 0.01 h [m] h [m] (c) SSSS (b) Combined effect

Figure 3-7: Plate first mode natural frequency as a function of the thickness of the plate for the half-crack length of 0.01 m

Table32presentsacomparisonoftheratiooffrequenciesofcrackedandun cracked plates. It shows that the percentage changes between the linear modelsandpresentnonlinearmodelfortherangeof2 a/l1ratio(0.10.2)is approximately(12)%.

62 Chapter 3: Formulation of Cracked Plates

2a/l 1 Linear Models 0.00 0.05 0.10 0.15 0.20

Stahl&Keer(1972) 1 0.9940 0.9775

Solecki(1983) 1 0.9940 0.9780

Qian etal .(1991) 1 0.9950 0.9820

Krawczuk(1993) 1 0.9971 0.9942 0.9874 0.9806

Krawczuk etal. (1994) 1 0.9971 0.9942 0.9874 0.9806 and(2001)

Present Nonlinear 1 0.9995 0.9992 0.9990 0.9989 Model

Table 3-2: Relative changes of the natural frequencies of the cracked simply supported plate for the first mode only

The approximate analytical solution of the nonlinear Duffing ordinary differentialequationisobtainedinchapter4bytheuseoftheperturbation methodofmultiplescalesforanalyzingthenonlinearbehaviourofthesame plateofaluminiumalloy5083.

63 Chapter 4: Approximate Analytical Techniques

Chapter 4

APPROXIMATE ANALYTICAL TECHNIQUES

______

Manyexactsolutionsareavailableintheliteraturefortheproblemsoflinear vibration. However, for nonlinear problems, no single exact solution exists because of the general complexity of such analysis. Therefore,approximate techniquesarewidelyusedfornumericalsolution. We usetheperturbation method of multiple scales for obtaining a closeform solution, in addition direct integration within Mathematica™ and a finite element analysis in ABAQUS,arealsoperformedforthecomparisonofnumericalsolutionsforthe modelofthecrackedplate.

Thereareseveralsocalledperturbationmethods.Each of these techniques has its own advantages and limitations. They all rely on the same idea of splittingthecoordinateupintosuccessivelysmallerparts,intheformofa powerseriesintermsofasmallparameter,usuallydefinedby ε .So,forthe coordinatethatweareusinghereis, ψ ,andtheexpansionwouldhaveof thisform

ψψ=+ εψ + εψ2 + + εψn 0 1 2 ...... n (4-1)

Each term in the series is known as a perturbation. The parameter, ε , is calledtheperturbationparameter.If ε issmallthenitcanbeseenthatthe ψ ψ ψ contributionto whichisofferedby i +1 issmallerthenthatofferedby i . ψ Onthatbasismostofthesolutionisencodedwithin 0 ,withasocalledfirst ψ ψ ordercorrectiongivenby 1 andasecondordercorrectiongivenby 2 andso on.Inpractice,ifoneusesaseriesofthissortthenitisimportanttoknow wheretotruncatetheseries.Thisisthebasisoftheperturbationmethods.In each method the coordinate or dependent variable is represented by a

64 Chapter 4: Approximate Analytical Techniques suitable series, suchas equation (41). It is alsorelevanttonotethatsince ψ= ψ(t , ε ) thentherateofchangesof ψ shouldalsobeperturbed(ideally). Simpleperturbationmethodsdonotdothis,andasaresulttheiraccuracyis limited, even when higher order perturbations are included. Here, we are used the perturbation method of multiple scales to formulate the Duffing’s equation (3.53) for the vibration analysis of a rectangular plate having a partthroughcrackatthecentreoftheplate.

4.1 The Method of Multiple Scales

Thepopularisationofthemethodofmultiplescalesiscommonlyattributedto Ali H. Nayfeh (1973), however, manyother peoples have contributed to its development, and as this method is well discussed in the seminal work of NayfehandMook(1979)andinthewellknownbooksof PerturbationMethods inAppliedMathematics byKevorkianandCole(1981), IntroductiontoLinear, Parametric and Nonlinear Vibrations by Cartmell (1990) and Perturbation TheoryandMethods byMurdock(1999).WealsonoteinpassingthatCartmell et al. , in 2003, reviewed the multiple scales method as applied to weakly nonlineardynamicsofmechanicalsystems.

For the method of multiple scales, the solution of the equation (3.53) is approximated by a uniformly valid expansion of the form as indicated in equation(41),

ψεψ= + εψ + ε 2 mn(,)t0 mn (,) TT 01 1 mn (,) TTo 01 (), (4.1-1)

ψ ψ where 0mn (T 0 , T 1 ) and 1mn (T 0 , T 1 ) arefunctionsyettobedetermined.

Sincethehighestorderderivativeintheequation(3.53)is2,therefore,the dψ firstandthesecondtimederivativeofthefunction, ψ are, ψɺ = mn and mn mn dt d 2ψ ψɺɺ = mn . The derivative perturbations rely on the notion that the real mn dt 2 time, t,canbeexpressedintheformofasetofsuccessively independent timescales, Tn ,andisgivenby

65 Chapter 4: Approximate Analytical Techniques

= ε n Tn t forn=0,1,2,… (4.1-2)

In equation (4.11), T0 is nominally considered as fast time and T1 as slow = = ε time,suchthat, T0 t and T1 t asfromequation(4.12).

Excitationcanalsobeexpressedintermof T0 and T1 as

=ε( ω + σ ) Ptp0( ) cosmn T 0 mn T 1 . (4.1-3)

Accordingtothatthederivativesareperturbedasfollows,startingwiththe firsttimederivative

d dT∂ dT ∂ =0 + 1 + ... ∂ ∂ (4.1-4) dt dt T0 dt T 1 or, d ∂ ∂ = +ε + ... ∂ ∂ (4.1-5) dt T0 T 1

Itcanalsobewrittenforfirstandsecondtimederivative using Doperator notationforsimplicityas

d =+DDDε + ε2 ++... ε n D (4.1-6) dt 0 1 2 n

d 2 =+D22ε DD + ε 2() D 2 + 2 DD + ... (4.1-7) dt 2 0 01 1 02

Beforeapplythismethodtoobtainauniformlyvalidapproximatesolutionto thisproblem(incaseofequation(3.53)),itisnecessarytoorderthecubic term,thedamping,andtheexcitation.Toaccomplishthiswechoosetoset thefollowingtoO(ε) 1,

µεµβ= = εβ = ε ,mn mn , p p . (4.1-8)

This philosophy is pragmatic and realistic in that it permits the pre determinedgenerationoflinear,homogeneousgeneratingsolutionsforeach

66 Chapter 4: Approximate Analytical Techniques

Ω coordinate. Moreover, instead of using the excitation frequency, mn as a σ parameter, we introduce a detuning parameter, mn , which quantitatively Ω ω describes the nearness of mn to mn . This has the advantage of clarifying identification of the terms in the governing equation at first order perturbation that lead to secularterms. Accordingly we write, [Nayfeh and Mook(1979)],

Ω =ω + εσ mn mn mn (4.1-9) where ε isanarbitrarilysmallperturbationparameter.

Ingeneral,equation(4.19)iscalledtheprimary resonancecondition.After substitutingequations(4.18)and(4.19)intoequation(3.53),itbecomesas follows,

λ ψɺɺ()2ttt+++ εµψ ɺ () ωψ2 () εβψ 3 () tp = εmn cos( ω + εσ ). t (4.1-10) mn mnD mn mn

This introduces damping, the cubic nonlinearity, and the excitation to first order perturbation, which is considered to be inline with the appropriate experimental configuration, and other work on weakly nonlinear vibrating systems[NayfehandMook,(1979),KevorkianandCole(1981),andMurdock, (1999)].ItisimportanttonoteherethatforDuffingequationsthecoefficient εβ ofthecubicterm,inthisorderedcase mn ,canbenumericallypositiveor negative,leadingtooverhangsoftheresponsecurveinthefrequencydomain totherightorleft,respectively.Substitutingtheexpansionofequation(4.1 1), the excitation term from equation (4.13) and the two time derivative seriesofequations(4.16)and(4.17)intotheOrdinaryDifferentialEquation (ODE)oftheform(4.110),weget,

2++ε εψε 22 +++ 2 ε εψ 22 + ε 2 (D02 DDD 01 10) mn ( D 0 2 DDD 01 11) mn o () ++εµ()() εψ + εµ2 + εψ + εµε2 + ωψ 2 2DD010mn 2 DD 011 mn 2() o mn 0 mn λ +++εωψ2 ωεεβψ 22o( )() 33 ++= εψ o ( ε 2 ) εmn pTT cos() ω + σ . mn1 mn mn mn0 mn 1 mn D mn0 mn 1 (4.1-11)

67 Chapter 4: Approximate Analytical Techniques

Separatingtermsoflikeorder εyields,toorder εo:

2ψ+ ω 2 ψ = D0 0mn mn 0 mn 0, (4.1-12)

Thisisalinear,homogeneous,secondorderperturbationequationandcanbe thoughtofasanordinarydifferentialequationwithrespecttotimescaleT0 . Itisusuallyreferredtoasthezerothorderperturbationequation. andtoorder ε1:

λ D2ψωψ+=− 2 2 DDD ψ − 2 µψβψ −+3 mn pTT cos() ωσ + . 01mn mn 1 mn 010 mn 00 mn mn 0 mnD mn 01 mn (4.1-13)

Thisisreferredtoasthefirstorderperturbationequation.Thehigherorders of ε 2 , ε 3 and so on, may be neglected because higher order perturbation equationswillyieldnegligiblecorrectionsfortheproblemassetuphere.The generalsolutionofequation(4.112)canbewrittenas

iTω− iT ω ψ =mn0 + mn 0 0mn BTe() 1 BTe () 1 , (4.1-14) where B isanunknowncomplexamplitude,and B isthecomplexconjugate of B . This amplitude will be determined by eliminating the secular terms ψ from 1mn . Substituting the solution from equation (4.114) into equation (4.113),weget,

ωω− ωω− 2ψ+=− ω 2 ψ iTmn0 + iT mn 0 −µ iTmn0 + iT mn 0 D01mn mn 1 mn 2 DDBTe 011{ () BTe () 1} 2 DBTe 01{ () BTe () 1 }

ω− ω 3 λ −β {}BTe()iTmn0 + BTe () iT mn 0 +mn p cos()ω T + σ T , mn 1 1 D mn0 mn 1 (4.1-15) which,afterdroppingtheargument T1 inthecomplexamplitudes,leadsto thefollowing,

68 Chapter 4: Approximate Analytical Techniques

iTω− iT ω iT ω− iT ω 2ψωψ+=− 2 ωmn0 − ω mn 0 − µωmn0 − ω mn 0 D01mnmn 1 mn2 iD 1 ( mn Be mn Be) 2 i( mn Be mn Be )

3 λ  3 3iTω− 3 iT ω iT ωω− iT  mn −β Bemn0 ++ Be mn 03 BBBe() mn 00 ++ Be mn p cos()ω T + σ T . mn   D mn0 mn 1 (4.1-16)

(ω+ σ ) Expressing cos mnT0 mn T 1 incomplexform,andtakethecommonfactor

iω T of e mn 0 outfromtherighthandsideofequation(4.116),weget,

λ  σ  iTω3 iT ω 2ψωψ+=−−−+ 2 ω µωβ2 mn imn T 1 mn0 − β 3 mn 0 + D01mn mn 1 mn 2 iDBiB mn 1 2 mn 3 mn BB pee mn Be cc ,  2D  (4.1-17) whereccdenotesthecomplexconjugateoftheprecedingterms.

iω T Itcanbeseenthatsomeoftherighthandsidetermscontaintheterm e mn 0 . ω Theimportantcharacteristichereisthat mn isexplicitlypresent,itmeans that those terms areresonant. Such terms frequently occur in perturbation analysisandarecalledsecularterms.Nowtheseculartermscanbeidentified

iω T immediatelyduetotheremovalofthecommonfactorof e mn 0 .Toeliminate theseculartermsfromequation(4.117),wemustput,

λ iσ T −2iω DBi − 23 µω B − β BB2 +mn pe mn 1 = 0. (4.1-18) mn1 mn mn 2D

This means that equation (4.117) will be much simpler and can then be solveddirectlyusingtheconventionalparticularintegral method. In solving equation(4.118),itisconvenienttowritethecomplexamplitude B inthe polarform,

1 α B= be i , (4.1-19) 2

= where B B( T 1 ) ,thephysicalreasoningbehindthatistokeepamplitudeina steady state or nearly so. Ifthisis imposed then it also has to impose the = α= α conditionsthatrealamplitude, b b( T 1 ) andphase, (T1 ) .

69 Chapter 4: Approximate Analytical Techniques

Substitutingequation(4.119)intoequation(4.118),weget,

3β λ ωαωωµbibib′−−− ′ mn b3 + mn p[cos( σα T −+ ) i sin( σα T −= )] 0, mn mn mn 8 2 D mn1 mn 1 (4.1-20)

wheretheprimedenotesthederivativewithrespectto T1 .

Now,separatingtheresultintorealandimaginaryparts,weobtain,

3βb3 λ Re: bα′ =mn − mn pcos( σ T − α ), (4.1-21) ω ω mn 1 8mn 2 mn D

λ Im: bb′ =−+µmn psin( σ T − α ). ω mn 1 (4.1-22) 2 mn D

Equation (4.121) contains α′,wherethisistheslowlyvaryingphaseangle, andequation(4.122)containstheslowlyvaryingamplitude, b′ .

Equations(4.121)and(4.122)canthenbetransformedintoanautonomous systemi.e.oneinwhich T1 doesnotappearexplicitly,byletting,

κ= σ − α mn T1 . (4.1-23)

Substitutingequation(4.123)intoequations(4.121)and(4.122),weget,

3βb3 λ bκ′ = σ b −mn + mn p cos κ , (4.1-24) mn ω ω 8mn 2 mn D

λ b′ = −µ b + mn p sin κ . ω (4.1-25) 2 mn D

In the case of steadystate motion b′=κ ′ ≈ 0 , and this corresponds to the singularpointsofequations(4.124)and(4.125);thatis,

70 Chapter 4: Approximate Analytical Techniques

3βb3 λ −mn +σb =− mn p cos κ , (4.1-26) ωmn ω 8mn 2 mn D

λ µb= mn p sin κ . ω (4.1-27) 2 mn D

Squaringandaddingtheseequations,weobtain,

2 3βb2   λ 2 µ2+ σ −mn   b 2 = mn p 2 . (4.1-28) mn 8ω 4 ω 2D 2 mn   mn

Itisthenpossibletorearrangeequation(4.128),weget,

3βb2 λ 2 σ=mn ± mn p2 − µ 2 . (4.1-29) mn ω ω 2 2 2 8mn 4 mn b D

This is a frequency response equation which gives the modal amplitude σ response, b asafunctionofthedetuningparameter, mn ,andtheamplitude of the excitation, p , this being a measure of deviation from the perfect forced resonance condition. It also indicates that the peak amplitude, bp is β independentofthevalueof mn (cubicnonlinearterm)andisgivenby

λ b= mn p p ω µ (4.1-30) 2 mn D

(β = ) Wecanplotthelinear mn 0 andnonlinearresponsecurvesfromequation (4.129).Thelinearresultsaresymmetrictothisorderofapproximationand representthesolutioninaverynarrowbandaroundtheresonantfrequency. The effect of the nonlinearity is to bend the amplitude curve left or right depending upon the negative or positive value of the cubic nonlinear term respectively.

71 Chapter 4: Approximate Analytical Techniques

4.2 Analytical Results

In this section, analytical results are presented based on the approximate methodofmultiplescales.Linearandnonlinearresponsecurvesforthethree casesofboundaryconditionsandahalfcracklengthof0.01m,areplottedto seetheireffectsattheresonancecondition.Secondly,adetailedcomparison is made between the linear and nonlinear cracked plate models. Finally, nonlinearityisalsoaffectedbychangingthelocationofthepointload,andby meansofthedampingfactor,andtheseaspectsarediscussednext.

4.2.1 Linear and Nonlinear Response Curves

Linearandnonlinearresponsecurvesareplottedforanalysingthebehaviour ofamodelofthecrackedrectangularplate.Toconstructsuchacurve,one σ solvesfor, mn intermsof b .Figure41showstheplotsofamplitude, b asa σ µ functionof mn forgiven and p intheformofafrequencyresponsecurve for three sets of boundary conditions as discussed in section 3.4 in detail. Eachpointonthiscurvecorrespondstoasingularpoint.

Now, we consider the same mechanical and geometric properties of test aluminiumplateasmotionedinsection3.6forplottingofsystemresponses. Theresultsareshownforthefirstmodeonly.Figures 4.1(a) and 4.1(b)are the linear and nonlinear response curves for the CCFF, CCSS and SSSS boundary conditions respectively. As shown, the nonlinearity bends the (β = ) frequencyresponsecurveawayfromthelinearcurve mn 0 ,totheright β > forhardspringsi.e. mn 0 forthecasesofCCSSandSSSS,andbendstothe β < left for soft springs i.e. mn 0 for the case of CCFF. These are shown in Figure41(b),withsomeattendantchangeinthemodalnaturalfrequency,or wecansaythatastheamplitudeoftheexcitationincreases,thefrequency σ = responsecurvesbendawayfromthe mn 0 axis.Thenaturalfrequencyis also influenced if the geometry of the plate is changed, in particular its length and thickness, in addition to the effect of the halfcrack length as discussedinchapter3(seeFigures36and37formoredetail).

