A Toolbox for Validation of Mass Spectrometry Peptides Identification

Total Page:16

File Type:pdf, Size:1020Kb

A Toolbox for Validation of Mass Spectrometry Peptides Identification Vol. 25 no. 15 2009, pages 1980–1981 BIOINFORMATICS APPLICATIONS NOTE doi:10.1093/bioinformatics/btp301 Gene expression A toolbox for validation of mass spectrometry peptides identification and generation of database: IRMa Véronique Dupierris1, Christophe Masselon2, Magali Court2, Sylvie Kieffer-Jaquinod2 and Christophe Bruley2,∗ 1Fondation Rhône-Alpes Futur, 89 rue Bellecombe, 69003 Lyon and 2CEA, DSV, iRTSV, Laboratoire d’Etude de la Dynamique des Protéomes, INSERM, U880, Université Joseph Fourier, Grenoble F-38054, France Received on December 5, 2008; revised and accepted on April 30, 2009 Advance Access publication May 6, 2009 Associate Editor: John Quackenbush Downloaded from https://academic.oup.com/bioinformatics/article/25/15/1980/211492 by guest on 24 September 2021 ABSTRACT absolute probability that the observed match is a random event, is Summary: The IRMa toolbox provides an interactive application assigned to each peptide spectrum matches (PSMs). For each query, to assist in the validation of Mascot search results. It allows PSMs are ranked according to their score. Mascot then groups automatic filtering of Mascot identification results as well as manual PSMs into protein hits. A hit contains not only all proteins covered confirmation or rejection of individual PSM (a match between a by the same set of PSMs but also all proteins covered by a subset fragmentation mass spectrum and a peptide). Dynamic grouping and of these PSMs. A hit score, based on its matching PSM scores, is coherence of information are maintained by the software in real time. assigned to each protein. Validated results can be exported under various forms, including an While existing tools (Bouyssié et al., 2007) validate whole hits, identification database (MSIdb). This allows biologists to compile selecting confident PSMs and rejecting dubious ones undoubtedly search results from a whole study in a unique repository in order to allow more accurate identification. When validating whole hits, provide a summarized view of their project. IRMa also features a fully false PSMs can still be considered in the result. On the other automated version that can be used in a high-throughput pipeline. hand, validation at the PSM level affects the grouping consistency Given filter parameters, it can delete hits with no significant PSM, (and hits properties such as score and coverage): rejecting PSM regroup hits identified by the same peptide(s) and export the result without grouping update leads to redundancy of the protein hits’ to the specified format without user intervention. list. IRMa allows validation at the PSM level, while circumventing Availability: http://biodev.extra.cea.fr/docs/irma (java 1.5 or higher the associated difficulties. needed) Contact: [email protected] 3 FEATURES IRMa uses the Mascot Parser distributed free of charge by Matrix 1 INTRODUCTION Science to build an identification result from the native ‘.dat’ files The Mascot search engine uses mass spectrometry data to identify generated by the Mascot server. The parser can be invoked with proteins by matching experimental and theoretical peptide mass different report parameters, such as the number of hits or significance spectra (Aebersold and Mann, 2003). However, it is necessary to thresholds. At this stage, the same information and grouping shown eliminate false matches (Baldwin, 2004; Nesvizhskii and Aebersold, in the Mascot result page are available but displayed in a structured 2004) in order to avoid incorrect protein identification. and accessible layout by IRMa (see Fig. 1). PSMs relevant for The Mascot html output is not designed for this kind of protein identifications are flagged as significant. A PSM having the validation, and exporting the data to Excel for subsequent same sequence as a significant one but associated to another query validation results in loss of data consistency. Moreover, validation and with a lower score are flagged as duplicated. being the first step in data interpretation, subsequent data mining For validation purposes, in addition to the significant and often requires compilation of numerous search results. IRMa is duplicated categories, IRMa introduces a third category in which a validation toolbox for Mascot identification results that allow ambiguous PSMs are classified. This third category regroups users to validate and export the identified proteins and their PSM to PSMs rejected by filtering and that do not contribute to protein various formats. Its main originality is to filter matches rather than identification. While PSMs’ classification into these categories identified proteins. can be done manually, several filters applied on the Mascot parser results are proposed. They provide rules to assign PSMs to significant or ambiguous categories and can be based on PSM 2 VALIDATING HITS VERSUS PSM ranks, scores, on mandatory post-translational modifications or For each submitted spectrum (query), Mascot attempts to match on PSMs properties expression. This automatic classification can up to 10 peptides from a sequence database. A score, based on the always be adjusted; the user can restore PSMs from the ambiguous group to the significant group or vice versa. Nevertheless, IRMa ∗To whom correspondence should be addressed. will ensure that the exact same sequence cannot appear twice 1980 © The Author 2009. Published by Oxford University Press. All rights reserved. For Permissions, please email: [email protected] [18:08 26/6/2009 Bioinformatics-btp301.tex] Page: 1980 1980–1981 IRMa 4 LARGE-SCALE STUDIES Biological studies often require the comparison of numerous samples. Furthermore, each sample can be fractionated before analysis to generate several aliquots, which in turn result in as many Mascot searches. One of the major challenges facing the biologist resides in the high redundancy in identification lists. Compiling multiple search results through multiple Excel files or html results pages is impractical. In order to overcome this difficulty, the creation of a unique database, containing the identification results of a whole project, allows the user to access information on all analyzed samples at once. IRMa was used in our laboratory to compile data from a large- scale proteomics study of A. thaliana chloroplasts. The MSIdb Fig. 1. IRMa snapshot. User can browse the submitted spectra (queries) was compiled in a fully unattended mode after providing the (1) or the identified protein hits and PSMs (2). The main component of the software with filter parameters and an output path. The database Downloaded from https://academic.oup.com/bioinformatics/article/25/15/1980/211492 by guest on 24 September 2021 interface displays query statistics or, as shown here, hit information. In this was populated using search results from ∼585 000 Mascot queries case, the upper part (3) shows the master protein description and properties generated from ∼500 LC–MS/MS analyses, with minimal user together with the lists of same-set and sub-set proteins. PSMs classified in intervention. significant, ambiguous and duplicated categories are displayed for the current hit (4). 5 PERSPECTIVES IRMa allows generation of an MSIdb for a given project. To enhance data mining of comprehensive identification catalog, it significant in the category. Dynamic classification has an impact would therefore be helpful to integrate identification databases ambiguous on protein hits: when a PSM is declared , it becomes with information from other data sources (e.g. web-based public irrelevant to proteins identification. IRMa takes into account these repositories). We are currently working on a tool to achieve changes to ensure consistency of information such as protein this aim and to further investigate identified proteins. Grouping coverage and identification score and dynamically proposes new identifications at the whole database level to remove redundancy protein hit sets and sub-sets based on significant PSMs. For among samples or comparing multiple experiments are some of the instance, two proteins of a same hit that initially shared only available operations. a sub-set of PSMs can become indistinguishable (all significant PSMs are shared) if specific PSMs are judged ambiguous. Another possibility is the merge of two distinct hits into a unique one ACKNOWLEDGEMENTS ambiguous if discriminating PSMs are flagged as . For example, We thank Matrix Science technical support team for their timely given the following two hits, ACTG_HUMAN {pep_63, pep_133, answers to our requests, the IRMa workgroup for their help in pep_167, pep_254, pep_311} and Q53G99_HUMAN {pep_63, application specification and design, and all EDyP Laboratory team , pep_139 pep_133 pep_139, pep_254, pep_311}, if PSM is declared members for testing and feedback. ambiguous, IRMa will propose grouping Q53G99_HUMAN and ACTG_HUMAN as the same hit. Funding: CEA, INSERM and the Rhône-Alpes Génopôle. The user can validate new grouping proposed by the application Conflict of Interest: none declared. by merging hits that become sub-sets or same sets of another and by deleting hits that no longer contain any significant PSM. This implies that hits are reordered according to their scores. REFERENCES The validated result can finally be exported under various forms: Aebersold,R. and Mann,M. (2003) Mass spectrometry-based proteomics. Nature, 422, to the widely used Microsoft Excel format; to a PDF format 198–207. 1 including graphical representation of annotated spectra or to Baldwin,M. (2004) Protein identification by mass spectrometry: issues to