72 Chapter 4: Approximate Analytical Techniques

0.035 0.01 0.03 0.008 0.025

0.02 0.006

0.015 b [m] 0.004 0.01 0.005 0.002

0 -10 -5 0 5 10 -20 -10 0 10 20 30 σmn [rad/s] σmn [rad/s] (a) Linear - CCFF (b) Nonlinear - CCFF

0.01 0.025 0.008 0.02 0.006 0.015

0.01 b [m] 0.004

0.005 0.002

0 -6 -4 -2 0 2 4 6 -20 -10 0 10 20 30 σmn [rad/s] σmn [rad/s] (a) Linear - CCSS (b) Nonlinear - CCSS

0.01 0.025 0.008 0.02 0.006 0.015

0.01 b [m] 0.004

0.005 0.002

0 -6 -4 -2 0 2 4 6 -20 -10 0 10 20 30 σmn [rad/s] σmn [rad/s] (a) Linear - SSSS (b) Nonlinear - SSSS

Figure 4-1: Linear and nonlinear response curves for three different cases of boundary conditions and half-crack length of 0.01 m

4.2.2 Comparison of Linear and Nonlinear Cracked Plate Model

β Ifthecubicnonlinearity, mn issettozerothentheproblemislinearisedas discussed earlier, but in the case of the nonlinear problem the significant effectofincludingthistermisapparentfromthenumericalresultsdepicted inFigure42forthetwosetsoftheplateaspectratios0.5/1and1/1.Figure 42 shows that the ratio of the linear and nonlinear solution amplitude β (where mn is set to zero) is very large for negative detuning. This exactly emulatesthesofteningnonlinearcharacteristicforthecaseofCCFFboundary

73 Chapter 4: Approximate Analytical Techniques conditions as shown in Figure 41(b). It can also be seen that this ratio reducesclosetounityforzeroandpositivedetuning,againfullyinlinewith thesofteningcharacteristicobservableinFigure41(b)forthecaseofCCFF boundarycondition.Inaddition,itcanalsobeseenthatthereisaverysmall differenceinamplituderatiobetweenthetwoaspect ratios of the plate in

Figure 42. In the Figure 42, bNL is the nonlinear amplitude and bL is the correspondinglinearamplitude.

80 80

60 60

L

40 /b 40 NL b

20 20

0 0 -40 -20 0 20 40 -40 -20 0 20 40 σmn [rad/s] σmn [rad/s] (a) Plate aspect ratio 0.5/1 (b) Plate aspect ratio 1/1

Figure 4-2: Comparison between linear and nonlinear model of the cracked rectangular plate and the boundary condition CCFF

4.2.3 Nonlinearity affects by changing the location of the Point Load

It has been observed that changing the location of the load on the plate slightlyaffectstheglobalnonlinearityofthesystem,asshowninFigure43 for thecaseof CCFF boundaryconditionandevidenced by the increasingly wide nonlinear region as the excitation location moves closer to the unsupportedcorner.

0.003

0.0025

( x0 , y0 )=(0.375,0.375) 0.002 ( x0 , y0 )=(0.375,0.50) 0.0015 ( x0 , y0 )=(0.375,0.75) b [m] 0.001

0.0005

-30 -20 -10 0 10 20 30 40 σmn [rad/s]

Figure 4-3: The amplitude of the response as a function of the detuning parameter, σmn [rad/s] and the point load at different locations [m] of the plate element

74 Chapter 4: Approximate Analytical Techniques

4.2.4 Damping Coefficient influences Nonlinearity

Itisalsointerestingtonotethatthedampingcoefficient, µ influence the responsecurves.Intheabsenceofdamping,thepeakamplitudeisinfinite, and the frequency response curve consists of two branches having as their 3β b2 asymptote the curve, σ = mn . However, in the presence of damping, mn ω 8 mn thepeakamplitudeisfiniteasinthepresentcase.

4.2.5 Peak Amplitude

Thepeakamplitude, bp asgiveninequation(4.130)foranuncrackedand crackedplateistabulatedinTable41.Asexpected,theamplitudeincreases astheinsertionofthecrackatthecentreoftheplateandincreasesfurther bytheincreaseofhalfcracklengthfrom10mmto25mm.

CrackedPlatewithHalfcrack Boundary Uncracked Lengths, a[mm] Conditions Plate[mm] 10mm 25mm

CCFF 35.19 35.36 35.54

Peakamplitude CCSS 27.62 27.80 27.99

SSSS 82.72 83.33 83.96

Table 4-1: Peak amplitudes for three sets of boundary conditions and two sets of half-crack length for a plate aspect ratio of 0.5/1

4.3 Direct Integration – NDSolve within Mathematica™

TheNDSolveintegratorwithin Mathematica™ (Wolfram,1996)isusedforthe numerical solution of nonlinear ordinary and partial differential equations.

75 Chapter 4: Approximate Analytical Techniques

SpecialprogramcodeisdevelopedforintegratingtheDuffingequation(3.53) forgiveninitialconditionsandisshowninAppendixA.

Theresultsobtainedareinthetimedomainandcanbetransformedintothe frequencydomainbyrunningthisprogramcodeasdescribed in Appendix A severaltimesforarangeoffrequencyvaluesfrom 40 rad/s to40 rad/s to obtain a list of amplitude values. While going through all the data individually, one selects that portion of the amplitude values where the valuesareinsteadystatecondition,andthenoneaveragesthemfortheplot ofamplitudeandfrequency.Theseprovideabasisfor comparison with the approximateanalyticalsolutionsobtainedfromequation(4.129).

0.003

0.0025

0.002

0.0015

0.001 Amplitude [m] 0.0005

-40 -20 0 20 40 Frequency [rad/s]

Figure 4-4: Nonlinear overhang in the form of the softening spring characteristic by the use of NDSolve within Mathematica™ for an aspect ratio of 0.5/1, and initial conditions zero

Figure44showstheresponsesoftheplateobtainedfromdirectintegration bytheuseofNDSolvewithin Mathematica™ .Reasonablycloseagreementcan be observed, however the numerical solution does not predict the same degree of nonlinear overhang in the form of the softening spring characteristicastheapproximateanalyticalsolution.Theoverpredictionof thesofteningoverhangbythemultiplescalessolutionisundoubtedlydueto an overcorrection to the solution from the first order perturbation contribution,andtheassumptionsthatnecessarilywentwiththatinorderto obtainaclosedformsolution.

4.4 Finite Element (FE) Technique – ABAQUS/CAE 6.7-1

ABAQUS/CAEisageneralpurposefiniteelementanalysistoolwithagroupof engineering simulation programs capable of modelling structures under

76 Chapter 4: Approximate Analytical Techniques different loading conditions. It can solve problems of relatively simple structuralanalysistothemostcomplicatedlineartononlinearanalyses.Ina nonlinear analysis ABAQUS/CAE automatically chooses appropriate load increments and convergence tolerances and continually adjusts them during the analysis to ensure that an accurate solution is obtained. ABAQUS/CAE consistsofawidespreadlibraryofelements,wherein any type of geometry can be modelled. Apart from solving structural problems, it can also solve problems in other different areas like fracture mechanics, soil mechanics, static analysis, piezoelectric analysis, coupled thermalelectrical analyses, heat problems, and acoustics etc. The detailed description of the ABAQUS/CAEfiniteelementprogramhasbeenincludedinAppendixB.

In this analytical framework, ABAQUS/CAE is used for evaluating the frequencies,displacementsandmodeshapesofthemodelofacrackedplate to investigate the theoretical predictions. The required inputs for the ABAQUS/CAE finite element analysis consists of model geometry, material properties,loading,boundaryconditions,andaninitialcrackconfiguration.

4.4.1 Steps Taken to Perform FE Analysis

A description of the steps taken to perform an elastic FE analysis using ABAQUS/CAEareasfollows:

• Createa3DsolidmodeloftheplateelementintheABAQUS/CAEPart moduleforagivengeometricandmechanicalpropertiesofaluminium alloy–5083.

• Createapartthroughcrackofdepth0.06matthecentreoftheplate bytheuseofcutfeatureundershapeinthemainmenu.

• Define material properties for an aluminium plate in the Property module, including modulus of elasticity, Poisson’s ratio, and density. Further,createsectionandsectionassignmentofthepartinthesame module.

77 Chapter 4: Approximate Analytical Techniques

• Createpartitionsofthewholepartforproperstructuralmeshinginthe mesh module. The partition feature can be access under tool in the mainmenu.

• CreateanassemblyofthepartintheAssemblymodule.

• Create steps for the analysis in the step module i.e. specific output requestsincludingfieldandhistoryoutputrequests.

• Createsetstodefinetheboundaryconditionsofthepart.

• Applyboundaryconditionsandloadingsintheloadmodule.Here,CCFF boundaryconditionandaconcentratedforceof10Nareapplied.

• Create the mesh of the part using element shape and analysis type standard, 3D stress, C3D8R 8 node linear brick with reduced integration. Mesh and seed part instances are also required for the creation of the mesh. ABAQUS/CAE offers a number of different meshing techniques. The default meshing technique assigned to the modelisindicatedbythecolourofthemodel.IfABAQUS/CAEdisplays themodelinorange,itcannotbemeshedwithoutassistancefromthe user.

• Whenallthekeywordsaredefined,submitthejobinthejobmoduleto solvefortheanalysis.

• In post processing, interpret the output in the Visualisation module, includingstandardstress,strainanddisplacementdistributions.

TherearetwobasictypesofdynamicanalysisinABAQUS/CAE step module; implicitandexplicit.ABAQUS/StandardusestheimplicitHilberHughesTaylor operatorforintegrationoftheequationsofmotion.Thisofferstheuseofall elements in ABAQUS, however, it can be slower than explicit, whereas ABAQUS/explicit uses the centraldifference operator. In an implicit dynamical analysis the integration operator matrix is inverted and a set of nonlinearequilibriumequationsaresolvedateachtimeincrement.Adynamic

78 Chapter 4: Approximate Analytical Techniques analysisforthecrackedmodelisperformedbyemployingimplicit,andedits theStepmoduleas

Basictab Timeperiod:6

Incrementationtab Type:Fixed

Maximumnumberofincrements:6000

Incrementsize:0.001

Check:Suppresshalfstepresidualcalculation

Theperiodicloadisappliedatadistanceof0.375x0.75mfromthefixed edges of the plate (see Figure 36) with a magnitude of 10 N under the resonant frequency. This can be defined in ABAQUS/CAE as Go to tools, amplitude,create,giveitanameandchooseperiodic.Themodelmaytakea longtimetorun.However,itcouldbemonitoredduringtheruns.

4.4.2 ABAQUS/CAE Results

TheresultsobtainedfromABAQUS/CAEareshowninFigures45,46and47 forthenonlinearFEanalysisoftheplatewithapartthrough crack at the centreoftheplateforaboundaryconditionofCCFF,andtheaspectratioof theplateis0.5/1.Equally,resultscanreadilybeobtainedbyemployingother boundaryconditions,suchasCCSSandSSSS.

4.4.2.1 Frequency Analysis

Figure45showsthreemodesofvibrationforanuncrackedplate.Similarly, Figures46and47showsadecreasingtrendastheinclusionofdamageinthe formofcrackatthecentreoftheplate.Thefrequencyvaluesaretabulated in Table 42 for a three modes of vibration for a cracked and uncracked plate.

79 Chapter 4: Approximate Analytical Techniques

(a) Mode – I (b) Mode – II (c) Mode – III

Figure 4-5: Three modes of vibration for an aluminium plate without a crack

(a) Mode – I (b) Mode – II (c) Mode – III

Figure 4-6: Three modes of vibration for an aluminium plate of sides 0.5x1 m and a half-crack length of 0.01 m

(a) Mode – I (b) Mode – II (c) Mode – III

Figure 4-7: Three modes of vibration for an aluminium plate of sides 0.5x1 m and a half-crack length of 0.025 m

80 Chapter 4: Approximate Analytical Techniques

4.4.2.2 Amplitude Analysis

The amplitude responses for an uncracked and cracked plate model are obtained by employing implicit dynamic nonlinear analysis within ABAQUS/CAE. As expected, the amplitudes values increase due to the insertionofasmallcrackinthealuminiumplate.Theseamplitudesvaluesare also tabulated in Table 42, and the comparison is made between the theoreticalmodelandtheFEAresults.

TheoreticalResultsfor FEAResults M1only

Amplitude Frequency[Hz] Frequency Amplitude [mm] [Hz] [mm] MI MII MIII MIonly

UncrackedPlate 36.77 1.1913 36.819 77.85 157.07 1.016

10mm 36.60 1.1974 36.240 76.73 154.82 1.222 Cracked Plate 25mm 36.41 1.2045 36.232 76.67 154.78 1.386

Table 4-2: Finite element analysis results

Theanalyticalresultsviathemethodofmultiplescalescanbeextendedfor the evaluation of higher modes for the cracked plate problem. However, includinghighermodesmakesthecomputationoftheproblemmorelengthy and complex to a greater extent. As one then could see, that the general formofthetransversedeflectionoftheplate(equation3.41)willtakemulti partform.Itwouldbeadvantageousifthiscouldbeinvestigatedfurtherfor thehighermodes.

81 Chapter 5: Dynamical System Analysis

Chapter 5

DYNAMICAL SYSTEM ANALYSIS

______

In this chapter, we discuss dynamical systems theory and its application for providing an introduction to nonlinear behaviour, principally through the study of the Duffing ODE of equation (3.53), used as the model of the crackedrectangularplateasdiscussedinchapters3and4.Thisstudybegins with the stability of the phase states, and the Poincaré map, and this is followedbyastudyofthebifurcations,thatareobservedfromtheanalysisof saddletrajectories,andthecalculationoftheLyapunovexponent.Thislead ustotheemergenceofstrangeattractorsoffractaldimension;theevolution of saddle orbits into chaos, and leads to the observation idea that in this systemseeminglychaoticbehaviourcanemergefromperfectlydeterministic origins.Chaoticbehaviourmight,inprinciple,bepredictedasanoutcomefor adeterministicsystem,however,insomesystemsitisdifficulttoenvisage,as thedynamicsofthesystemarenecessarilyofhighprecision.Therefore,the understanding of the dynamics of an analytically modelled system, or a system defined by a finite element model, can be extended further by recoursetotechniquesbasedonspecialisednumericalinvestigations.

Nonlineardynamicalsystemsareusedasmodelsineveryfieldofscienceand engineeringanduniversalpatternsofbehaviour,includingchaos, have been observedinmanyexamples.Various,freelyavailablepiecesofsoftwaresuch as, AUTO 2,XPPAUT 3,Matcont 4,Content 5,DynPac 6, and DynamicsSolver 7have beenspecificallydesignedfortheanalysisofdynamicalsystems,andtoallow theusertocomputetheequilibriaandlimitscycles, bifurcation points and

2http://indy.cs.concordia.ca/auto/ 3http://www.math.pitt.edu/~bard/bardware/tut/xppauto.html 4http://www.matcont.ugent.be/matcont.html 5http://www.enm.bris.ac.uk/staff/hinke/dss/continuation/content.html 6http://www.me.rochester.edu/~clark/dynpac.html 7http://www.enm.bris.ac.uk/staff/hinke/dss/ode/dynsolver.html

82 Chapter 5: Dynamical System Analysis

Lyapunovexponentsfortheirownsystems.Inpractice,ithasbeenobserved that every software package has its own specific significance, and performance,andthisgivestheuserthechoiceofmany.Aprimaryfunction of these dynamical systems software packages is to perform numerical integrationandnumericalcontinuation.Numericalintegrationisaniterative techniquewhichisappliedtothemajorityofnonlinearsystemsthatarenot solvedanalyticallyforsomereason,therefore,thetrajectoryisapproximated bycalculatingasequenceofsolutionsoveragiventimespan.Ontheother hand,numericalcontinuationisatechniquetotracethesolutionpathtoa given system as the value of a control parameter varies, so it allows the bifurcationstobefound,andstableandunstablesolutionstobetraced.

Inthisstudy,computationalmethodsfortheanalysisofdynamicalsystemsas system parameters varies are discussed by implementing the Dynamics 2 dynamicalsystemsoftware,andalsobytheuseofbespokecodewrittenby the author in Mathematica™ . In addition, these analyses are for high excitationandfrequencyvaluesoftheDuffingequation(3.53).

5.1 Dynamical System Theory

Chaosisbroadlydefinedasamajortypeofirregular,unpredictablebehaviour observable in deterministic nonlinear dynamic systems. In the mathematical literature,itisusuallydefinedasaphenomenonseeninadynamicalsystem that has a sensitive dependence on its initial conditions. Stanisław Marcin Ulam(1909–1984)famouslystatedthatnonlinearscienceislikenonelephant zoology. Chaos theory began as a field of physics and mathematics dealing with the structures of turbulence and the selfsimilar forms of fractal geometry. The idea that many simple nonlinear deterministic systems can behaveinanapparentlyunpredictableandchaoticmannerwasfirstnoticed bythegreatFrenchmathematicianHenriPoincaré(1854–1912). Other early pioneering work in the field of chaotic dynamics were found in the mathematicalliteraturebysuchluminariesasBirkhoff(1844–944),Andronov (1901–1952) and his students, Littlewood (1885–1977), Kolmogorov (1903– 1987), Pontryagin (1908–1988), Cartwright (1900–1998), and Smale (1930– present),amongstothers.Inspiteofthis,theimportanceofchaoswasnot

83 Chapter 5: Dynamical System Analysis fully appreciated until the widespread availability of digital computers for numerical simulations and the demonstration of chaos in various realtime systems. This realisation has broad implications for many fields of science, anditisonlywithinthepastthreedecadesthatthefieldhasundergonean explosivegrowthinsuchdiversedisciplinesasengineering,fluidmechanics, physics,biology,economics,andchemistry.

Poincaréwroteinhisessay Science and Hypothesis (1903)that“Ifweknew exactly the laws of nature and the situation of the universe at the initial moment,wecouldpredictexactlythesituationofthat same universe at a succeedingmoment.Butevenifitwerethecasethatthenaturallawshadno longer any secret for us, we could still only know the initial situation approximately.Ifthatenabledustopredictthesucceedingsituationwiththe same approximation, that is all we require, and we should say that the phenomenon had been predicted, that it is governed by laws. But it is not always so; it may happen that small differences in the initial conditions produceverygreatonesinthefinalphenomena.Asmallerrorintheformer willproduceanenormouserrorinthelatter.Predictionbecomesimpossible, andwehavethefortuitousphenomenon”.Wecanconcludefromthisthatit isveryhardtogetexactpredictionsofanysystemfromtheinitialconditions. Theseinitialconditionscancauseenormousdivergenceintheresults,aswe canseeinthecaseofthecrackedplatemodelinthefollowingsections.

The book by Abrahams and Shaw, in 1982, used artistic techniques to represent phase space structures and bifurcation diagrams in three dimensions. Today the capabilities of the dynamical systems research communityarefarmoremature,andthenomenclatureofbifurcationtheory is hardwired into almost all fields of scientific study. Champneys, in 2006, presentedanoverviewofafamousbook DynamicalSystemsandBifurcations ofVectorFields writtenbyGuckenheimerandHolmes(1983).Hepointedout thatifphysicswasthegreatscienceofthetwentiethcentury,thensurelyit will be the life sciences that increasingly dominate in the twentyfirst century,tosaynothingofthesocialsciences,economics, models of human behaviour, perception and cognition. All of these will need the insight of applieddynamicalsystemstheory.