Recommended publications
  • MALDI-TOF/TOF MS Protocols Objectives
    MALDI-TOF/TOF MS Protocols Objectives: 1. To be familiar with the basic operation of the MALDI-TOF-TOF mass spectrometer. 2. To use MALDI-TOF-TOF mass spectrometer for peptide mass fingerprinting, peptide sequencing, and in source decay sequencing of intact proteins. Protocols included: 1. Obtaining a peptide mass fingerprint with MALDI-TOF 2. ISD and T3 sequencing 3. In-gel tryptic digest 4. Sample spotting with the dried droplet method 5. Ultraflex III Operation for Obtaining a PMF Introduction: MALDI refers to the ion source, i.e., the Matrix Assists in Laser Desorption/Ionization of the analyte. The matrix, is co-crystallized with the sample, it must absorb light maximally at 337 nm (wavelength of the laser), and must participate in proton transfer with the analyte. TOF refers to the mass analyzer. The mass analyzer separates ions based on their Time Of Flight. Flight time is a function of the mass to charge ratio (m/z) of the analyte. TOF-TOF means that this is a tandem mass spectrometer, so an ion can be selected for, fragmented, and mass analyzed again. Tandem mass spectrometry, MS/MS, can provide additional information for structural elucidation of the analyte in question. The Ultraflex III is a MALDI-TOF-TOF mass spectrometer that will be used in this laboratory (Figure 1). A suite of software is used with this instrument. Acquisition of mass spectra is done in Flex Control, spectrum processing and annotation in Flex Analysis, and additional data processing and data searching is done in BioTools and Sequence Editor (Bruker). 1 Figure 1: Schematic of the Ultraflex III MALDI-TOF-TOF.
    [Show full text]
  • Optimized Search Strategy to Maximize PTM Characterization and Protein Coverage in Proteome Discoverer Software
    Application Note 658 Note Application Optimized Search Strategy to Maximize PTM Characterization and Protein Coverage in Proteome Discoverer Software Xiaoyue Jiang1, David Horn1, Michael Blank1, Devin Drew1, Bernard Delanghe2, Rosa Viner1, Andreas FR Huhmer1 1Thermo Fisher Scientific, San Jose, CA, USA; 2Thermo Fisher Scientific, Bremen, Germany Key Words This is probably due to the heterogeneous nature of the Protein coverage, post-translational modification (PTM), Proteome samples (heavily modified or lightly modified), acquisition Discoverer, SEQUEST, Byonic, Mascot, MaxQuant, MS Amanda, FDR methods (acquired at high resolution or low resolution), database searching parameters (mass tolerance, Goal modifications), and search filters (false discovery rate To evaluate several commonly used search algorithms to maximize (FDR)) that were used in those comparisons, all of which peptide/protein identifications and PTM signatures for different types can affect the results of the assessment. of samples. A more standardized approach, in which optimized instrument method and search parameters as well as the search filters included as part of the comparative study, Introduction must be applied so clear conclusions of the search engine New advances in mass spectrometry enable comprehensive comparison can be drawn. characterization and accurate quantitation of complete proteomes. However, complex biological questions can In this study, we evaluated several widely used search only be answered through sophisticated data processing algorithms including SEQUEST, Mascot, Byonic, and using multiple state-of-the-art proteomics search engines. MS Amanda available in Thermo Scientific™ Proteome The list of identified peptides and proteins returned from Discoverer™ 2.0 software, and the Andromeda search such search engines ultimately determines the conclusions engine in MaxQuant™ software on two representative for the whole experiment and thus high confidence in the datasets acquired on high-resolution, accurate mass results is critical.
    [Show full text]
  • Protein Identification by Mass Spectrometry
    Outline Terminology • Database search types • Mass tolerance • Peptide Mass Fingerprint • MS/MS search (PMF) • FASTA • Precursor mass-based • Sequence tag • Tandem MS • Precursor mass • Results comparison across programs • Product ion • Manual inspection of • Theoretical mass results • Experimental mass • Sequence tag • de novo sequencing Center for Mass Spectrometry and Proteomics | Phone | (612)625-2280 | (612)625-2279 Three Strategies for Protein Inference from Peptide MS or MS/MS Data Peptide Mass Peptide MS/MS DATA INPUT: List (MS1) (MS2) Peptide Mass Precursor Sequence- Search TYPE: Fingerprint Mass-based based (PMF) (historical) (de novo or 2 mass tag) 1 3 Center for Mass Spectrometry and Proteomics | Phone | (612)625-2280 | (612)625-2279 Peptide Mass Fingerprint (PMF) 1 • Historical: after 1D or 2D in-gel Digestion of single bands or spots • Current applications: limited; decreasing utility Component Description Input (Data) Peptide Mass List • Mass type (Mr or MH+) • Average or Monoisotopic Target Protein FASTA Sequence Database Search Parameters Proteolytic enzyme # Missed enzyme cleave sites Amino acid modifications Mass tolerance Center for Mass Spectrometry and Proteomics | Phone | (612)625-2280 | (612)625-2279 1 Peptide Mass Fingerprint: INPUT GLSDGEWQQVLNVWGK VEADIAGHGQEVLIR A) In gel Trypsin LFTGHPETLEK UNKNOWN PROTEIN (amino acid sequence): TEAEMK GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTG digestion ASEDLK HPETLEKFDKFKHLKTEAEMKASEDLKKHGTVVLT HGTVVLTALGGILK ALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLE GHHEAELKPLAQSHATK FISDAIIHVLHSHPGNFGADAQGAMTKALELFRND
    [Show full text]
  • Large-Scale Database Searching Using Tandem Mass Spectra: Looking up the Answer in the Back of the Book
    REVIEW Large-scale database searching using tandem mass spectra: Looking up the answer in the methods back of the book Rovshan G Sadygov, Daniel Cociorva & John R Yates III .com/nature e Database searching is an essential element of large-scale proteomics. Because these .natur w methods are widely used, it is important to understand the rationale of the algorithms. Most algorithms are based on concepts first developed in SEQUEST and PeptideSearch. Four basic approaches are used to determine a match between a spectrum and http://ww sequence: descriptive, interpretative, stochastic and probability–based matching. We oup r review the basic concepts used by most search algorithms, the computational modeling G of peptide identification and current challenges and limitations of this approach for protein identification. lishing b Pu An unintended consequence of whole-genome sequenc- to matching tandem mass spectra of peptides whose ing has been the birth of large-scale proteomics. What exact sequences may not be present in the database. Nature drives proteomics is the ability to use mass spectrome- Space limitations restrict a detailed description of all try data of peptides as an ‘address’ or ‘zip code’ to locate algorithms in this rapidly expanding field. Also, some 2004 proteins in sequence databases. Two mass spectrom- algorithms are proprietary, and thus, details on how © etry methods are used to identify proteins by database they work are unknown. This review should supple- search methods. The first method uses a molecular ment and update earlier reviews on database search weight fingerprint measured from a protein digested algorithms19–24. with a site-specific protease1–5.
    [Show full text]
  • Ptmap—A Sequence Alignment Software for Unrestricted, Accurate, and Full-Spectrum Identification of Post-Translational Modification Sites
    PTMap—A sequence alignment software for unrestricted, accurate, and full-spectrum identification of post-translational modification sites Yue Chena,b,1, Wei Chenc, Melanie H. Cobbc, and Yingming Zhaoa,2 Departments of aBiochemistry and cPharmacology, University of Texas Southwestern Medical Center, Dallas, TX 75390; and bDepartment of Chemistry and Biochemistry, University of Texas, Arlington, TX 76019 Contributed by Melanie H. Cobb, November 20, 2008 (sent for review June 12, 2008) We present sequence alignment software, called PTMap, for the over the integers between Ϫ100 and ϩ 300, a list of 4,800 possible accurate identification of full-spectrum protein post-translational modified peptides is generated from the single peptide sequence. modifications (PTMs) and polymorphisms. The software incorpo- The exponentially increased size of the peptide pool and the high rates several features to improve searching speed and accuracy, similarity among peptide sequences derived from the full spectrum including peak selection, adjustment of inaccurate mass shifts, and of possible PTMs make it difficult to remove most of the false precise localization of PTM sites. PTMap also automates rules, positives, let alone all of them. Second, a PTM could happen at based mainly on unmatched peaks, for manual verification of several residue [e.g., protein methylation (18)], modified peptides identified peptides. To evaluate the quality of sequence alignment, with adjacent PTM sites are likely to have similar theoretical we developed a scoring system that takes into account both fragmentation patterns, and hence similar statistical scores. Third, matched and unmatched peaks in the mass spectrum. Incorpora- in silico-generated peptide sequence pools used for sequence tion of these features dramatically increased both accuracy and alignment are unlikely to include all of the peptide sequences sensitivity of the peptide- and PTM-identifications.