84 Chapter 5: Dynamical System Analysis

5.2 A Model of the Cracked Plate for Dynamical System Analysis

ThemodelofthecrackedplateintheformoftheDuffingequation(3.53)as discussed in chapter 3 is used after some modification, to represent the behaviourofthisdynamicalsystemfromnonlineartransitiontochaos,bythe use of Dynamics 2 –atoolforbifurcationanalysis,andbymeansof special bespokecodein Mathematica™ .Therefore,wecanwritetheDuffingequation (3.53)inthefollowingform:

ɺɺ+++ ɺ 3 =ρ ( Ω ) xCxCxCx1 2 3 cos t . (5.2-1) where = µ C1 2 (5.2-2)

= ω 2 C2 mn (5.2-3)

= β C3 mn (5.2-4)

P λ ρ =mn = mn p (5.2-5) Mmn D and, Ω = Frequencyofexcitation

5.2.1 Nondimensionalisation

Nondimensionalisation of the timescale in equation (5.21) is introduced by putting τ= ω t in order to show realistic plots in the subsequent Figures, where ω is the natural frequency of the first mode of the cracked plate model.

Therefore,

85 Chapter 5: Dynamical System Analysis

d2 x dx ⇒ xɺɺ = xɺ = dt 2 dt 2 dx = d x = τ 2 τ    ; d d   ω  ω    d2 x = ω dx = ω τ dτ 2 d xɺɺ () t= ω x ′′ () τ xɺ() t= ω x ′ () τ

(5.2.1-1) Indimensionlesstimescale,equation(5.21)

Ω  ωω′′+ ′ ++3 = ρτ x Cx1 CxCx 2 3 cos   (5.2.1-2) ω 

Where the prime (′) denotes differentiation with respect to dimensionless time τ .

Dividingtheequation(5.2.12)by ω ,weget

ρ Ω  ′′+1 ′ + 1 + 1 3 = τ x Cx1 Cx 2 Cx 3 cos   (5.2.1-3) ω ω ω ω ω 

Letassumethat Ω = ω .Therefore,

1 1 1 ρ x′′+ Cx ′ + Cx + Cx 3 = cos ( ω τ ) ω 1ω 2 ω 3 ω (5.2.1-4)

The 2nd order differential equation is split into two first order ordinary differential equations to make a more compact form for these types of analyses.

x′ = y (5.2.1-5) C C C ρ y′ =−1 yxx − 2 −3 3 + cos ()ω τ (5.2.1-6) ω ω ω ω

86 Chapter 5: Dynamical System Analysis

Similarly, the mechanical properties of the material used, in this case aluminium alloy 5083, are used for the calculation of system parameters, whicharetabulatedinTable51.

System Parameters

Half Linear Cubic Excitation Reference Boundary crack Damping, Stiffness, C Nonlineari ty, amplitude, Frequency, −1 2 Conditions Lengths C1 [ s ] − − − − −2 2 2 ρ 2 ω 1 [s ] C3 [ m s ] [ m s ] [ rad s ] [m]

0.01 37072.80 3.84962x10 8 192.54 SSSS 2.56708 0.025 36514.30 3.78199x10 8 191.09

0.010.16 1.33234x10 6 2.40601x10 9 1154.27 CCSS 5.13416 0.025 1.31453x10 6 2.36375x10 9 1146.53

0.01 52875.30 1.00988x10 9 229.95 CCFF 1.30113 0.025 52348.10 9.92135x10 8 228.80

Table 5-1: Data used for dynamical system analysis for various cases of boundary conditions and half-crack lengths

5.3 Dynamics 2 - A Tool for Bifurcation Analysis

The Dynamics2 softwarepackagewasdevelopedbyNusseandYorkein1998 toenabletheuseofcomputationalnumericalinvestigationsforinvestigating systemdynamics.Priortothis,apreviousedition,Dynamics ,wasofferedby NusseandYorkein1994.Severalotherauthorshave used thissoftware for systemdynamicsinvestigationsnamely,Nusse etal. (1994),Chin etal. (1994) and Nusse et al. (1995). Lim, in 2003, used Dynamics 2 for a preliminary investigation into the effects of nonlinear response modification within coupled oscillators and his numerical results showed that the Dynamics 2

87 Chapter 5: Dynamical System Analysis software package has the capability of resolving a variety of complex nonlinearproblemsveryefficiently.

Dynamics 2 combines different tools for visualising the dynamical systems, suchastoolsforplottingbasinsofattraction,computingsaddletrajectories, automatically searching for all periodic orbits of a specified period, computationofLyapunovexponentsandplottingofbifurcationdiagrams. In Dynamics 2 , there are numerous builtinexamples of mapsand differential equations, particularly the Henon, Logistic, and Piecewise linear maps, amongstothers,anddifferentialequationsincludesGoodwin’sequation,the Lorenz system, the forceddamped pendulum equation, a parametrically excitedDuffingequation,theRösslerequation,andmanymore.Althougha variety of program codes are made available in the form of maps and differential equations, it allows the user to add his/her own mathematical modelwithintheeditormenu.Figure51showsascreendumpoftheprogram codethatiscreatedfortheanalysisoftheDuffingsystemofequation(5.21).

Figure 5-1: Dynamics 2 program code for the cracked plate model and a boundary condition SSSS

88 Chapter 5: Dynamical System Analysis

5.3.1 Bifurcation Analysis

Inthestudyofdynamicalsystems,asuddenqualitativeortopologicalchange canoccurunderthevariationinaparameterofthesystem.Thesechangesin thedynamicsarecalledbifurcations,andtheparametervaluesatwhichthey occur are called bifurcation points. Bifurcations can take place in both continuous systems described by differential equations, and in discrete systems, describedby maps. They definetransitions and instabilities in the systems and are scientifically important. In the literature,there are various typesofkeys,defined,bifurcations,however,inthepresentanalysisaperiod doublingbifurcationcanmostlybeobservedandisanalysedinthefollowing sectionsindetail.Aperioddoublingbifurcationisabifurcationinwhichthe systemswitchestonewbehaviouratintegermultiples of theperiodicity of theoriginalresponse.

5.3.2 Lyapunov Exponents

Numbersthatmeasuretheexponentialattractionorseparationintimeoftwo adjacent trajectories in phase space, with different initial conditions, are called Lyapunov (or Liapunov) exponents. A positive Lyapunov exponent indicatesachaoticmotioninadynamicalsystemwithboundedtrajectories.

Figure 5-2: Explanation of Lyapunov exponent

Byconsideringtwopointsinspace, X0and X0+x 0,andassuminganorbitin that space generated by using some equation or system of equations, then theseorbitscanbethoughtofasparametricfunctionsofavariableliketime. Ifoneoftheorbitsisusedasareferenceorbit,thentheseparationbetween thetwoorbitswillalsobeafunctionoftime.As sensitive dependence can ariseonlyinsomeportionsofasystem,thisseparationisalsoafunctionof

89 Chapter 5: Dynamical System Analysis thelocationoftheinitialvalueandhastheformx(X 0,t) .Inasystemwith attracting fixed points or attracting periodic points, x(X0,t) diminishes asymptotically with time. If a system is unstable, then the orbits diverge exponentially for a while, however they finally settle down. For chaotic points,thefunction x(X0,t) behaveserratically.Itisthereforeappropriate tostudythemeanexponentialrateofdivergenceoftwoinitiallycloseorbits usingtheformula

∆ ( ) 1 |x Xo , t | λ = lim ln (5.3.2-1) t →∞ ∆ ∆ t| x o | |xo |

λ < 0 The orbit attracts to a stable fixed point, or stable periodic orbit. NegativeLyapunovexponentsarecharacteristicofdissipativeornon conservative systems. Such systems exhibit asymptoticstability; the more negative the exponent, the greater the stability. Superstable fixedpointsandsuperstableperiodicpointshaveaLyapunovexponent of λ = −∞ .Thisissomethinganalogoustoacriticallydampedoscillator in that the system heads towards its equilibrium point as quickly as possible.

λ = 0 The orbit is a neutral fixed point or an eventually fixed point. A Lyapunovexponentofzeroindicatesthatthesystemisinsomesortof steadystate mode. A physical system with this exponent is conservative.SuchsystemsexhibitLyapunovstability.

λ > 0 Theorbitisunstableandalsochaotic.Nearbypoints,nomatterhow closetheyare,divergetoanyarbitraryseparation.Allneighbourhoods inthephasespaceareeventuallyvisited.Thesepointsaresaidtobe unstable.Foradiscretesystem,theorbitswouldbeabitlumpylike snow.Foracontinuoussystem,thephasespacewould be a tangled seaofwavylineslikeapotofspaghetti.

Thebifurcationbehaviourofasystemforthecasesofthehalfcracklengths of0.01mand0.025mwithinequation(5.21)isplottednextintermsof

90 Chapter 5: Dynamical System Analysis

• Amplitude of response, x, as a function of normalised excitation frequency, ωandtheLyapunovexponent.

• Amplitude of response, x, as a function of normalised excitation acceleration,andtheLyapunovexponent.

The first mode is examined in detail around the resonant region, and it is observed that at the high frequency end, a new phenomenon occurs. This couldimplychaos.

AllthenumericaldatausedfortheseplotsaretabulatedinTable51.Certain Dynamics 2 commands which are necessary for the smooth plotting of all theseFiguresaresummarisedintheTable52.Theauthorhasincludedsome ofthedefinitionofthesecommandsinAppendixC,thatarenecessarytoget good plots. For a fuller understanding of these commands, the reader is referred Dynamics:NumericalExplorations byNusseandYork(1998),andthe workofLim(2003).

Commands IPP SPC BIFD BIFPI BIFV CON

Bifurcationdiagrams 30 30 1000 1500 1000 Off

Lyapunovexponentdiagrams 30 30 1000 1500 1000 On

Timeplots 1 30 200 0 400 On

PhasePlanes 1 30 200 0 400 On

PoincaréMaps 30 30 200 0 400 Off

Table 5-2: Dynamics 2 command values for plotting

5.3.3 Amplitude of response, x, as a function of normalised excitation frequency, ω and the Lyapunov exponent

Thefollowingobservationshavebeenmade,andsummarisedasfollows:

91 Chapter 5: Dynamical System Analysis

• The first mode is examined around the resonant region, and it is evidentthatthecubicnonlinearcoefficientaccentuatesthenonlinear effect in all three boundary conditions cases, mirroring the effect noticeableinFigures41(b).Therefore,bothmethodsshowthesame nonlineartrends.

• Thesystembecomeschaoticwiththeincreaseinnormalisedexcitation frequency. This can be observed in Figures 53(a) and 53(b), and Figures 54(a) and 54(b) for the two cases of the halfcrack length. Moreover,theroutetochaoscaneasilybeseeninLyapunovexponent plots.

• Anearlyindicationofchaosisobserved,withtheincreaseinhalfcrack lengthfrom0.01mto0.025m,asindicatedinFigures54(a)and5 4(b).

• No indication of chaos is found in the case of the CCFF boundary condition within the normalised excitation frequencyrangeof0–30 (seeFigures53(c)and54(c)).

• SofteningcharacteristicscanbeobservedforthecasesoftheSSSSand CCSSboundaryconditions,andhardeningfeaturescanbefoundinthe CCFFcase(seeFigures53and54).

92 Chapter 5: Dynamical System Analysis

ω ω ω

x x

L L y y a a p p u u n Chaotic n Chaotic o region o region v v

E E x x p p o o n n e e n n t t

(a) SSSS (b) CCSS (c) CCFF

Figure 5-3: Bifurcation diagrams for three different cases of boundary conditions and a half-crack length of 0.01 m for the normalised control parameter, ω

ω ω ω

x x

L L y y a a p p u Chaotic u n n Chaotic region o o region v v

E E x x p p o o n n e e n n t t

(a) SSSS (b) CCSS (c) CCFF

Figure 5-4: Bifurcation diagrams for three different cases of boundary conditions and a half-crack length of 0.025 m for the normalised control parameter, ω

93 Chapter 5: Dynamical System Analysis

5.3.4 Amplitude of response, x, as a function of normalised excitation acceleration and the Lyapunov exponent

Thefollowingarethegeneralpointsobservedfromtheseanalyses:

• Figures 55 and 56 show the bifurcation of x as controlled by the normalised excitation acceleration, and using the first mode

eigenvalue, ω fromTable51.Byincreasingthenormalisedexcitation accelerationtoaveryhighvalue,theperiodicresponse bifurcates to chaos.PositiveLyapunovexponentsfortheserespective Figures show clearindicationofchaos,whilethenegativeLyapunovexponentsshow stable motion. As the response becomes chaotic, higher normalised excitation acceleration is required in each of the three boundary conditionscasesandhalfcracklengths,successively.

• PerioddoublingbifurcationcanbestbeobservedinFigures55(b),5 5(d), 56(b), and 56(d) with the increase of normalised excitation acceleration.InthecaseofSSSS,period2andperiod4motioncanbe found in the region of normalised excitation acceleration 47.70 to 48.90 and 48.90 to 49.15 respectively. Similarly, further period doublingbifurcationsi.e.period8andperiod16can be found in the sameway.Theseperioddoublingbifurcationscontinueandleadfinally tochaoticmotion.

• ItcanbeseenfromtheseFiguresthatwhenthesystembifurcatesto highermultipleofperiodicmotion,ajumpuptothezerolevelinthe Lyapunov exponent plot occur, which is also an indication that the systemmovestohighermultiplesoftheperiod.

• Interesting bifurcations and period doubling routes to chaos are predicated via the Lyapunov exponent in the cases of the SSSS and CCSSboundaryconditions.

• Astheincreaseinhalfcracklengthgoesfrom0.01mto0.025m,the systembifurcatestoperiod2,4,8,andsoon,duetothedecreasein

94 Chapter 5: Dynamical System Analysis

normalised excitation frequency and cubic nonlinear coefficient (see Figures55(b),55(d),56(b),and56(d)).

• These Figures also indicate bifurcation to periodic motion after the chaosregion.

• InthecaseoftheCCFFboundaryconditionandfor each caseof the halfcracklength,the Dynamics2 programarbitrarilydepictstheseas negativevalues,andtheanalysisisautomaticallytruncatedinFigure5 5(e)duetothecomputationallimitationsoftheprogram.

95 Chapter 5: Dynamical System Analysis

49.2 49.7 47.6 48.5 Periodic doubling Z1 x x

L L y y a a p p u u n n o o v v

E E x x p p o o n n e e n n t t

(a) SSSS (b) SSSS – Enlarged view of Z1

714 705.17 680 695 Z2 x x

L L y y a a p p u u n n o o v v

E E x x p p o o n n e e n n t t

(c) CCSS (d) CCSS – Enlarged view of Z2

96 Chapter 5: Dynamical System Analysis

x

Automatic truncation of Dynamics 2 program at normalised excitation acceleration of 0.8 L y a p u n o v

E x p o n e n t

(e) CCFF

Figure 5-5: Bifurcation diagrams for three different cases of boundary conditions and a half-crack length of 0.01 m for the normalised excitation acceleration in the x-direction

97 Chapter 5: Dynamical System Analysis

48.9 49.5 48 47

x x

Z3

L L y y a a p p u u n n o o v v

E E x x p p o o n n e e n n t t

(a) SSSS (b) SSSS – Enlarged view of Z3

703 710 680 690

Z4 x x

L L y y a a p p u u n n o o v v

E E x x p p o o n n e e n n t t

(c) CCSS (d) CCSS – Enlarged view of Z4

Figure 5-6: Bifurcation diagrams for three different cases of boundary conditions and a half-crack length of 0.025 m for the normalised excitation acceleration in the x-direction

98 Chapter 5: Dynamical System Analysis

DiscretenormalisedexcitationaccelerationpointsinFigures55(b),55(d),5 6(b),and56(d)areselectedfortheplottingoftimeplots,phaseplanes,and Poincarémapsforamoredetailedunderstandingofthesystem’sdynamicsin theproceedingsection.However,inthecaseoftheCCFFboundarycondition, theanalysis of the Dynamics 2 program automatically truncates due to the computational limitations of the program, and depicts these as negative values.Therefore,itisnotcurrentlypossibleto observe bifurcations in the caseoftheCCFFboundaryconditionforthecrackedplate.

5.3.5 Time plots, Phase planes, and Poincaré maps

Thetermperiod(s)foraperiodicmotionisdefinedasthenumberofperiod(s) foracycletorepeatitself.Thisdefinitionisappliedhereandtheperiodfor these analyses is measured as T = 2π / ω . It means that cycle repeats itself afterevery Tsecandiscalledperiod1motion.

Thetimeplotsandphaseplanesareplottedforsteadystateintervaloftime i.e.from499.50to500seconds.However,thePoincarémapsareplottedover thetransienttime,from0to500secondsasmostof them converged to a periodicmotionwithjustapoint,thereforericherdiagramsarepreferredand sothesemapsconvergetoapoint,andthisisusuallycalledapointattractor.

Thebreakdownoftheobservationsmadefordifferentnormalisedexcitation accelerationvaluesareasfollows:

5.3.5.1 Figures 5-7(a) to 5-10(a)

• Allthebifurcationdiagramsforthetwocasesofthehalfcracklength indicateperiodicandstablemotion,asdepictedinFigures55(b),5 5(d),56(b)and56(d)withnegativeLyapunovexponents.

• Timeplotsineachboundaryconditioncaseillustrateclearevidenceof aperiodicresponse.

• Inthephaseplanes,alltheFiguresshowstationaryandposttransient motion by the elimination of the initial part of the solutions. These

99 Chapter 5: Dynamical System Analysis

phaseplanesshowsperiodicorbitscorrespondingwiththe bifurcation diagrams.

• AllthePoincarémapsconvergeintosinglepoints.Themapsconsistof afinitenumberofpoints,whichimpliesperiodicmotionbecausethere isonlyonepoint,whichindicatesaperiod1motion.

5.3.5.2 Figures 5-7(b) to 5-10(b)

• Allthebifurcationdiagramsforthetwocasesofthehalfcracklength showperiodicandstablemotionofperiod2,withnegative Lyapunov exponents.

• Allthetimeplotsdepictperiodicmotion.

• The phase plane in each case indicates the periodic doubling phenomenontoperiod2motion,whichisinlinewith the bifurcation diagrams(seeFigures55(b),55(d),56(b)and56(d)).

• The Poincaré maps againconverge to two points, indicating period2 motion.

5.3.5.3 Figures 5-7(c) to 5-10(c)

• The bifurcation diagrams in Figures 55(b), 55(d), 56(b) and 56(d) showaperiod8motion.

• Intimeplots,acarefulobservationshowthatthe oscillation repeats itselfafterevery8intervalsoftime.

• ThePhaseplanesshowcomplicatedandrichphaseplots,however,the orbit repeat itself on the same path, as the simulation time is continued.

100 Chapter 5: Dynamical System Analysis

• ThePoincarémapsillustratehowthetransientmotionconvergesinto8 stationary points. These finite number of points implies period8 motionascorrespondingwiththebifurcationdiagrams.

5.3.5.4 Figures 5-7(d) to 5-10(d)

• The bifurcation diagrams for these cases show chaotic motion with positiveLyapunovexponents.

• In all the time plots the oscillations never repeat. This could be a qualitativevisualindicatorofchaoticmotion.

• In the phase planes a densely filled phase plane is obtained. As the simulation is allowed to continue, the planes would be even more overlaid by repeated orbit crossovers. No dominant single orbit is observedandsothiscoordinatesachaoticmotion.

• The Poincaré maps show a large number of points. This describes a highly nonlinear behaviour which generally indicates chaotic motion. This conclusion is supported from the Lyapunov exponent plots of Figures55(b),55(d),56(b)and56(d).

Finally,itisconcludedfromthesenumericalresultsthatwhenthesystemis excited at its resonant frequency, linear, nonlinear (period doubling), and chaotic responses can be obtained by changing the normalised excitation accelerations(seeFigures55and56).Similarly,aroutetochaoscanalsobe obtainedbychangingthenormalisedexcitationfrequencyataconstantvalue ofthenormalisedexcitationacceleration(seeFigures53and54).

101 Chapter 5: Dynamical System Analysis

Time Plots Phase Planes Poincaré Maps (t = 499.5 – 500sec) (t = 499.5 – 500sec) (t = 0 – 500sec)

Time, t x x

x xɺ

(a) Normalised excitation acceleration at 47.6 (Period-1 motion)

x xɺ

(b) Normalised excitation acceleration at 48.5 (Period-2 motion)

Period 8

x xɺ

(c) Normalised excitation acceleration at 49.2 (Period-8 motion)

x xɺ

(d) Normalised excitation acceleration at 49.7 (Chaotic motion)

Figure 5-7: Dynamical system analysis for a half-crack length of 0.01 m and the boundary condition SSSS

102 Chapter 5: Dynamical System Analysis

Time Plots Phase Planes Poincaré Maps (t = 499.9 – 500sec) (t = 499.9 – 500sec) (t = 0 – 500sec)

Time, t x x

x xɺ

(a) Normalised excitation acceleration at 680 (Period-1 motion)

x xɺ

(b) Normalised excitation acceleration at 695 (Period-2 motion)

x xɺ

(c) Normalised excitation acceleration at 705.17 (Period-8 motion)

x xɺ

(d) Normalised excitation acceleration at 714 (Chaotic motion)

Figure 5-8: Dynamical system analysis for a half-crack length of 0.01 m and the boundary condition CCSS

103 Chapter 5: Dynamical System Analysis

Time Plots Phase Planes Poincaré Maps (t = 499.5 – 500sec) (t = 499.5 – 500sec) (t = 0 – 500sec)

Time, t x x

x xɺ

(a) Normalised excitation acceleration at 47 (Period-1 motion)

x xɺ

(b) Normalised excitation acceleration at 48 (Period-2 motion)

x xɺ

(c) Normalised excitation acceleration at 48.9 (Period-8 motion)

x xɺ

(d) Normalised excitation acceleration at 49.5 (Chaotic motion)

Figure 5-9: Dynamical system analysis for a half-crack length of 0.025 m and the boundary condition SSSS

104 Chapter 5: Dynamical System Analysis

Time Plots Phase Planes Poincaré Maps (t = 499.9 – 500sec) (t = 499.9 – 500sec) (t = 0 – 500sec)

Time, t x x

x xɺ

(a) Normalised excitation acceleration at 680 (Period-1 motion)

x xɺ

(b) Normalised excitation acceleration at 690 (Period-2 motion)

x xɺ

(c) Normalised excitation acceleration at 703 (Period-8 motion)

x xɺ

(d) Normalised excitation acceleration at 710 (Chaotic motion)

Figure 5-10: Dynamical system analysis for a half-crack length of 0.025 m and the boundary condition CCSS

105 Chapter 5: Dynamical System Analysis

5.4 Specialised Numerical Calculation Code written in Mathematica™

In this work the numerical nonlinear dynamical systems analysis has been performedbyemployingtheNDSolveintegratorwithin Mathematica™ forthe integration and prediction of the dynamics of the cracked plate, for given initialconditions.Theprogramcodehasbeendevelopedfortimeplots,phase planesandPoincarémapsandispresentedinAppendixA.Thisprogramcode isusedforthepredictionofchaosforthethreeboundaryconditioncasesand thehalfcracklengthof0.01mbyusingthenumericaldatafromTable51.

1.5

0.2 1

0.1 0.5

0 xɺ 0

-0.1 -0.5

-1 -0.2 -1.5 0.00125 0.0015 0.00175 0.002 0.00225 0.0025 0.00275 0.0005 0.00075 0.001 0.00125 0.0015 0.00175 0.002 x x (a) SSSS (b) CCSS

0.2

0.1

xɺ 0

-0.1

-0.2 -0.0016 -0.0014 -0.0012 -0.001 -0.0008 -0.0006 x

(c) CCFF

Figure 5-11: Poincaré map for the three boundary condition cases and a half- crack length of 0.01 m from the use of specialised code written in Mathematica™

106 Chapter 5: Dynamical System Analysis

Time Plots Phase Planes

Time, t x 0.003 0.6 0.002 0.4 0.001 0.2 x 0 xɺ 0 -0.001 -0.2

-0.002 -0.4

-0.003 -0.6 0 0.1 0.2 0.3 0.4 0.5 -0.003 -0.002 -0.001 0 0.001 0.002 0.003 (a) t = (0 – 0.5) seconds

0.003 0.6 0.002 0.4 0.001 0.2 x 0 xɺ 0 -0.001 -0.2 -0.002 -0.4 -0.003 -0.6 0 0.2 0.4 0.6 0.8 1 -0.003 -0.002 -0.001 0 0.001 0.002 0.003 (b) t = (0 – 1) seconds

0.6 0.003 0.002 0.4 0.001 0.2 x 0 xɺ 0 -0.001 -0.2 -0.002 -0.4 -0.003 -0.6 0 2 4 6 8 10 -0.003 -0.002 -0.001 0 0.001 0.002 0.003 (c) t = (0 – 10) seconds

0.003 0.4 0.002 0.2 0.001 0 x 0 xɺ -0.2 -0.001 -0.002 -0.4 -0.003 -0.6 0 10 20 30 40 50 -0.003 -0.002 -0.001 0 0.001 0.002 0.003 (d) t = (0 – 50) seconds

Figure 5-12: Time plots, and phase planes for a half-crack length of 0.01 m by the use of specialised code written in Mathematica™ and the boundary condition SSSS

107 Chapter 5: Dynamical System Analysis

Time Plots Phase Planes

Time, t x 0.001 1

0.0005 0.5

x 0 xɺ 0

-0.0005 -0.5

-0.001 -1 0 0.1 0.2 0.3 0.4 0.5 -0.001 -0.0005 0 0.0005 0.001 (a) t = (0 – 0.5) seconds

0.002 2

0.001 1

x 0 xɺ 0

-0.001 -1

-0.002 -2 0 0.2 0.4 0.6 0.8 1 -0.002 -0.001 0 0.001 0.002 (b) t = (0 – 1) seconds

0.002 2

0.001 1

x 0 xɺ 0

-0.001 -1

-0.002 -2 0 2 4 6 8 10 -0.002 -0.001 0 0.001 0.002 (d) t = (0 – 10) seconds

0.002 2

0.001 1

x 0 xɺ 0

-0.001 -1

-0.002 -2 0 10 20 30 40 50 -0.002 -0.001 0 0.001 0.002 (d) t = (0 – 50) seconds

Figure 5-13: Time plots, and phase planes for a half-crack length 0.01 m by the use of specialised code written in Mathematica™ and the boundary condition CCSS

108 Chapter 5: Dynamical System Analysis

Time Plots Phase Planes

Time, t x 0.3 0.001 0.2 0.0005 0.1 x 0 xɺ 0 -0.0005 -0.1 -0.001 -0.2 -0.3 0 0.1 0.2 0.3 0.4 0.5 -0.001 -0.0005 0 0.0005 0.001 (a) t = (0 – 0.5) seconds

0.4 0.0015 0.001 0.2 0.0005 x 0 xɺ 0 -0.0005 -0.001 -0.2 -0.0015 -0.4 0 0.2 0.4 0.6 0.8 1 -0.0015-0.001-0.0005 0 0.0005 0.001 0.0015 (b) t = (0 – 1) seconds

0.4 0.0015 0.001 0.2 0.0005 x 0 xɺ 0 -0.0005 -0.001 -0.2 -0.0015 -0.4 0 2 4 6 8 10 -0.0015 -0.001-0.0005 0 0.0005 0.001 0.0015 (c) t = (0 – 10) seconds

0.4 0.0015 0.001 0.2 0.0005 x 0 xɺ 0 -0.0005 -0.001 -0.2 -0.0015 -0.4 0 10 20 30 40 50 -0.0015 -0.001-0.0005 0 0.0005 0.001 0.0015 (d) t = (0 – 50) seconds

Figure 5-14: Time Plots, and phase planes for a half-crack length 0.01 m by the use of specialised code written in Mathematica™ and the boundary condition CCFF

109 Chapter 5: Dynamical System Analysis

Alloftheseplotsshowthatthesystemisstableandmotionisperiodic.The phaseplanesindicateperiodicorbitsinwhichsystemstartsatthecentreand movesoutwardinaformofcircularmotion.CorrespondingPoincarémapsare plotted from the transient times, as most of them converge to period1 motion with just a point, therefore, richer diagrams are preferred and so thesemapsconvergetodarkerareasandfinallytoapoint(seeFigure511).

Hence,itisconcludedfromtheseresultsthatthereisnoclearindicationof chaos in the model of the cracked plate.The Mathematica™ program code givesrelativelygoodresultswhencomparedwith Dynamics2 . Dynamics2 uses differentcommandparameterssuchasIPP,SPC,BIFBI,BIFV,BIFD,andmany more(seeAppendixC)forplotting.Thereforeitisverydifficulttounderstand whathappensbehindtheprocess.Toavoidthiscomplexity,a Mathematica™ program code was developed, which uses the powerful NDSolve function to integrate numerically the two equations of motion. The method used is as specifically stated in the code is StiffnessSwitching. This NDSolve function canpotentiallyuseawidevarietyofotherintegrationmethodologiessuchas Adams, Gear, and RungeKutta methods. The only drawback of using this methodisthecomputationaltimeover Dynamics2 .

110 Chapter 6: Experimental Investigations

Chapter 6

EXPERIMENTAL INVESTIGATIONS

______

Manyexperimentalstudieshavebeencarriedoutin thepastonrectangular plates,andavarietyofnonlinearphenomenahasbeenobserved.Theauthor refersthereadertoNayfehandMook(1979),Chia(1980),andSathyamoorthy (1997) for a detailed review ofthenonlinear vibration of plates. However, rectangularplateswithcrackshavebeenstudiedby Krawczuk et al. (2003) and(2004),Trendafilova(2005),andTrendafilova etal. (2006),andbyothers forthevibrationanalysis.

In order to justify the theoretical predictions as proposed in the previous chapters, experimental measurements are carried out to verify the dependenceofthecrackedaluminiumplate’sfundamental mode shape and resonancefrequencyonthevibrationdisplacementamplitude.Thenonlinear resonance frequency is defined as the frequency at which the maximum vibration amplitude is observed when the excitation frequency is increased throughtherangeofinterestduringafrequencyresponsetest.Thisdefinition isadoptedintheplatetestsandasetofmeasurements are carried out in whichtheexcitationfrequencyisincreasedforagivenvalueofforceuntilthe jumpphenomenonoccursandthecorrespondingvaluesoffrequencyandpeak amplitude are noted. An interesting nonlinear dynamics phenomenon is observedinthetestcaseoftheplatewithasmallcrack.

6.1 Instrumentation

A 500 x 1000 x 10 mm rectangular plate made of aluminium alloy 5083 is selectedfortheexperimentalinvestigations.Thelayoutofthewholesetupis showninFigure61.ItcanbenotedfromthisFigurethattheelectrodynamic exciterisdrivenbyafunctiongeneratorconnectedtoasignalamplifier.A

111 Chapter 6: Experimental Investigations vibrometer controller connected to a spectrum analyzer enables the identification of plate responses through the signal which comes from the HeliumNeon laser vibrometer. The list of the instruments used in this investigationhasbeenincludedinAppendixD.

He-Ne Laser Vibro- meter Laser beam Aluminium plate

Force Transducer Vibrometer Controller

Exciter Power Amplifier

Spectrum Function Analyser Oscilloscope Generator

Figure 6-1: Simple layout of the experimental setup

6.2 Machining Procedure of the Crack in the Aluminium Plate

The machining ofthe crack can inflict additional damage on the pavement anditisdesirabletouseahighprecisionmachinethatfollowscrackswelland producesminimalspallsorfractures.Astraightpartthroughcrackof50x1x 6mmisrequiredtobemadeatthecentreandparalleltothe xdirectionof thealuminiumplatebytheuseofan XYZVerticalMillingmachine.

Foraneasyinitiationofthecrackmachining,ascratchontheplatesurfaceat the starting edges is required. The scratch is made using a diamond point tool.TheplateisplacedontheXYZcoordinatetablesuchthatthedesired place to be cut is below the moving cutting tool. A 2flute solid carbide cuttingtoolofdiameter1mmisused.Themovementofthecuttingtoolis settobe0.1mmforeachdeepcut,with40mmperminutecuttingfeedin

112 Chapter 6: Experimental Investigations the Xdirectionand25mmperminutedownfeedinthe Zdirection.Thecrack propagationinthedesiredpathisachievedbymovingofthe XYZcoordinate table with the plate mounting, at a spindle speed of 2000 rpm under the movingcuttingtoolonthemachine.Thecrackintheplateappearsafteran initialdwellingperiod.Figure63showsa50mmcutonthealuminiumplate.

Figure 6-2: Aluminium plate with crack at the centre

Platecuttingusingprecisionmachinessuchasverticalmillingmachinegivesa betterprofilethanusingamanualtable.Thisisbecauseofthecontrolledand uniformmotionoftheplatewiththemillingmachinetable.Itisalsopossible tocutarepetitiveprofileusingthismillingmachineprocedure.Thisismuch moredifficultwhenitisattemptedusingamanualtable.

6.3 Test Setup

Aheavysteelrigwasspecificallydesignedforthesupportoftheplate’sends insuchawaythatitcouldbeclampedinbetweenthe clamps on the two adjacentedgesoftheplate,andthentheseclampsaretightenedbyaseries ofscrews.Theremainingtwoedgesoftheplateare unconstrained. A rigid guided support made of a steel frame carrying the laser vibrometer is constructed,enablingdisplacementmeasurementstobemadeatanypointon the surface of the plate. The plate is harmonically excited by an electro dynamicexciterwhichimposesnoaddedstiffnessandnoadditionalmasson theplate.Thearrangementofthetworigsandtheelectrodynamicexciteris showninFigure63.Theexcitationoftheexciterismonitoredbymeansofa forcetransducerfittedintotheexciterclampingfixture.Thisalsoprovidesa means for the control of the periodic load, as per the requirement. The excitationpointischosentobeatadistanceof37.5x75mmfromthefixed

113 Chapter 6: Experimental Investigations endsoftheplateinthe xand ydirectionsrespectively.Thesignalfromthe forcetransducerismonitoredbyanoscilloscope,andtheamplitudesignalsin terms of voltages, are monitored by the spectrum analyzer. At different pointsofinterestovertheplate’ssurface,thesignalsarerecordedforfurther analysis.Thesesignalsareultimatelyconvertedinto mechanical amplitudes for the generation of the first mode shape of the plate at the resonance frequency. Care has to be taken to check in all tests that nondesirable vibrationofthetwoframesandlaservibrometeroccurs. The support could otherwise affect the plate displacement signals derived from the laser vibrometer. The complete instrumentation setup used in this work is illustratedinFigure63.

Figure 6-3: Complete assembly of the test rig

Initially, a rough estimate of the natural frequencyofthecrackedandun crackedplatesisobtainedusingahammertest.Theplateisimpactedbythe hammer,andanestimateofthenaturalfrequencyisobtainedfromthepeak inthefrequencyspectra.Anaveragefrommultiplereadingsistakenforeach

114 Chapter 6: Experimental Investigations naturalfrequency.Laterasweeptestaroundthoseaveragedvaluesisdoneto determinetheexactnaturalfrequency.

6.4 Experimental Results

Testsarecarriedoutfortheuncrackedandcrackedplateofcracklength50 mm.Thiscrackisatthecentreoftheplateandisparalleltothe xdirection of the plate, so that comparisons can be made between the theoretical resultsandtheexperimentaldata.Itisnecessaryinitiallytoavoidhavingthe excitationfrequencytooneartotheunstableregionwherethejumpeffect could occur in the first mode. Curves show similar trends of decreasing resonancefrequencywiththeincreaseofdynamicdisplacementamplitudefor agivencracklength.Asmaybeexpectedthetheoretical values are higher thantheexperimentalmeasurementspredominantlyduetotheinherentslip at the clamp edges, and any microscopic flaws or cracks that always exist undernormalconditionsatthesurface,andwithintheinteriorofthebodyof the material. Furthermore, while developing the analytical modal, shaker structureinteractionwasignored,aswasonepossiblenonlineardamping,and anyinitialgeometricaldistortionoftheplate.Itispossiblethatoneormore ofthesefactorscouldhaveplayedasignificantrole,andthiscouldbefurther investigated.