    [Show full text]
  • Bioinformatics Methods for Protein Identification
    BIOINFORMATICS METHODS FOR PROTEIN IDENTIFICATION USING PEPTIDE MASS FINGERPRINTING DATA _______________________________________ A Dissertation presented to the Faculty of the Graduate School at the University of Missouri-Columbia _______________________________________________________ In Partial Fulfillment of the Requirements for the Degree Doctor of Philosophy _____________________________________________________ by ZHAO SONG Dr. Dong Xu, Dissertation Supervisor MAY 2009 The undersigned, appointed by the dean of the Graduate School, have examined the [thesis or dissertation] entitled BINFORMATICS METHODS FOR PROTEIN IDENTIFICATION USING PEPTIDE MASS FINGERPRINTING presented by Zhao Song, a candidate for the degree of [doctor of philosophy of Computer Science], and hereby certify that, in their opinion, it is worthy of acceptance. Professor Dong Xu Professor Ye Duan Professor Chi-Ren Shyu Professor Dmitry Korkin Professor Sounak Chakraborty ACKNOWLEDGEMENTS I would like to thank my advisor Dr. Dong Xu who is an experienced researcher and has always been supportive through the years of my study. With his guidance, I have finished the project successfully and learned how to do research and write papers. Dr. Dong Xu is a great mentor in life as well. It has been great experience working in his lab. I would like to thank Dr. Chi-Ren Shyu, Dr. Duan Ye, Dr. Sounak Chakraborty and Dr. Dmitry Korkin who are willing to serve on my committee. I acknowledge Dr. Chi- Ren Shyu for his valuable advices on database search issue. I acknowledge Dr. Sounak Chakraborty for his suggestions on the statistic model design. I acknowledge Dr. Duan Ye and Dr. Dmitry Korkin for the discussions on many detailed problems. I would like to thank Dr.
    [Show full text]
  • The Power of Three in Cannabis Shotgun Proteomics: Proteases, Databases and Search Engines
    proteomes Article The Power of Three in Cannabis Shotgun Proteomics: Proteases, Databases and Search Engines Delphine Vincent *, Keith Savin , Simone Rochfort and German Spangenberg Agriculture Victoria Research, AgriBio, Centre for AgriBioscience, Bundoora, Victoria 3083, Australia; [email protected] (K.S.); [email protected] (S.R.); [email protected] (G.S.) * Correspondence: [email protected]; Tel.: +61-3-90327116 Received: 28 May 2020; Accepted: 12 June 2020; Published: 15 June 2020 Abstract: Cannabis research has taken off since the relaxation of legislation, yet proteomics is still lagging. In 2019, we published three proteomics methods aimed at optimizing protein extraction, protein digestion for bottom-up and middle-down proteomics, as well as the analysis of intact proteins for top-down proteomics. The database of Cannabis sativa proteins used in these studies was retrieved from UniProt, the reference repositories for proteins, which is incomplete and therefore underrepresents the genetic diversity of this non-model species. In this fourth study, we remedy this shortcoming by searching larger databases from various sources. We also compare two search engines, the oldest, SEQUEST, and the most popular, Mascot. This shotgun proteomics experiment also utilizes the power of parallel digestions with orthogonal proteases of increasing selectivity, namely chymotrypsin, trypsin/Lys-C and Asp-N. Our results show that the larger the database the greater the list of accessions identified but the longer the duration of the search. Using orthogonal proteases and different search algorithms increases the total number of proteins identified, most of them common despite differing proteases and algorithms, but many of them unique as well.