ThemeasuredresponsesoftheplatefromrepeatedtestsareshowninFigures 64 and 65 for an uncracked and cracked plate of crack length 50 mm respectively,andFigure66showsthecombinedeffectonthecrackedand uncrackedplatesofanexcitationlevelof2.5v(Thisexcitationlevel2.5vis equivalenttoaforceof10Napproximately;thisbeing measured from the sensitivityoftheforcetransducer123.78mv/N),thenastheexcitationlevel isincreased,aregionofhysteresiscombinedwithamplitudejumpsandstable andunstablemultivaluedresponsesbecomesevident.

Experimental investigation shows the same trend as explained in early chaptersthatthecrackinfluencestheexcitationfrequencyandamplitude.In thecaseoftheuncrackedplateanexcitationfrequencyof24Hzisobtained, whileitreducesto23.6Hzfortheinsertionofacrackoflength50mm.A similarlydecreasingtrendinfrequenciescanbeobservedasthecracklength

115 Chapter 6: Experimental Investigations atthecentreoftheplateincreases.Inaddition, amplitudeofthevibration increases,thisbeingsummarisedinTable61.

Figure 6-4: First mode shape for an un-cracked aluminium plate of aspect ratio 0.5/1

Figure 6-5: First mode shape for cracked aluminium plate of crack length 50 mm, and aspect ratio of the plate 0.5/1

116 Chapter 6: Experimental Investigations

Un-cracked Cracked

Figure 6-6: Amplitude responses (in terms of voltage signals) for first mode of an un-cracked (white mesh area) and cracked (coloured mesh area) aluminium plates of aspect ratio 0.5/1

Amplitudeatthetipof Frequencyofexcitation AluminiumPlates thefreeendofthe [Hz] aluminiumplate[mm]

Uncracked 24.0 0.90880

Cracked 23.6 0.93696

Table 6-1: Experimental results of first mode of vibration for an un-cracked and cracked aluminium plates

117 Chapter 7: Results and Discussion

Chapter 7

RESULTS AND DISCUSSION

______

The analytical modelling of the cracked plate and their theoretical and experimental analyses have been presented in Chapters 3 to 6. The formulationofthemodelofthecrackedplatewasobtainedinChapter3.The numericalandanalyticaltechniques,includingthemethodofmultiplescales, directnumericalintegrationbytheuseof Mathematica™ ,andfiniteelement analysis,werediscussedinChapter4forthepredictionoftheresponseofthe crackedplatemodelasshowninFigures31to33and35.Anumericalstudy intothesystem’sdynamicswasextendedintoChapter5,whereastudyofthe bifurcationsandthestabilityofthesolutionsviatimeplots,phaseplanesand Poincaré maps, bifurcation diagrams and Lyapunov exponents were summarised. Experimental work is presented in Chapter 6 to justify the theoreticalpredictions.

ThepurposeofthischapteristoexaminetheresultsfromChapters3to6, extending the discussion whereappropriate, and allowing conclusions to be derivedfromtherespectiveresults.

7.1 Analytical Results

A new mathematical model for a cracked plate is proposed for vibration analysis.Thegeneralobservationsaresummarisedasfollows:

• Thenaturalfrequencyresultsforacrackedplatemodelwithdifferent aspectratiosshowsthatthepresenceofalinecrackatthecentreof the plate significantly influences the natural frequency of the first mode,inallthreecasesoftheboundaryconditionsinvestigated,which includedCCFF,CCSS,SSSS(Table31).

118 Chapter 7: Results and Discussion

• Thephysicalreasonthatcrackslowernaturalfrequenciesisduetothe localflexibilityinthevicinityofthecrack,whichinturnreducesthe overallstiffnessofthestructure.Thisisintuitivelydiscussandclearly borneoutinthisresearch.

• Inadditiontotheeffectofthehalfcracklength,thenaturalfrequency isalsoinfluencedifthegeometryoftheplateischanged,inparticular itslengthandthickness(Figure37).

• Theresultsofthepresentnonlineartheoryhavebeenpartiallyverified bymeansofexistinglinearmodels(butnosuchliteraturewasfoundfor theforcednonlinearvibrationanalysisofacrackedplate)asproposed by different authors, namely Stahl and Keer (1972), Solecki (1983), Qian et al. (1991), Krawczuk (1993) and Krawczuk et al. (1994) and (2001), and close agreement was found. The percentage difference betweenthelinearmodelsandthenewnonlinearmodelofthecracked

plate,forthechosenrangeofthe2a/l 1ratioisapproximately(12)% (Table32).

The analytical developments involved using the method of multiple scales, directnumericalintegrationandfiniteelementanalysis.Inthefollowingare summarisedpointswhichemergefromthesestudies:

• TheresultsfromthemethodofmultiplescalesgiveninFigures41,42 and43showedgoodconclusiveresultsforthethreecasesofboundary conditionsi.e.CCFF,CCSS,SSSSandonesetofhalfcracklengthof10 mm.Theeffectofacrackwithintheplatemodelproduced a global effectonthenonlinearresponseoftheoverallsystem.Ahardening spring characteristic has been found in the case of CCSS and SSSS, whereasthesofteningspringcharacteristicisfoundintheCCFFsystem (Figure41forthethreecases).Thisstudycanproducelinearresultsif β we set the nonlinear cubic term i.e. mn equal to zero. Comparison betweenthelinearandnonlinearcrackedplatemodelshasalsobeen madeforthecaseofCCFFonly,whichexactlyemulatesthesoftening nonlinearcharacteristicasshowninFigure41(b).Therelativeratioof

119 Chapter 7: Results and Discussion

nonlinearamplitudetolinearamplitudeisclosetounityforzeroand positivedetuning,againfullyinlinewiththesoftening characteristic observableinFigure41(b).

• Similarly,changingthelocationoftheconcentratedloadovertheplate areaslightlyaffectsthenonlinearmodelofthecrackedplateandthat isevidencedbytheincreasinglywidenonlinearregionastheexcitation locationmovesclosertotheunsupportedcorner(Figure43).

• Thedampingcoefficientplaysanimportantrole,and obviously limits the finite peak amplitude. The peak amplitude shows an increasing trend with the insertion of crack into the model, as expected (see Table41).

0.01

0.008

0.006

0.004

Amplitude [m] 0.002 . Numerical Integration Results - Method of Multiple Scales Results -20 -10 0 10 20 30 Frequency [rad/s]

Figure 7-1: Comparison between method of multiple scales and that of numerical integration

• Numericallyintegratingthegoverningequationofmotion(3.53)within Mathematica™ has produced results that corroborate those of the methodofmultiplescales,andareshowninFigure71.Theamplitudes aremarginallyhigherinthecaseofnumericalintegration.Theover predictionofthesofteningoverhangbythemultiplescalessolutionis undoubtedly due to an overcorrection to the solution from the first orderperturbationcontribution,andtheassumptions that necessarily wentwiththatinordertoobtainaclosedformsolution.

• Thenumericalintegrationresultsgivetheresponseforthefirstmode onlywhereasthemethodofmultiplescalesgenerates results at that

120 Chapter 7: Results and Discussion

resonance condition and also around the region of perfect external εσ tuning,bymeansofthedetuningparameter, mn (equation4.19).

The cracked plate model is investigated in ABAQUS/CAE 6.71, one of the tools for finite element analysis. The following are the general points observedfromtheseresults:

• Thefiniteelementanalysisofthecrackedplatemodel has produced results that corroborate those of the method of multiple scales and numericalintegrationforthecaseofCCFFonly.Thefrequencyresults showadecreasingtrendattheresonancecondition,andsimilarly,the amplituderesultsshowanincreasingtrend,whenusingasmallcrack, againfullyinlinewiththeanalyticalmodel.(Figures 45 to 47, and Table42).Similarresultscanalsobeobtainedforothercasesofthe boundaryconditionssuchasCCSSandSSSS.

• The finite element analysis results are marginally higher; this over predictionisduetothecrackgeometry.IntheFE analysis the crack widthistakenas1mm,whereasithasbeenproposedasacontinuous linespringinthederivationofthecrackedplatemodel(chapter3).

7.2 Numerical Results

Thesubsequentnumericalanalyseswereundertakenbygeneratingproblem specificcodewithinthepublicdomainsoftware Dynamics2 .

• Figures53and54giveplotsofthebifurcatorybehaviourofamplitude response xasafunctionofnormalisedexcitationfrequency,ω .Forthe first response mode, it can be deduced that the cubic nonlinear coefficientaccentuates the nonlineareffectinall thethreecases of boundaryconditions,mirroring the effectnoticeable in the results of the method of multiple scales, numerical integrations, and finite element analysis (Figures 41(b), 44, and Table 42). The softening characteristicisobservedforthecasesofSSSSandCCSS,whereasthe

121 Chapter 7: Results and Discussion

responsebecomesmorehardeninginthecaseofCCFF,againfullyin linewiththeanalyticalmodelofthecrackedplate.

• The calculated Lyapunov exponents support the notion that nonlinearitiescangenerateundesirableresponses,butonlyincasesof very high excitation level for this particular structural configuration, anddamageintheformofacrackatthecentreoftheplate,asshown inFigures53and54.Asthehalfcracklengthisincreased,thesystem getsmorechaotic,withawiderregionofpositiveLyapunovexponents, obviouslyrenderinganypracticalsysteminefficient.

• Similarly, no route to chaos is indicated in the case of CCFF for the normalisedexcitationfrequencyrangeof0–30(Figures53(c)and5 4(c)).

• Figures55and56showsthebifurcatorybehaviour of theamplitude response x as a function of normalised excitation acceleration, accompaniedbyitsrespectiveLyapunovexponent.Forthemostlinear responsefromChapters3to5,aperiodicresponseforawiderangeof excitation values is achieved. As the halfcrack length is increased, evidence of chaos surfaces, with a higher normalised excitation accelerationthatissubsequentlyexpected.

• The results in Figures 55(b), 55(d), 56(b) and 56(d) shows period doubling bifurcations with the increase of normalised excitation acceleration.Inaddition,ajumpuptothezerolevelintheLyapunov exponent plots occurs, and indicates that the system has moved to higherperiodmultiples.

• The Dynamics2 programisautomaticallytruncatedinFigure55(e)due tothecomputationallimitationsoftheprogramandarbitrarilydepicts theseasnegativevaluesincaseofCCFFforthetwosetsofhalfcrack length.

At discrete normalised excitation acceleration points of the above bifurcations,timeplots,phaseplanes,thePoincarémapsaregiveninFigure

122 Chapter 7: Results and Discussion

57 to 510. The following are general observations of the cracked plate modelforthreesetofboundaryconditions.

• Theperiodicorbitsinthephaseplanesmoveawayfromeachotheras theeffectofthepredominantsystemnonlinearityischanged,eitherby manipulationofthecubicnonlinearcoefficientwiththeinsertionofa small crack into the system, or by the normalised excitation acceleration.Andtherefore,thephenomenonbehindthisbehaviour,as shownonthephaseplanes,couldrepresentabifurcationtochaos.

• Complicatedandricherphaseplotsareobtainedforhighernormalised excitation accelerations, indicating likely chaotic motions. However, theorbitsrepeatthemselvesinthesameway,asthesimulationtimeis continued.

• Strange attractors are also obtained in the Poincaré maps for higher value of normalised excitation accelerations, again indicating chaotic motions.

Figures511to514showsthenonlineardynamicsystemanalysisbytheuse ofspecialisedcodewrittenin Mathematica™ .Fromtheseplotsthefollowing isconcluded:

• Thecrackedplatemodelforthetwosetsofhalfcracklengthisstable andthemotionisperiodic,inallthreecasesofboundaryconditions.

• The Poincaré map converges to darker areas, and finally to a point, whichshowsaperiod1motion.

• The only drawback of using this method is the computational time whencomparedwith Dynamics2 .

7.3 Experimental Results

Thefollowingresultswereobtainedfromanexperimentalsetupcarriedout forthevibrationanalysisofthecrackedplate.

123 Chapter 7: Results and Discussion

• The experimental results qualitatively produce the same decreasing trend in frequencies and increasing trend in amplitudes with the insertionofacrackatthecentreofthealuminiumplate.However,the measuredvaluesthroughtheexperimentsaresignificantlylowerthan thosepredictedbythetheoreticalcalculationsbased on approximate techniques.Thiscouldbebecauseofthefactthatmicroscopicflawsor cracks that always exist under normal conditions at the surface and within the interior of the body of material, as explained by Griffith (1920).

• Anexperimentalinvestigationshowsthatthereisalocalstabilityloss inplateswithcracksunderperiodicloading.

7.4 Conclusions

Thethreemethodsofinvestigatingandidentifyingtheresponsebehaviourof thecrackedplatemodel,intheformofaDuffingequation(3.53),haveall shown similar trends with regard to the effect of decreasing natural frequenciesandincreasingamplitudevalues.Dynamical system studies have also indicatedthatchaosis evidentas the system becomes more nonlinear duetoanincreaseinexcitationacceleration.Experimentalresultsfromthe testsconcludethatthisnoveltheoreticalapproachispracticallysignificant.

124 Chapter 8: Conclusions and Future Recommendation

Chapter 8

CONCLUSIONS AND FUTURE RECOMMENDATIONS

______

8.1 Summary

In this dissertation, a new analytical model of a cracked isotropic plate subjected to transverse harmonic excitations has been proposed, based on classicalplatetheory.Thiscanbeusedtodetermineboththecriticalforcing amplitudeaswellasthejumpfrequenciesinsinglemodesystemssuchasthis modeldepicts.Thismodelcanbeappliedtoanysinglemodesystemwitha weak cubic nonlinear geometric term, and damage in the form of a crack. ThiscubicnonlineartermwasgeneratedbytheuseofBerger’sformulation, whichinturnreplacedtheinplaneforceswithintheanalyticalmodelofthe crackedplate,whichthenreducedittothewellknownDuffingequation.In particular, the author studied, both experimentally and theoretically, the nonlinear behaviour, the frequency of excitation, amplitudes, and mode shapes.Threecasesofboundaryconditions—CCFF,CCSSandSSSSandtwo setsofcracklength—wereconsidered.CCFFshowednegativecubicstiffness effectwhereasCCSSandSSSSshowedpositivecubiccharacteristics.

In addition, the nonlinear vibration solutions of the cracked plate were investigatedwhenitwassubjectedtotransverseharmonicexcitations,using the method of multiple scales, and the equation of motion was also numerically integrated by the use of NDsolve within Mathematica™ . Interesting nonlinear behaviour was observed for the primary resonance Ω =ω + εσ εσ condition, mn mn mn ,where mn istheinternaldetuningparameter. Inthisstudyitwasshownconclusively,byusingafirstordermultiplescales approximation, that the nonlinear characteristics of the steadystate

125 Chapter 8: Conclusions and Future Recommendations responses are encoded within the nonautonomous modulation equations. A rectangularcrosssectionplatemadeofaluminiumwithacrackatthecentre of the plate was considered for the numerical analysis. It was found that dependingonincreasedcracklength,thevibration frequencydecreasesand the amplitude increases. Furthermore, it was found that for a square CCFF platethereisanapproximately7.9%reductionin natural frequency in the presence of a centrally located crack of length 0.05 m. However, the reductionin the value of natural frequency is lower for other plate aspect ratios, and linear and nonlinear results tend to coalesce for very low amplituderatios(Table31).Therearelimitedreferencestosuchsystemsin theliteratureastherehavenotbeenmanyreportedphenomenarelatingto nonlinearforcedvibrationofcrackedplatestodate.

FiniteelementanalyseswereperformedusingABAQUS 6.71 fora nonlinear vibratingcrackedCCFFplate.Solutionofthisproblemwasthenpursuedusing astepbystepprocedureinconjunctionwithanimplicitHilberHughesTaylor operatorforintegration.Fromthesolutionproducedbythisanalysisavariety ofinformationwasextracted.Threedimensionalprofilesforvariousmodes, deflection,andfrequencyofvibrationwereobtained(Figures45,46,and4 7).ItwasthenillustratedthattheseFEanalyses werefullyinlinewiththe nonlinear dynamic regimes by means of comparison with the approximate analytical solution via the method of multiple scales, and numerical integration.

Further study of the bifurcations and stability of the solutions via phase planes, Poincaré maps, time plots, bifurcation diagrams and Lyapunov exponents showed that additional and highly complex dynamics could be observed,particularlyinmorestronglyexcitedsystems.Arangeofnumerical results was obtained for the model of a cracked plate in the physical co ordinate space, and these underpinned the fact that general finding of the responseamplitudecharacteristicscouldbeeffectivelyachievedfordifferent combinationsofparameters.

Experimentally, the response of a rectangular, aluminium cracked plate – CCFFtotransverseharmonicexcitationswasobserved.Itwasfoundthatthe amplitude of vibration is a function of the crack length of the plate. The

126 Chapter 8: Conclusions and Future Recommendations modulation frequency, which depends on various parameters such as the amplitudeandfrequencyofexcitation,dampingfactors,etc.,hastobenear thenaturalfrequencyofthefirstmode.Insuchacase,weseeamarginally increaseinamplitudeoftheplateduetopresenceofcrackofthefirstmode componentintheplateresponse.Thisisverysimilartoprimaryresonancein astructuralsystemwheretheclosenessofanexternalexcitationfrequencyto the natural frequencies of the structure dictates the magnitude of the structureresponse.

Theanalyticalmodelwasabletopredictresultsqualitatively similar to the experimentally observed motions, but the results differed quantitatively. Issues, such as the nonlinear damping, internal discontinuities within the plate, shakerstructure interaction, and initial curvature of the plate were ignored,whendevelopingtheanalyticalmodel.Itis,therefore,possiblethat oneormoreofthesefactorsmightbeplayingabiggerrolethanexpected, andthiscouldbefurtherinvestigated.Additionally,theinstabilityregionwas manipulatedbyalteringthetightnessoftheclampededgesoftheplate.Itis understoodinthehighlyexcitedsystemthatcarefulassemblyofthesystem componentsiscriticalforbetteroverallperformance.

Based on the present observations, it can be concluded that conventional methods used for the reduction in frequency response in the cracked plate element,mightinfactleadtoanincreaseintheamplitudeofexcitationfor thefirstmode.Inotherwords,wecansaythataloss of local stability of plates with a small crack is possible under periodic loading. As shown, a simplecrackedplateunderharmonicexcitationcoulddisplaymanydifferent nonlineardynamicphenomena.Thesetypesofnonlinearresonanceshavevery high excitation level to be observed. Such unusual phenomena have been observed in real engineering structures and mechanical systems, therefore thereisapotentialneedtostudysuchphenomenain more detail in other cracked structures. Many physical systems display nonlinear behaviour, but only a watchful eye can recognize that. Most of the time the linear perspective makes one overlook such behaviour in many practical systems. Therefore, it would be advantageous generally to model nonlinearity for overallbetterapproximation.

127 Chapter 8: Conclusions and Future Recommendations

Finally, this research provides some basic theory and understanding of how nonlinearplatesystemscanbemadetobemoreefficient.Ithasalsoinitiated anidentificationofthenonlinearcharacteristicsofcrackedplatestructures. Engineers and scientists could be encouraged to use this new approach for prior understanding of the behaviour of damaged plates and panels. By obtainingabasicunderstanding,anidealandrobustsystemcanultimatelybe configured,andhencemorereliableandefficientindustrial systems can be constructed for a vibration based analysis methodologies, and for further developmentofvibrationbasedhealthmonitoringincrackedplatestructures.

8.2 Future Recommendations

Thereisscopetoimproveandextendthiscrackedplatenonlinearmodelfora crackinarbitrarylocationsandorientations.Suchmodelscouldthenbeused toexplainsomeofthemoreunusualmotionsasdescribedinthisdissertation. Similarly,ifthelocationofthecrackisatthehighstressarea,thenonlinear bendmaybewider,itisthereforenecessarytolookintotheseareasforthe expansionoftheexistingcrackedplatemodel.

Itwouldbeinterestingtoseeifonecouldintroducemorethanonecrackand then study the influence of such cracks on the responses of the plate structures.Similarly,thestudycouldalsobeextendedforallthroughcracks, andellipticalcracks.

Improvementofthesolutiontechniquecouldbepursuedbyimplementinga secondorderperturbationexpansion,andonecouldseehowthisaffectsthe overallresponseofthesystem.

Finally, the solution of the cracked plate nonlinear model can further be extendedforhighermodesofvibrationbymeansofapproximatetechniques.

128 List of References

LIST OF REFERENCES

______

Abrahams R., and Shaw C., (1982), Dynamics: the Geometry of Behaviour , ArialPress,SantaCruz

Aggarwala B.D., and Ariel P.D., (1981), Engineering Transactions , 29 , 295 310,VibrationandBendingofaCrackedPlate.

Alhazza K. A., and Nayfeh A. H., (2001), Proceedings of the 42nd AIAA/ASME/ASCE/AHS/ASC Structures, Structural Dynamics, and Materials Conference , Nonlinear Vibrations of Doublycurved Crossply ShallowShells,Seattle,Washington.

Ali R., and Atwal S.J., (1980), Computers and Structures , 12 , 819823, PredictionofNaturalFrequenciesofVibrationofRectangularPlateswith RectangularCutouts.

Alighanbari H., and Hashemi S.M., (2003), AIAA031206 , 3641, Bifurcation Analysis of an Airfoil Containing a Cubic Structural Nonlinearity and subjectedtoTwoDimensionalIncompressibleFlow.

Alwar R.S., and Nambissan K.N.R., (1983), International Journal for NumericalMethodsinEngineering , 19 ,293303,ThreeDimensionalFinite ElementAnalysisofCrackedThickPlatesinBending.

Au F.T.K., Wang M.F., (2005), Journal of Sound and Vibration , 281 , 1057 1075.SoundRadiationfromForcedVibrationofRectangular Orthotropic PlatesunderMovingLoads.

Bamnios Y., Douka E., and Trochidis A., (2002), Journal of Sound and Vibration, 256 (2),287297,CrackIdentificationinBeamStructuresUsing MechanicalImpedance.

129 List of References

Beidouri Z., Benamar R., and El Kadiri M., (2006), International Journal of NonLinear Mechanics , 41 , 5777, Geometrically NonLinear Transverse VibrationsofCSSSandCSCSRectangularPlates.

Benamar R., Bennouna M.M.K., and White R.G., (1990), 4th International Conference of Recent Advances in Structural Dynamics , 749760, The effectsofLargeVibrationAmplitudesontheFundamentalModeShapeof aFullyClampedSymmetricallyLaminatedRectangularPlate.

BenamarR.,BennounaM.M.K.,andWhiteR.G.,(1991), JournalofSoundand Vibration , 149 ,179–195,TheEffectsofLargeVibrationAmplitudesonthe Fundamental Mode Shape of Thin Elastic Structures, Part I: Simply SupportedandClamped–ClampedBeams.

BenamarR.,BennounaM.M.K.,andWhiteR.G.,(1991), JournalofSoundand Vibration , 175 ,377395,TheEffectsofLargeVibrationAmplitudesonthe Fundamental Mode Shape of Thin Elastic Structures, Part III: Fully clamped Rectangular Isotropic Plates––Measurements of the Mode Shape Amplitude Dependence and the Spatial Distribution of Harmonic Distortion.

BenamarR.,BennounaM.M.K.,andWhiteR.G.,(1993), JournalofSoundand Vibration , 164 (2),295316,TheEffectsofLargeVibrationAmplitudeson theModeShapesandNaturalFrequenciesofThinElasticStructures,Part II:FullyClampedRectangularIsotropicPlates.

Berger H.M., (1955), Journal of Applied Mechanics , 22 , 465472, A New ApproachtotheAnalysisofLargeDeflectionsofPlates.

Berthelot J.M., (1999), Dynamics of Composite Materials and Structures , InstituteforAdvancedMaterialsandMechanics,Springer,NewYork.

BhatR.B.,(1985), JournalofSoundandVibration , 102 (4),493499,Natural Frequencies of Rectangular Plates using Characteristic Orthogonal PolynomialsinRayleighRitzMethod.

130 List of References

Bogoliubov N.N., and Mitropolski Y.A., (1961), Asymptotic Methods in the TheoryofNonlinearOscillations ,GordonandBreach,NewYork.

Cartmell M.P., (1990), Introduction to Linear, Parametric and NonLinear Vibrations ,Springer,NewYork.

CartmellM.P.,Ziegler,S.W.,Khanin,R.&Forehand,D.I.M.,(2003), Applied Mechanics Review , 56 (5), 455492, Multiple Scales Analysis of the DynamicsofWeaklyNonlinearMechanicalSystems.

CawleyP.,andAdamsR.D.,(1979(a)), JournalofStrainAnalysis , 14 (2),49 57,TheLocationofDefectsinStructuresfromMeasurementsofNatural Frequencies.

Cawley P., and Adams R.D., (1979(b)), American Society of Mechanical EngineersDesignEngineeringTechnicalConference ,St.Louis,paper79 DET46,DefectLocationinStructuresbyaVibrationTechnique.

ChampneysA.R.,(2006), TransactionsoftheASME,JournalofComputational and Nonlinear Dynamics , 1, 279282, A Twentyfirst Century Guidebook forAppliedDynamicsSystems.

ChangC.C.,andChenL.W.,(2004), AppliedAcoustics , 65 ,819832,Damage DetectionofaRectangularPlatebySpatialWaveletBasedApproach.

ChatiM.,RandR.,andMukherjeeS.,(1997), JournalofSoundandVibration , 207 (2),249270,ModalAnalysisofaCrackedBeam.

CheungY.K.,andLuV.P.,(1988), EngineeringComputations , 5,134140,An Implicit Implementation of Harmonic Balance Method for Nonlinear DynamicsSystems.

ChiaC.,(1980), NonlinearAnalysisofPlates ,McGrawHill,USA.

ChinW.,OttE.,NusseH.E.,andGrebogiC.,(1994), PhysicalReview E50 (6), 44274444,Grazingbifurcationsinimpactoscillators.

131 List of References

Chu H.N., Hermann G., (1956), Journal of Applied Mechanics , 23 , 532540, InfluenceofLargeAmplitudesonFreeFlexuralVibrationsofRectangular ElasticPlates.

Cole J.D., (1968), Perturbation Methods in Applied Mathematics, Blaisdell, Waltham,MA.

Cole J.D., and Kevorkian J., (1963), Nonlinear Differential Equations and NonlinearMechanics (J.P.LaSalleandS.Lefschetz,eds)AcademicPress, New York, 113120, Uniformly valid Asymptotic Approximations for CertainDifferentialEquations.

CordesR.D.,andJosephP.F.,(1995), InternationalJournalofFracture , 68 , 287314,SurfaceandInternalCracksinaResiduallyStressedPlate

Cornwell P., Doebling S.W., and Farrar C.R., (1999), Journal of Sound and Vibration s, 224 (2), 359374, Application of the Strain Energy Damage DetectionMethodtoPlateLikeStructures.

Dimarogonas A.D., (1996), Engineering Fracture Mechanics , 55 (5), 831857, VibrationofCrackedStructures:AStateoftheArtReview.

ElBikriK.,BenamarR.,andBennounaM.,(2003), ComputersandStructures , 81 , 20292043, Geometrically Nonlinear Free Vibrations of Clamped SimplySupportedRectangularPlates.PatI:TheEffectsofLargeVibration AmplitudesontheFundamentalModeShape.

ElKadiriM.,BenamarR.,(2002(b)), JournalofSoundandVibration , 257 (1), 1962,ImprovementoftheSemiAnalyticalMethod,for Determining the Geometrically Nonlinear Response of Thin Straight Structures: Part II First and Second Nonlinear Mode Shapes of Fully Clamped Rectangular Plates.

ElKadiriM.,BenamarR., JournalofSoundandVibration ,(2003), 264 (1),1 35, Improvement of the SemiAnalytical Method, Based on Hamilton’s Principle and Spectral Analysis, for Determination of the Geometrically

132 List of References

Nonlinear Response of Thin Straight Structures. Part III: Steady State PeriodicForcedResponseofRectangularPlates.

El Kadiri M., Benamar R., White R.G., (2002(a)), Journal of Sound and Vibration , 249 (2),263305,ImprovementoftheSemiAnalyticalMethod, for Determining the Geometrically Nonlinear Response of Thin Straight Structures. Part I: Application to ClampedClamped and Simply SupportedClampedBeams.

Emam S. A., and Nayfeh A. H., (2002), Proceedings of the 43rd AIAA/ASME/ASCE/AHS/ASC Structures, Structural Dynamics, and MaterialsConference ,NonlinearDynamicsofaClampedclampedBuckled Beam,Denver,Colorado.

Epureanu B.I., and Yin S.H., (2004), Computers and Structures , 82 , 2743 2751, Identification of Damage in an Aeroelastic System Based on AttractorDeformations.

FanZ.,2001, InternationalJournalforNumericalMethodsinEngineering , 51 , 619630,TransientVibrationandSoundRadiationofaRectangularPlate withViscoelasticBoundarySupports.

FerriA.A.,(1986), TransactionsoftheASME,JournalofAppliedMechanics , 53 , 455457, On the equivalence of the Incremental Harmonic Balance MethodandtheHarmonicBalanceNewtonRaphsonMethod.

Fujimoto T., Wakata K., Cao F., and Nisitani H., (2003), Materials Science Forum ., Trans. Tech. Publications, Switzerland, 440-441 , 407414, VibrationAnalysisofaCrackedPlateSubjectedtoTensionusingaHybrid MethodofFEMandBFM.

Goncalves J.P.M., de Castro P.M.S.T., (1999), International Journal of PressureVesselsandPiping , 76 ,551560,ApplicationoftheLineSpring Model to Some Complex Geometries, and Comparison with Three dimensionalResults.

133 List of References

GormanD.G.,TrendafilovaI.,MulhollandA.,andHoràčekJ.,(2006), Applied Mechanics and Materials , Trans. Tech. Publications, Switzerland, 5-6, 323330, Vibration of a Coupled Plate/Fluid Interacting System and its implicationforModalAnalysisandVibrationHealthMonitoring.

GriffithA.A.,(1920), PhilosophicalTransactionsoftheRoyalSociety ,London, A221 ,162198,ThePhenomenaofRuptureandFlowinSolids.

Gross B., Srawley J.E., and Brown W.F. Jr., (August 1964), NASA Technical Note D2395, StressIntensity Factors for a SingleEdgeNotch Tension SpecimenbyBoundaryCollocationofaStressFunction.

GuckenheimerJ.,andHolmesP.J.,(1983), NonlinearOscillations,Dynamical Systems,andBifurcationsofVectorFields ,SpringerVerlag,Berlin.

GuitiérrezJ.M.,andIglesias A., (1998), ComputerinPhysics , 12 (5),508619, Mathematica Package for Analysis and Control of Chaos in Nonlinear Systems.

HanW.,PetytM.,(1996(a)), ComputerandStructures , 61 (4),713724,Linear VibrationAnalysisofLaminatedRectangularPlatesusingtheHierarchical FiniteElementMethod.I:ForcedVibrationAnalysis.

HanW.,PetytM.,(1996(b)), ComputerandStructures ,61 (4),705712,Linear VibrationAnalysisofLaminatedRectangularPlatesusingtheHierarchical FiniteElementMethodI:FreeVibrationAnalysis.

Han W., Petyt M., (1997(a)), Computer and Structures , 63 (2), 295308, Geometrically Nonlinear Vibration Analysis of Thin Rectangular Plates usingtheHierarchicalFiniteElementMethod—I:The Fundamental Mode ofIsotropicPlates.

Han W., Petyt M., (1997(b)), Computer and Structures , 63 (2), 309318, Geometrically Nonlinear Vibration Analysis of Thin Rectangular Plates usingtheHierarchicalFiniteElementMethod—II:1stmodeofLaminated PlatesandHigherModesofIsotropicandLaminatedPlates.

134 List of References

Hénon M., (1976), Commun. Mathe. Phys ., 50 , 6977, A Twodimensional MappingwithaStrangeAttractor.

Hirano Y., Okazaki K., (1980), Bulletin JSME , 23 , 732740, Vibration of CrackedRectangularPlates.

HolmesM.H.,(1995), IntroductiontoPerturbationMethods ,SpringerVerlag, NewYork.

HoribeT.,andWatanabeK.,(2006), JSMEInternationalJournal , 49 (3),403 410,CrackIdentificationofPlatesusingGeneticAlgorithm.

Irwin G.R., (1962), Journal of Applied Mechanics , 29 , 651654, Crack ExtensionForceforaPartthroughCrackinaPlate.

Iwato (1951), Trans JSME , 17 (57), 3033, Approximate Calculation for the Frequency of Natural Vibration of a Thin Rectangular Plate the two Adjacent edges of which are Clamped while the other two edges are FreelySupported.(InJapanese)

JezequelL.,SetioH.D.,andSetioS.,(29Jan–1Feb,1990), Proceedingsof the8 th IMACConference ,OrlandoFlorida(USA),334340,NonlinearModal SynthesisinFrequencyDomain.

JonesR.,andMilneB.J.,(1976), JournalofSoundandVibration , 45 ,309316, Application of the Extended Kantorovich Method to the Vibration of ClampedRectangularPlates.

KeerL.M., andSveC.,(1970), InternationalJournalofSolidsandStructures , 6,15451559,OntheBendingofCrackedPlates.

Kerr A.D., (1968), Quarterly of Applied Mathematics , 26, 219229, An ExtensionoftheKantorovichmethod.

Kevorkian J., and Cole J.D., (1981), 34 , Perturbation Methods in Applied Mathematics ,SpringerVerlag.

135 List of References

Khadem S.E., and Rezaee M., (2000(a)), Journal of Sound and Vibration , 236 (2), 245258, Introduction of Modified Comparison Functions for VibrationAnalysisofaRectangularCrackedPlate.

Khadem S.E., and Rezaee M., (2000(b)), Journal of Sound and Vibration , 230 (2),291308,AnAnalyticalApproachforObtaining the Location and Depth of an allover Partthrough Crack on Externally Inplane loaded RectangularPlateusingVibrationAnalysis.

Khanin R., and Cartmell M.P., (1999), Mathematica in Education and Research , 8(2), 1926, Applying the Perturbation Method of Multiple Scales.

Khanin R., and Cartmell M.P., (2001), Journal of Symbolic Computation , 31 (4), 461473, Parallelization of Perturbation Analysis: Application to LargescaleEngineeringProblems.

KhaninR.,Cartmell M.P.,andGilbertA.,(2000), Computer and Structures , 76 (5), 565575, A Computerised Implementation of the Multiple Scales PerturbationMethodusing Mathematica .

Kim Y.J., Chung K.H., Kim J.S., and Kim Y.J., (2004), Key Engineering Materials , Trans. Tech. Publications, Switzerland, 261-263 , 699704, Threedimensional ElasticPlastic Finite Element Analysis of Biaxially LoadedCrackedPlates.

Krawczuk M., (1993), Archive of Applied Mechanics , 63 , 491504, Natural VibrationsofRectangularPlateswithaThroughCrack.

Krawczuk M., (1993), Computers and Structures , 46 (3), 487493, A RectangularPlateFiniteElementwithanOpenCrack.

Krawczuk M., (1994), Finite Elements in Analysis and Design , 15 , 233253, RectangularShellFiniteElementwithanOpenCrack.

136 List of References

Krawczuk M., and Ostachowicz W.M., (1994), Computer Methods in Applied Mechanics and Engineering , 115 , 6778, A Finite Plate Element for DynamicAnalysisofaCrackedPlate.

Krawczuk M., Palacz M., and Ostachowicz W., (2003), Modern Practice in Stress and Vibration Analysis , Materials Science Forum, 440-441 , 187 194, Spectral Plate Element for Crack Detection with the Use of PropagatingWaves.

Krawczuk M., Palacz M., and Ostachowicz W., (2004), Finite Elements in Analysis&Design , 40 ,9911004,WavePropagationinPlateStructuresfor CrackDetection.

KrawczukM.,śakA.,andOstachowiczW.,(2001), ComputersandStructures , 79 , 519532, Finite Elements Model of the Plate with Elastoplatic ThroughCrack.

KuzmakG.E.,(1959), JournalofAppliedMathematicsandMechanics(PMM) , 23 ,730744,AsymptoticSolutionsofNonlinearSecondOrderDifferential EquationswithVariableCoefficients.

LacarbonaraW.,(1999), JournalofSoundandVibration , 221 ,849866,Direct TreatmentandDiscretizationsofNonlinearSpatiallyContinuousSystems.

Lau S.L., and Cheung Y.K., (1981), Transactions of the ASME, Journal of Applied Mechanics , 48 , 959964, Amplitude Incremental Variational PrincipleforNonlinearVibrationofElasticSystems.

Lau S.L., Cheung T.K., Wu S.Y., (1984), Journal of Applied Mechanics , 51 , 837844,NonlinearVibrationsofThinElasticPlates,PartI:Generalized IncrementalHamilton’sPrincipleandElementFormulation.