    [Show full text]
  • Using Mascot to Characterise Protein Modifications
    Using Mascot to characterize Protein modifications ASMS 2003 1 Post-translational Modifications (PTMs) • Help understand complex biological systems • Phosphorylation is one of the most important protein PTMs • Mascot allows up to 9 variable modifications to be specified at a time • Use variable modifications sparingly, follow it by error tolerant search ASMS 2003 2 ASMS 2003 This slide shows that two proteins have scores above the threshold. One of them is beta-Casein variant CnH. 3 ASMS 2003 The other protein is beta-casein precursor. 4 ASMS 2003 When we look at the detail, we see that Serine or Threonine is phosphorylated. 5 ASMS 2003 With Peptide Mass Fingerprint, it is not possible to map the modification sites. One needs tandem mass spectrometry to do that. 6 ASMS 2003 This slide shows at least 5 proteins with scores above the threshold. 7 ASMS 2003 Four peptides identified in this slide have scores higher than 34, the significance threshold. Deamidation seems to be a common modification for all of them. 8 ASMS 2003 Here we see four other peptides that have scores higher than the significance threshold. 9 ASMS 2003 Let’s focus on Query 34, where the ion score was 101. We see a rich MS/MS spectrum. 10 ASMS 2003 Most of the Y ions have been identified. 11 ASMS 2003 From the error graph, one can see that the calibration is quite good. I would believe that this peptide is deamidated. 12 ASMS 2003 This example shows a phosphorylated peptide. There are two possible phosphorylation sites, but the score for phospho-serine (102) is much, much greater than that for phospho-threonine.
    [Show full text]
  • John Cottrell, David Creasy & Darryl Pappin
    PROFILE John Cottrell, David Creasy & Darryl Pappin Pioneers in proteomics data analysis reflect on what to focus on in computational biology. n 1993, five papers—authored independently at greater scales. For instance, when we first Iby William Henzel, Peter James, Matthias started developing Mascot, we thought that Mann, Darryl Pappin and John Yates—showed 300 spectra in a single search would be a rea- that peptide masses measured by a mass spec- sonable limit. How wrong we were! By 2003, it trometer could be used as a ‘fingerprint’ to was possible to analyze 1 million spectra in a identify proteins. This insight spurred global single search, and now there is effectively no analyses of the proteome and the need for new limit. When there have been big advances in computational tools. At the 2012 international experimental technology, as there have been in meeting of the Human Proteome Organization proteomics and genomics, new ideas in compu- (HUPO), John Cottrell and David Creasy tational biology have been needed. received the HUPO Award for Science and Technology for developing an algorithm cre- Are there big opportunities today for ated by Pappin into the widely used Mascot commercialization of academic ‘omics David Creasy & John Cottrell software package for peptide identification and software? protein inference. Nature Biotechnology spoke D.C., J.C. & Darryl Pappin: In August 2001, the supposed benefits of running Mascot ‘on with Cottrell, Creasy and Pappin to understand Genome Technology magazine profiled ‘pro- the cloud’. In a presentation made in 2004, Mascot’s route to successful commercialization teinformatics’—not a term that ever caught Darryl León of Lion Biosciences [Heidelberg, and glean insights into current challenges in on—in an article that featured search engines Germany] noted that this model of supplying computational biology.