LauraP.A.A.,DuranR.,(1975), JournalofSoundandVibration , 42 (1),129 135,ANoteonForcedVibrationsofClampedRectangularPlate.

137 List of References

Lee H.E., (1992), Computers and Structures , 43 , 10851089, Fundamental FrequenciesofAnnularPlateswithInternalCracks.

LeeH.P.,LimS.P.,andChowS.T.,(1990), ComputerandStructures , 36 (5), 861869, Prediction of Natural Frequencies of Rectangular Plates with RectangularCutouts.

Lee W.K., and Park H.D., (1999), International Journal of Nonlinear Mechanics , 34 , 749757, Secondorder Approximation for Chaotic ResponsesofaHarmonicallyExcitedSpringpendulumSystem.

Leissa A.W., (1973), Journal of Sound and Vibration , 31 , 257293, Free VibrationsofRectangularPlate.

Leissa A.W., (1978), The Shock and Vibration Digest , 10 (12), 2135, Recent ResearchinPlateVibrations.19731976:ComplicatingEffects.

Leissa A.W., (1984), Proceeding of the 2nd International Conference on Structural Dynamics : Recent Advances, Southampton, 1, 241–260, Non linearAnalysisofPlateandShellVibrations.

Leissa, A.W., (1993), Vibration of Plates , NASA SP160, National Acoustical andSpaceAdministration,Washington,DC

LeleS.P.,andMaitiS.K.,(2002), JournalofSoundandVibration , 257 (3),559 583,ModellingofTransverseVibrationofShortBeamsforCrackDetection andMeasurementofCrackExtension.

LeungA.Y.T.,andZhuB.,(2004), JournalofSoundandVibration , 278 ,699 703,Commentson‘FreeVibrationofSkewMindlinPlatesby pversionof F.E.M.’

LeveyH.C.,andMahonyJ.J.,(1968), JournalofInst.MathsApplics ., 4,282 294,ResonanceinalmostLinearSystems.

LiewK.M.,andWangQ.,(1998), JournalofEngineeringMechanics , 124 ,152 157,ApplicationofWaveletTheoryforCrackIdentificationinStructures.

138 List of References

LiewK.M.,HungK.C.,andLimM.K.,(1994), EngineeringFractureMechanics , 48 (3),393404,ASolutionMethodforAnalysisofCracked Plates Under Vibration.

LighthillM.J.,(1949), PhilosophicalMagazine , XL ,11791201,ATechniquefor RenderingApproximateSolutionstoPhysicalProblemsUniformlyValid.

Lim F.C.N., (2003), PhD Thesis , University of Glasgow, Glasgow, UK, A Preliminary Investigation into the Effects of Nonlinear Response ModificationwithinCoupledOscillators.

Lindstedt M.J., (1882), Astron. Nachr ., 103 , 211220, Ueber die integration einerfürdiestörungstheoriewichtigendifferentialgleichung.

LiuG.R.,andLamK.Y.,(1994), InternationalJournalofSolidandStructures , 31 (21),29652977,CharacterizationofaHorizontalCrackinAnisotropic LaminatedPlates.

Liu Y., Liang L.H., Hong Q.C., and Antes H., (1999), Engineering Fracture Mechanics , 63 , 413424, Nonlinear Surface Crack Analysis by Three DimensionalBoundaryElementwithMixedBoundaryConditions.

Lorenz H.W., (1989), Nonlinear Dynamical Economics and Chaotic Motion, Lecture Notes in Economics and Mathematical Systems, 334, Springer Verlag,Berlin,NewYork.

Lynn E.E., and Kumbasar N., (1967), In:10th Midwestern Mechanics Conference, Fort Colins , 911928, Free Vibration of Thin Rectangular PlateshavingNarrowCrackswithSimplySupportedEdges.

Mackey M.C., and Glass L., (1997), Sciences , 197 , 287289, Oscillations and ChaosinPhysiologicalControlScience.

Maestrello L., Frendi A., and Brown D.E., (1992), AIAA Journal , 30 , 2632 2638,NonlinearVibrationandRadiationfromaPanelwithTransitionto Chaos.

139 List of References

Malatkar P., (2003), PhD Dissertation , Blacksburg Virginia, Nonlinear VibrationsofCantileverBeamsandPlates.

Markström K., Storàkers B., (1980), International Journal of Solids and Structures , 16 ,217229,BucklingofCrackedMembersunderTension.

Mei C., (1973), Computers and Structures , 3, 163174, Finite Element Displacement Method for Large Amplitude Free Flexural Vibrations of BeamsandPlates.

Mindlin R.D., (1951), Journal of Applied Mechanics , 18 , 3138, Influence of RotatoryInertiaandShearonFlexuralMotionsofIsotropicElasticPlates.

Mindlin R.D., (1960), Structural Mechanics , PergamonPress, 199232, Waves andVibrationsonIsotropicElasticPlates.

MoonF.C.,(1987), ChaoticVibrations ,JohnWiley&Sons,Inc.,USA.

Morrison J.A., (1966(a)), SIAM Rev. , 8, 6685, Comparison of the Modified MethodofAveragingandthetwovariableExpansionProcedure.

MorrisonJ.A.,(1966(b)), InprogressinAstronauticsandAeronautics,Methods in Astrodynamics and Celestial Mechanics (R.L. Duncombe and V.G., Szebehely,Eds.),Academic,NewYork, 17 ,117138,GeneralizedMethod ofAveragingandthevonZeipelMethod.

Mukhopadhyay M., (1979), Forsch. Ing.Wes., 45 (4), 111118, A General SolutionforRectangularPlateBending.

MurdockJ.A.,(1999), PerturbationsTheoryandMethods ,SIAM.

NagarajaJ.V.,&RaoS.S.,(1953), JournalofAeronauticalSciences , 20 ,855 856,VibrationofRectangularPlates.

NayfehA.H.,(1986), PerturbationMethodsinNonlinearDynamics ,238314, In Nonlinear Dynamics Aspects of Particle Accelerators, Jowett, J. M., Month,M.,andTurner,S.,eds.,SpringerVerlag,Berlin,Germany.

140 List of References

NayfehA.H.,(1998), NonlinearDynamics , 16 ,105125,ReducedorderModels ofWeaklyNonlinearSpatiallyContinuousSystems.

NayfehA.H.,(2000), NonlinearInteractions ,Wiley,NewYork.

NayfehA.H.&MookD.T.,(1979), NonlinearOscillations ,JohnWiley&Sons, Germany.

NayfehA.H.,(1973), PerturbationMethods ,Wiley,NewYork.

Nayfeh A.H., and Arafat H.N., (2002), Proceedings of the 43 rd AIAA/ASME/ASCE/AHS/ASC Structures, Structural Dynamics, and Materials Conference , Nonlinear Responses of Suspended Cables to PrimaryResonanceExcitations,Denver,Colorado.

Nayfeh A.H., and Chin C.M., (1999), Perturbation Methods with Mathematica™ ,DynamicPress,Virginia.

NayfehA.H.,andLacarbonaraW.,(1997), NonlinearDynamics , 13 ,203220, On the Discretization of Distributedparameter Systems with Quadratic andCubicNonlinearities.

NeogyS.,andRamamurtiV.,(1417Sep.1997), ProceedingofDETC’97ASME DesignEngineeringTechnicalConferences ,Sacramento,California,Effect ofCrackontheNaturalFrequencyofRotatingTwistedBlades.

Nezu K., (1982), Bulletin JSME , 25 , 1623, Free Vibrations of a Simple SupportedRectangularPlatewithaStraightThroughnotch.

Niyogi A.K., and Meyers B.L., (1981), International Journal of NonLinear Mechanics , 16 (5/6), 401408, A Perturbation Solution of NonLinear VibrationofRectangularPlates.

Nusee H.E., and Yorke J.A., (1994), Dynamics: Numerical Explorations , SpringerVerlag,NewYork.

141 List of References

NusseH.E.,OttE.,andYorkeJ.A.,(1995), Physical Review Letters 75 (13), 24822485,Saddlenodebifurcationsonfractalbasinboundaries.

Nusse H.E., York J.A., (1998), Dynamics: Numerical Explorations , second revisedandenlargededition,Springer,NewYork.

OkamuraH.,LiuH.W.,ChuC.andLiebowitzH.,(1969), EngineeringFracture Mechanics , 1,547563,ACrackedColumnunderCompression.

Oliveira C.A.M., De Melo F.J.M.Q., and De Castro P.M.S.T., (1991), EngineeringFractureMechanics , 39 (6),10271035,TheElasticAnalysisof ArbitrarythinshellshavingPartthroughCracks,usingtheIntegratedLine SpringandtheSemiloofShellElements.

PakdemirliM.,NayfehS.A.,andNayfehA.H.,(1995),NonlinearDynamics, 8, 6583, Analysis of OnetoOne Autoparametric Resonances in Cables– Discretizationvs.DirectTreatment.

Perko L.M., (July 1969), SIAM Journal on Applied Mathematics , 17 (4), 698 724,HigherOrderAveragingandRelatedMethodsforPerturbedPeriodic andQuasiPeriodicSystems.

PetytM.,(1968), JournalofSoundandVibration , 8(3),377389,TheVibration CharacteristicsofaTensionedPlateContainingaFatigueCrack.

PierreC.,DowellE.H.,(1985), JournalofAppliedMechanics , 52 ,693697,A Study of Dynamic Instability of Plate by an Extended Incremental HarmonicBalanceMethod.

PoincaréH.,(1886), ActaMath , 8,295344,Surlesintégulièresdeséquations linéaires.

Poincare H., (1903), Science and Hypothesis , Dover reprint, 1952, Mineola, DoverPublicationsNewYork.

142 List of References

Polyzos D., Stamos A.A., and Beskos D.E., (1994), Communications in NumericalMethodsinEngineering , 10 ,8187,BEMComputationofDSIFin CrackedViscoelasticPlates.

Prabhakara M.K., and Chia C.Y., (1977), Journal of Sound and Vibration , 52 (4),511518,NonlinearFlexuralVibrationsofOrthotropicRectangular Plates.

Purbolaksona J., Dirgantara T., and Aliabadi M.H., (March 2006), Key Engineering Materials , 306-308 , 661666, Nonlinear Analysis of Cracked Plates.

QianG.L.,GuS.N.,andJiangJ.S.,(1991), Computers and Structures , 39 , 483487, A Finite Element Model of Cracked Plates Application to VibrationProblems.

RahmanZ.,andBurtonT.D.,(1989), JournalofSoundandVibration , 133 (3), 369379, On Higher Order Methods of Multiple Scales in Nonlinear OscillatorsPeriodicSteadyStateResponse.

RajuI.S.,andNewmanJ.C.Jr.,(1979), Engineering Fracture Mechanics , 11 , 817829, StressIntensity Factors for a Wide Range of Semielliptical SurfaceCracksinFinitethicknessPlates.

Ramachandran J. and Reddy D.V., (1972), AIAA Journal , 10 , 17091710, NonlinearVibrationsofRectangularPlateswithCutouts.

Ramamurti V., and Neogy S., (1998), Mechanics Based Design of Structures andMachines:anInternationalJournal , 26 (2),131143,EffectofCrack ontheNaturalFrequencyofCantileverPlates—aRayleigh–RitzSolution.

RayleighL.,(1945), TheoryofSound .2nded.,MacmillanandCo.London.

RegaG.,LacarbonaraW.,NayfehA.H.,andChinC.M.,(1999), International Journal of NonLinear Mechanics , 34 , 901—924, Multiple Resonances in SuspendedCables:DirectversusReducedorderModels.

143 List of References

Rehfield L.W., (1973), International Journal of Solids and Structures , 581 590,NonlinearFreeVibrationsofElasticStructures.

Ribeiro P., Petyt M., (1999), International Journal of Mechanical Science , 41 (4–5),437–459,NonlinearVibrationofPlatesbytheHierarchicalFinite ElementandContinuationMethods.

RibeiroP.,PetytM.,(1999), JournalofSoundandVibration, 226 (5),955–983, Geometrical Nonlinear, Steadystate, Forced, Periodic Vibration of Plates:partI:ModelandConvergenceStudies.

RiceJ.R.,andLevyN.,(1972), JournalofAppliedMechanics , 3,185194,The PartThroughSurfaceCrackinanElasticPlate.

Rössler O.E., (1976), Physical Letters , 57A , 397398, An Equation for ContinuousChaos.

Rössler O.E., (1979), Physical Letters , 71A , 155157, An Equation for Hyperchaos.

Rossmanith H.P., (Jan. 1985), Journal of Applied Mathematics and Physics, 36 ,166171,OnCrackedPlatesSubjectedtoClassicalBending.

SaavedraP.N.,andCuitinoL.A.,(2002), JournalofVibrationandControl , 8, 5167,VibrationAnalysisofRotorforCrackIdentification.

SathyamoorthyM.,(1988), TheShockandVibrationDigest ,1420,Literature Review:RecentResearchinNonlinearPlateVibrations.

SathyamoorthyM.,(1998), NonlinearAnalysisofStructures ,CRC,USA

Schrödinger E., (1926), Ann. Phys ., 80 , 437490, Quantisierung als Eigenwertproblem.

ShawkiT.G.,NakamuraT.,andParksD.M.,(1989),International Journal of Fracture , 41 , 2338, Linespring Analysis of Surface Flawed Plates and ShellsusingDeformationTheory.

144 List of References

SinghG.,SharmaA.K.,andRaoG.V.,(1990), JournalofSoundandVibration , 142 (1),77–85,LargeAmplitudeFreeVibrationsofBeams––ADiscussionon VariousFormulationsandAssumptions.

Smith D.R., (1985), SingularPerturbation Theory: An Introduction with Applications ,CambridgeUniversityPress,London

Solecki R., (1983), Engineering Fracture Mechanics , 18 , 11111118, Bending VibrationofaSimplySupportedRectangularPlatewithaCrackParallelto oneEdge.

Solecki R., (2022 Oct. 1975), 12 th Annual Meeting of the Society of EngineeringSciences ,Austin,Tex,UnitedStates,373380,IsotropicFinite PlateswithCracks.

SrinivasanA.V.,(1965), AIAAJournal , 3(10),1951–1953,LargeamplitudeFree OscillationsofBeamsandPlates.

Stahl B., and Keer L.M., (1972), International Journal of Solids and Structures , 8, 6991, Vibration and Stability of Cracked Rectangular Plates.

Stanišië M.M., (1957), Journal of Aeronautical Sciences , 24 , 159160, An ApproximateMethodAppliedtotheSolutionoftheProblemofVibrating RectangularPlates.

StanišićM.M., andPayne J.G., (1968), ArchiveofAppliedMechanics , 37 (3), 189195,ARapidlyConvergingTechniqueforVibrationAnalysisofPlates withaDiscreteMassDistribution.

StephenW.,2005, TheMathematica ,5thEdition,CambridgeUniversityPress, UK

StokesG.G.,(1843), Trans.Camb.Philos.Soc , 8,105165,OnSomeCasesof FluidMotion.

145 List of References

Strogatz S.H., (1994), Nonlinear Dynamics and Chaos , AddisonWesley PublishingCompany,USA.

Sturrock P.A., (1957), Proc. Roy. Soc. (London) , A242 , 277299, Nonlinear EffectsinElectronPlasmas.

Su R.K.L., Leung A.Y.T., and Wong S.C., (1998), Key Engineering Materials , 145-149 ,167172,VibrationofCrackedKirchhoff’sPlates.

SzilardR.,(2004), TheoriesandApplicationsofPlateAnalysis ,JohnWiley& Sons,USA.

TengT.L.,LiangC.C.,andLiaoC.C.,(1999), ComputationalMechanics , 23 , 17,1999,Nonlinearforcedvibrationanalysisoftherectangularplatesby theFourierseriesmethod.

ThompsonJ.M.T.,andStewartH.B.,(1986), NonlinearDynamicsandChaos , JohnWiley&Sons,UK.

Thomsen J.J., (1997), Vibrations and Stability – Order and Chaos , McGraw Hill,UK

Timoshenko S., (1940), Theory of Plates and Shells , McGraw Hill Book Company,Inc.,NewYork&London

Timoshenko S.P., (1921), Philosophical Magazine , 41 , 744746, On the CorrectionforShearoftheDifferentialEquationforTransverseVibrations ofPrismaticBars.

TomoticaS.,(1936),PhilosMagn, 21, 745760,TheTransverseVibrationofa SquarePlateClampedatFourEdges.

TrendafilovaI.,(August2005), AppliedMechanicsandMaterials ,Trans.Tech. Publications, Switzerland, 3-4, 309314, A Study on VibrationBased DamageDetectionandLocationinanAircraftWingScaledModel.

146 List of References

TrendafilovaI.,(September2005), KeyEngineeringMaterials , 293-294 ,321 328,AnInvestigationonVibrationbasedDamageDetectioninanAircraft WingScaledModel.

TrendafilovaI.,ManoachE.,CartmellM.P.,KrawczukM.,OstachowiczW.M., and Palacz M., (2006), ModernPracticeinStressandVibrationAnalysis VI ,P.Keogh,eds.,TransTechPublicationsLtd,Switzerland, 5-6,247254, OntheProblemforDamageDetectionofVibratingCrackedPlates.

VanderPolB.,andVanderMarkJ.,(1927), Nature , 120 ,363364,Frequency Demultiplication. van Dyke M., (1975), Perturbation Methods in Fluid Mechanics , Parabolic Press,Stanford.

Von Karman T., (1910), IV , 349 "Festigkeitshprobleme im Machinenbau", EncyklopadiederMathematishenWissenchaften.

Wah T., (1963), International Journal of Mechanical Sciences , 5, 425438, LargeAmplitudeFlexuralVibrationofRectangularPlates.

Wah T., (1964), Journal of Applied Mechanics , 31 , 139140, The Normal ModesofVibrationofCertainNonlinearContinuousSystems.

Wang R.T., and Kuo N.Y., (1999), Structural Engineering and Mechanics , 8(2),151164,NonlinearVibrationofMindlinPlate Subjected to Moving ForcesIncludingtheEffectofWeightofthePlate.

Wang W.C., Hwang C.H., and Lin S.Y., (August 1996), Applied Optics , 35 (22), 45024509, Vibration Measurement by the Timeaveraged ElectronicSpecklePatternInterferometryMethods.

Wang Y.H., Tham L.G., Lee P.K.K., and Tsui Y., (2003), Computers and Structures , 81 , 26212630, A Boundary Collocation Method for Cracked Plates.

147 List of References

Wang,C.,(1948), NACATN1425 ,NonlinearLargeDeflectionBoundaryValue problemsofRectangularPlates

Warburton G.B., (1954), Proceeding of the Institute of Mechanical Engineering , 168 ,371381,TheVibrationofRectangularPlates.

Wei Z., Wen Z., and Turner K.L., (June 59, 2005), Transducers 05 , Coex, SeoulKorea, 1,76871,NonlinearDynamicsofMicroImpactOscillatorsin HighFrequencyMEMSSwitchApplication.

WenY.SandZhixeJ.,(1987), EngineeringFractureMechanics , 26 (1),7582, On the Equivalent Relation of the Line Spring Model: A Suggested Modification.

WestmannR.A.,andYangW.H.,(1967), JournalofAppliedMechanics , 34 , 693701,StressAnalysisofCrackedRectangularBeams.

Whittaker E.T., (1914), Edinburgh Math. Soc. Proc. , 32 , 95116, On the GeneralSolutionofMathieu’sEquation.

Wolf,Alan,Swift,JackB.,Swinny,VastanoH.L.,andJohnA.,(1985), Physica 16D ,285317,DeterminingLyapunovExponentsfromaTimeSeries.

WolframS.,(1996), TheMathematica™Book ,CambridgeUniversityPress,USA

Wu G. Y., and Shih Y. S., (2005), Computers and Structures , 84 , 110, DynamicInstabilityofRectangularPlatewithanEdgeCrack.

Wykes C., (1982), Optical Engineering , 21 (3), 400406, Use of Electronic Speckle Pattern Interferometry (ESPI) in the Measurement of Static and DynamicSurfaceDisplacement.

XiaoY.G,FuY.MandZhaX.D.,(2006), Chaos, Solitons and Fractals , 35 , 460465,BifurcationandChaosofRectangularModeratelyThickCracked PlatesonanElasticFoundationSubjectedtoPeriodicLoad.

148 List of References

Yagiz,N.,andSakmanL.E.,(2006), JournalofVibrationandControl , 12 (1), 8398, Vibrations of a Rectangular Bridge as an Isotropic Plate under a TravelingFullVehicleModel.

YamakiN.,(1961), ZAMMJournalofAppliedMathematicsandMechanics , 41 , 501–510, Influence of Large Amplitudes on Flexural Vibrations of Elastic Plates.

YanY.J.,andYamL.H.,(2002), ComputerandStructures , 58 ,2938,Online Detection of Crack Damage in Composite Plate using Embedded PiezoelectricActuators/SensorsandWaveletAnalysis.

YasudaK.,andToriiT.,(1987), JSMEInternationalJournal , 30 (264),963969, MultiModeResponseofaSquareMembrane.

YoungD.,(1950), JournalofAppliedMechanics , 17 (4),448453,Vibrationof RectangularPlatesbytheRitzMethod.

ZengZ.J,DaiS.HandYangY.M,(1993), InternationalJournalofFracture , 60 , 157167, Analysis of Surface Cracks using the Linespring Boundary ElementMethodandtheVirtualCrackExtensionTechnique.

Note:Totalnumberofreferencesinthisdissertationis205

149 Publications

PUBLICATIONS

______

Israr A. Cartmell M.P., Krawczuk M., Ostachowicz W.M., Manoach E., TrendafilovaI.,ShiskinaE.V.,PalaczM.,(2006),ModernPracticeinStress and Vibration Analysis VI , P.Keogh, eds., Trans Tech Publications Ltd, Switzerland, 5-6, 315322, On Approximate Analytical Solutions for VibrationsinCrackedPlates.

Israr A., Cartmell M.P., Manoach E., Trendafilova I., Ostachowicz W.M., Krawczuk M., śak A., (2007), Paper accepted for publication in ASME JournalofAppliedMechanics ,AnalyticalModellingandVibrationAnalysis of Partially Cracked Rectangular Plates with Different Boundary ConditionsandLoading.

150 List of Figures in Appendices

LIST OF FIGURES IN APPENDICES

Figure B-1: Three stages of ABAQUS/CAE analysis ...... B-1

Figure B-2: Components of the main menu ...... B-3

Figure B-3: The ABAQUS/CAE file environment...... B-6

Figure D-1: Schematic view of the instruments used ...... D-2

A-1 Content of Appendices

CONTENT OF APPENDICES

LIST OF FIGURES IN APPENDICES ...... A-1

CONTENT OF APPENDICES ...... A-2

APPENDIX A...... A-3

SPECIALISED CODE WRITTEN IN MATHEMATICA™...... A-3

A.1 Numerical Integration ...... A-3

A.2 Plotting of Poincaré Map ...... A-3

A.3 Plotting of Time plots and Phase planes ...... A-4

APPENDIX B...... B-1

FINITE ELEMENT ANALYSIS ...... B-1

B.1 Stages of ABAQUS/CAE ...... B-1

B.1.1 Pre-processing ...... B-1

B.1.2 Simulation (ABAQUS /Standard or ABAQUS /Explicit)...... B-2

B.1.3 Post-processing ...... B-2

B.2 Main Components of ABAQUS/CAE...... B-2

B.3 The ABAQUS/CAE File Environment...... B-5

APPENDIX C...... C-1

DYNAMICS 2 COMMANDS ...... C-1

C.1 Numerical Explorations Menu...... C-1

C.2 Plotting...... C-2

C.3 Storing Data...... C-2

C.4 Bifurcation Plotting Commands ...... C-2

C.5 Lyapunov Commands...... C-2

APPENDIX D...... D-1

LIST OF INSTRUMENTS - EXPERIMENTAL WORK...... D-1

A-2 Appendix A: Specialised Code written in Mathematica™

APPENDIX A

SPECIALISED CODE WRITTEN IN MATHEMATICA™

______

A.1 Numerical Integration

λ *p *cos[Ω * t ] eqnt=++ψ′′[] µψ * ′ []( t ω )*2 ψ [] t + βψ *( []) t 3 − mn mn mn mn mn mn mn D system=NDSolve[{eqn==0, ψ [0] ==0, ψ ′[0] ==0}, {ψ } ,{t,0,50),MaxSteps →Infinity, AccuracyGoal →Automatic,PrecisionGoal →Automatic,WorkingPrecsion →20]

Plot[Evaluate[ ψ [t ] /.system],{t,0,50},Frame →True,FrameTicks →Automatic, GridLines →Automatic,FrameLabel →{Time, ψ [t ] }]

Plot[Evaluate[ ψ ′[t ] /.system],{t,0,50},Frame →True,FrameTicks →Automatic, GridLines →Automatic,FrameLabel →{Time, ψ ′[t ] }]

A.2 Plotting of Poincaré Map

Poincare[ W_,C1_,C2_,C3_,rho_,ndrop_,nplot_]:=(T=2* p/W;g[{xold_,yold_}]:= {x[T],y[T]}/.NDSolve[{y'[t] ãC2*x[t]C3*x[t]^3C1*y[t]+rho*Cos[ W*t],x'[t] ãy[t], x[0] ãxold,y[0] ãyold},{x,y},{t,0,T},Method ØStiffnessSwitching, MaxSteps ØInfinity,WorkingPrecision Ø32][[1]]; lp=ListPlot[Drop[NestList[g,{0,0},nplot+ndrop],ndrop],PlotRange ØAll, Frame ØTrue,AxesOrigin Ø{0.00105,0.28},DisplayFunction ØIdentity]);

Show[lp,DisplayFunction Ø$DisplayFunction]

A-3 Appendix A: Specialised Code written in Mathematica™

For the case of SSSS boundary condition

Poincare[192.543,0.16,37072.8,3.96872*10 8,2.56708,200,15000];

A.3 Plotting of Time plots and Phase planes

{,C1,C2,C3,rho}={192.543,0.16,37072.80,3.96872*10 8,9050} solution[tmax_]:=NDSolve[{y'[t] C2*x[t]C3*x[t]^3C1*y[t]+rho*Cos[ *t], x'[t] y[t],x[0] 0,y[0] 0},{x,y},{t,49.5,tmax},Method →StiffnessSwitching, MaxSteps →Infinity,WorkingPrecision →32]; sol1=solution[50];

For time plots graph1[tmin_,tmax_]:=Plot[Evaluate[x[t]/.sol1],{t,tmin,tmax},Frame →True]; graph1[49.5,50];

For phase planes graph[tmin_,tmax_]:=ParametricPlot[Evaluate[{x[t],y[t]}/.sol1],{t,tmin,tmax} ,AxesStyle →{AbsoluteThickness[1]},Frame →True]; graph[49.5,50];

A-4 Appendix B: Finite Element Analysis

APPENDIX B

FINITE ELEMENT ANALYSIS

B.1 Stages of ABAQUS/CAE

A complete ABAQUS/CAE analysis usually consists of three distinct stages which includes preprocessing, simulation, and postprocessing. These three stagesarelinkedtogetherbyfilesasshowninFigureA1.

Pre-processing ABAQUS/CAE Input file; job.inp

Simulation ABAQUS/Standard or ABAQUS/Explicit Output files; job.odb, job.dat job.res, job.fil

Post-processing ABAQUS/CAE

Figure B-1: Three stages of ABAQUS/CAE analysis

B.1.1 Pre-processing Inpreprocessing,themodelofthephysicalproblemisdefinedandcreatesan ABAQUS input file. The model is usually created graphically using ABAQUS/CAEoranotherpreprocessor,althoughtheABAQUSinputfilefora simpleanalysiscanbecreateddirectlyusingatexteditor.

B-1 Appendix B: Finite Element Analysis

B.1.2 Simulation (ABAQUS /Standard or ABAQUS /Explicit) Thesimulation,whichnormallyisrunasabackgroundprocess,isthestagein which ABAQUS/Standard or ABAQUS/Explicit solves the numerical problem defined in the model. Examples of output from a stress analysis include displacements and stresses that are stored in binary files ready for post processing.Dependingonthecomplexityoftheproblembeinganalyzedand thepowerofthecomputerbeingused,itmaytakeanywherefromsecondsto daystocompleteananalysisrun.

B.1.3 Post-processing Inpostprocessing,theresultscanbeevaluatedoncethesimulationhasbeen completed and the displacements, stresses, or other fundamental variables havebeencalculated.Theevaluationisgenerallydoneinteractivelyusingthe VisualizationmoduleofABAQUS/CAE.TheVisualisationmodule,whichreads theneutralbinaryoutputdatabasefile,hasavarietyofoptionsfordisplaying theresults,includingcolourcontourplots,animations,deformedshapeplots, andX–Yplots.

The ABAQUS/CAE is the complete environment that provides a simple, consistent interface for creating models, interactively submitting and monitoring jobs, and evaluating results from simulations. ABAQUS/CAE is divided into modules, where each module defines a logical aspect of the modelling process, for example, defining the geometry, defining material properties,andgeneratingamesh.Whenthemodeliscomplete,ABAQUS/CAE generatesaninputfilethatissubmittedtotheABAQUSanalysisproduct.The inputfilecanalsobecreatedmanually.

B.2 Main Components of ABAQUS/CAE

Figure A2 shows the components that appear in the main window. These componentsare:

Titlebar ItindicatestheversionofABAQUS/CAEthatrunsandthename ofthecurrentmodeldatabase.

B-2 Appendix B: Finite Element Analysis

Menubar The menu bar contains all the available menus. This menu givesaccesstoallthefunctionalityintheproduct. Different menus appear in the menu bar depending on which module selectedfromthecontextbar.

Figure B-2: Components of the main menu

Toolbars Thetoolbarsprovidequickaccesstoitemsthatarealso availableinthemenus.

ModelTree The model tree provides with a graphical overview of the model and the objects that it contains, such as parts, materials, steps, loads, and output requests. In addition, it also provides a convenient, centralized tool for moving between modules and for managing objects. If model databasecontainsmorethanonemodel,themodeltreecan

B-3 Appendix B: Finite Element Analysis

beusedtomovebetweenmodels.

ResultsTree Theresultstreeprovideswithagraphicaloverviewofoutput databasesandothersessionspecificdatasuchasX–Yplots.If we have more than one output database open in successive session,theresultstreetomovebetweenoutputdatabases.

Toolboxarea The toolbox area displays tools in the toolbox that are appropriateforthatmodule.Thetoolboxallowsquickaccess tomanyofthemodulefunctionsthatarealsoavailablefrom themenubar.

Canvasand Thecanvascanbethoughtofasaninfinitescreenorbulletin Drawingarea boardon which we post viewports. The drawing area is the visibleportionofthecanvas.

Viewport Viewportsarewindowsonthecanvasinwhich ABAQUS/CAE displaysmodel.

Promptarea It displays instructions to follow during a procedure; for example,itaskstoselectapointinthepartgeometry.

Messagearea Itprintsstatusinformationandwarningsinthemessagearea. To resize the message area, drag the top edge; to see informationthathasscrolledoutofthemessagearea,usethe scrollbarontherightside.Themessageareaisdisplayedby default,butitusesthesamespaceoccupiedbythecommand line interface. If the command line interface has been recentlyused,clickthetabinthebottomleftcornerofthe mainwindowtoactivatethemessagearea.

Commandline CommandlineinterfaceisusedtotypePythoncommandsand

B-4 Appendix B: Finite Element Analysis interface evaluate mathematical expressions using the Python interpreter that is built into ABAQUS/CAE. The interface includesprimary(>>>)andsecondary(...)promptstoindicate when we must indent commands to comply with Python syntax.Thecommandlineinterfaceishiddenbydefault,but itusesthesamespaceoccupiedbythemessagearea. Click the tab in the bottom left corner of the main window to switchfromthemessageareatothecommandlineinterface. Clickthetabtoreturntothemessagearea.

A completed model contains everything that needs to start the analysis. ABAQUS/CAE uses a model database to store models. When ABAQUS/CAE starts, the Start Session dialog box allows creating a new, empty model databaseinmemory.AfterthestartofABAQUS/CAE,themodeldatabasecan be saved to adisk by selecting File Savefrom the main menu bar and for retrievingamodeldatabasefromadisk,selectFileOpen.

B.3 The ABAQUS/CAE File Environment

Duringexecutionthesystemcreatesbothtemporaryandpermanentfiles,the exactnumberofwhichdependsupontheinstructions contained in the .inp file. For nonlinear problems, the analysis is broken down into a number of steps,eachofwhichcontainsanumberofincrements,eachofwhichrequires a number of iterations to reach a solution. The schematic view of the file environmentisshowninFigureA3.

.dat(‘dat’) It contains the data echo, the data checking information, information about the progress of the solution and the results. The first three are switched on or off by the *PREPRINT card while the results are controlled by the *EL PRINTand*NODEPRINTcards.

.odb('odb') Itistheoutputdatabase,whichcontainsresultstoberead

B-5 Appendix B: Finite Element Analysis

inbytheVisualisationmoduleofABAQUS/CAE.

.res('res') The restart file, containing results to be read back in to ABAQUSitselftocontinueanonlinearanalysisfromwhereit left off on a previous run. This .res file is generated by a *RESTARTcard.

ABAQUS/CAE

Text editor inp .cae

ABAQUS Solver

.dat .res .sta .log .msg .odb

Print results

Figure B-3: The ABAQUS/CAE file environment

.sta('status') It contains a summary of the steps and increments in a nonlinearanalysis.

.log('log') It contains a summary of the system commands invoked duringtheruntogetherwithCPUtiminginformation.

.msg('message') Itcontainsinformationontheprogressoftherun.

The.dat,.sta,.logand.msgfilesarehumanreadable.Theycanbeprinted but are better scanned with the editor to look for errors beforehand, particularlysincethe.datfilecanbeverylarge.The.odband.resfilesare unformattedandsoaren'thumanreadable.

B-6 Appendix C: Dynamics 2 Commands

APPENDIX C

DYNAMICS 2 COMMANDS

______

C.1 Numerical Explorations Menu

T :plottrajectory

DYN :quit&startnewmapordifferentialequation

OWN :quit&createownprocess

P :pausetheprogram

Q :quitdynamicsprogram

BIFM :BifurcationdiagramMenu

BM :BasinofattractionMenu

DIM :DimensionMenu

FOM :Follow(periodic)Menu

LM :LyapunovexponentMenu

POM :PeriodicOrbitMenu

STM :StraddleTrajectoryMenu

UM :UnstableandstablemanifoldManu

C-1 Appendix C: Dynamics 2 Commands

C.2 Plotting

CON :connectsconsecutivedots

PT :plotstimehorizontally

SPC :numberofdifferentialequationstepsinoneperiodoftheforcing period

IPP :numberofiteratesperplot

C.3 Storing Data

DD :DumpDatatodisk

FD :retrievepicturefromdisk

TD :savepicturetodisk

C.4 Bifurcation Plotting Commands

BIFS :bifurcationplotonthescreen

BIFD :numberofthedotstobeplottedforeachparameter

BIFPI :preiteratesforeachparameter

BIFR :specifyingrangeofparametere.g.rho

BIFV :setnumberofvaluesofparameterforbetterpicturequality

PRM :parametertobevaried

C.5 Lyapunov Commands

L :setsnumberofLyapunovexponentstobecomputed(0≤L≤2)

LL :currentvaluesoftheLyapunovexponentstobeprintedonthescreen

C-2 Appendix D: List of Instruments – Experimental Work

APPENDIX D

LIST OF INSTRUMENTS - EXPERIMENTAL WORK

Thelistoftheinstrumentsusedinthisinvestigationandtheirschematicviews areshowninFigureD1.

• PowerAmplifier–ModelPA500LCE

• ElectrodynamicExciter–LINGATECModel407

• HeliumNeonLaserVibrometer–ModelPolytechOFV303 (1milliwattmax/cw)

• VibrometerController–ModelPloytechOFV3001 (100/115/230v50/60Hz)

• SpectrumAnalyser–ModelHP3582A

• FunctionGenerator2Mhz–ModelTG215

• Oscilloscope20Mhz–ModelISOTechISR622

• ForceTransducerIEPE–Model8230

D-1 Appendix D: List of Instruments – Experimental Work

(a) Power Amplifier (b) Electro-dynamics Exciter (c) He-Ne Laser Vibrometer

(d) Vibrometer Controller (e) Spectrum Analyser (f) Function Generator

(g) Oscilloscope (h) Force Transducer

Figure D-1: Schematic view of the instruments used

D-2