    [Show full text]
  • Discovering the N-Terminal Methylome by Repurposing of Proteomic
    bioRxiv preprint doi: https://doi.org/10.1101/2021.04.14.439552; this version posted April 15, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Discovering the N-terminal Methylome by Repurposing of Proteomic Datasets Panyue Chen1, Tiago Jose Paschoal Sobreira2, Mark C. Hall3,4 and Tony Hazbun1,4* 1. Department of Medicinal Chemistry and Molecular Pharmacology, Purdue University, West Lafayette, IN 47907 2. Bindley Bioscience Center, Purdue University, West Lafayette, IN 47907 3. Department of Biochemistry, Purdue University, West Lafayette, IN 47907 4. Purdue Center for Cancer Research, Purdue University, West Lafayette, IN 47907 * Corresponding author: Purdue University, HANS 235, 201 South State St, West Lafayette, IN 47907 Tel: 765-496-8228 Email: [email protected] 1 bioRxiv preprint doi: https://doi.org/10.1101/2021.04.14.439552; this version posted April 15, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract Protein -N-methylation is an underexplored post-translational modification involving the covalent addition of methyl groups to the free -amino group at protein N-termini. To systematically explore the extent of -N-terminal methylation in yeast and humans, we reanalyzed publicly accessible proteomic datasets to identify N-terminal peptides contributing to the -N-terminome. This repurposing approach found evidence of -N-methylation of established and novel protein substrates with canonical N-terminal motifs of established - N-terminal methyltransferases, NTMT1/2 for humans, and Tae1 for yeast.
    [Show full text]
  • Modifications
    Modifications 1 Types of Modifications Post-translational •Phosphorylation, acetylation Artefacts •Oxidation, acetylation Derivatisation •Alkylation of cysteine, ICAT, SILAC Sequence variants •Errors, SNP’s, other variants. : Modifications © 2007-2010 Matrix Science Modifications are a very important topic in database searching. In some cases, the main focus of a study is to characterise post translational modifications, which may have biological significance. Phosphorylation would be a good example. In other cases, the modification may not be of interest in itself, but you need to allow for it in order to get a match. Oxidation during sample preparation would be an example. And, of course, most methods of quantitation involve tagging Some sequence variants, such as the substitution of one residue by another, are equivalent to modifications, and can be handled in a similar way 2 : Modifications © 2007-2010 Matrix Science Comprehensive and accurate information about post translational and chemical modifications is an essential factor in the success of protein identification. In Mascot, we take our list of modifications from Unimod, which is an on-line modifications database. 3 : Modifications © 2007-2010 Matrix Science There are other lists of modifications on the web, like DeltaMass on the ABRF web site and RESID from the EBI, but none is as comprehensive as Unimod Mass values are calculated from empirical chemical formulae, eliminating the most common source of error. Specificities can be defined in ways that are useful in database searching, and there is the option to enter mass-spec specific data, such as neutral loss information. This screen shot shows one of the better annotated entries, I can’t pretend that all of them are this detailed.
    [Show full text]
  • Evaluating Peptide Mass Fingerprinting-Based Protein Identification
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Elsevier - Publisher Connector Perspective Evaluating Peptide Mass Fingerprinting-based Protein Identification Senthilkumar Damodaran1*, Troy D. Wood2, Priyadharsini Nagarajan3, and Richard A. Rabin1 1 Department of Pharmacology and Toxicology, School of Medicine and Biomedical Sciences, University at Buffalo, Buffalo, NY 14214, USA; 2 Department of Chemistry, University at Buffalo, Buffalo, NY 14260, USA; 3 Department of Biochemistry, School of Medicine and Biomedical Sciences, University at Buffalo, Buffalo, NY 14214, USA. Identification of proteins by mass spectrometry (MS) is an essential step in pro- teomic studies and is typically accomplished by either peptide mass fingerprinting (PMF) or amino acid sequencing of the peptide. Although sequence information from MS/MS analysis can be used to validate PMF-based protein identification, it may not be practical when analyzing a large number of proteins and when high- throughput MS/MS instrumentation is not readily available. At present, a vast majority of proteomic studies employ PMF. However, there are huge disparities in criteria used to identify proteins using PMF. Therefore, to reduce incorrect protein identification using PMF, and also to increase confidence in PMF-based protein identification without accompanying MS/MS analysis, definitive guiding principles are essential. To this end, we propose a value-based scoring system that provides guidance on evaluating when PMF-based protein identification can be deemed sufficient without accompanying amino acid sequence data from MS/MS analysis. Key words: peptide mass fingerprinting, Mowse, Mascot, ProFound, proteomics Introduction Protein identification using mass spectrometry (MS) ratios for a series of daughter ions.
    [Show full text]