Quarter Calendars Summer Quarter 2003 June 23-Aug

Quarter Calendars Summer Quarter 2003 June 23-Aug. 30, 2003 Winter Quarter 2004 Jan. 6-Mar. 20, 2004 May 19 Open registration begins Nov. 10-17 Priority registration-Students currently enrolled June 13 Last day to pay without late fee for Fall Quarter 2003 students enrolled in Summer Quarter Nov. 18 Open registration begins June 16 Senior citizens registration begins Dec. 5 Last day to pay without late fee for students June 18 Last day to pay for Summer terms A,C,D enrolled in Winter Quarter June 20 General registration 8:30 a.m. to 2 p.m., Dec. 10 Last day to pay fees for Winter Quarter Records Office, Rhodes Hall Dec. 12 General registration – 8:30 a.m. to 5 p.m. June 21 Registration and payment; 9 a.m. to 12 noon Records Office, Rhodes Hall June 23-24 Summer A,C,D terms begin Dec. 25-26 College closed - Christmas holiday July 4 College closed – Independence Day Dec. 29 Senior citizens registration begins July 11 Last day to drop with a “W” for Summer A Jan. 1 New Year’s Day-College closed July 18 Last day to drop with a “W” for Summer C Jan. 3 Registration and payment; 9 a.m. –12 noon July 25 Summer A ends Jan. 5 Winter Quarter begins Last day to pay for Summer B Jan. 19 College closed - Martin Luther King Day Last day to drop with a “W” from Summer D Feb. 9-13 Midterm week July 28 Summer B term begins Feb. 20 Last day to drop with a “W” from Winter Qtr Aug. 15 Last day to drop with a “W” for Summer B Mar. 16-20 Final exams Summer C term ends Mar. 20 Winter Quarter ends Aug. 29 Summer B and D terms end

Fall Quarter 2003 Sept. 15-Dec. 6, 2003 Spring Quarter 2004 Mar. 29-June 11, 2004 May 19 Open registration begins Feb. 16-20 Priority registration-Students currently enrolled Aug. 28 Last day to pay without late fee for students Winter Quarter 2004 enrolled in Fall Quarter Feb. 23 Open registration begins Sept. 1 College closed – Labor day Mar. 12 Last day to pay without late fee for students Sept. 3 Last day to pay fees for students enrolled in enrolled in Spring Quarter Fall Quarter Mar. 17 Last day to pay for students enrolled in Sept. 5 General registration 8:30 a.m. to 5 p.m. Spring Quarter Records Office, Rhodes Hall Mar. 19 General registration 8:30 a.m. – 5 p.m. Sept. 8 Senior citizens registration begins Records Office, Rhodes Hall Sept. 13 Registration and payment; 9 a.m. to 12 noon Mar. 22 Senior citizens registration begins Sept. 15 Fall Quarter begins Mar. 27 Registration and payment; 9 a.m. – 12 noon Oct. 20-25 Midterm week Mar. 29 Spring Quarter begins Oct. 31 Last day to drop with a “W” for Fall Quarter May 3-8 Midterm week Nov. 11 College Closed - Veterans Day May 14 Last day to drop with a “W” for Spring Quarter Nov. 25-26 Staff Development Day – No Classes – May 31 College closed - Memorial Day College Open June 8-11 Final exams, Saturday classes, exam is June 5 Nov. 27-29 College closed - Thanksgiving holiday June 11 Spring Quarter ends Dec. 1 Staff Development Day-No Classes- June 12 Graduation College Open Dec. 2-6 Final Exams (classes that meet Monday only, exam is Nov 24) Dec. 6 Fall Quarter ends revised 4-25-03 Table of Contents Welcome to Clark State Introduction Quarter Calendars ...... Inside front cover

Welcome to Clark State ...... 1

About Clark State ...... 2

Technical Degrees ...... 4

Certificates ...... 4

General Education...... 4

Transfer Degrees...... 5

Degree Programs ...... 10

Course Descriptions ...... 68

Admissions ...... 113

Registration Information ...... 116 Hello! Tuition ...... 118 Please accept my personal welcome as you embark upon Student Records ...... 119 your college career at Clark State Community College. We’re very excited that you have chosen Clark State as your Academic Policies...... 120 college of choice. Financial Aid ...... 123 We’re all part of a family of sorts – a close-knit group of faculty and staff with one mission: your success. Clark Scholarships ...... 126 State is also a family of students who support and help one another, have fun together and enjoy college life. Our Academic Services ...... 127 student body is extremely diverse with many ages, cultures and races represented on campus. You’ll realize that many Campus Directory ...... 129 of your educational experiences will come not only from Advisory Committees ...... 133 books, but also from sharing experiences and building relationships with others you’ll meet along your journey. Index ...... 135 The Clark State Catalog is a helpful tool designed to assist you in learning more about the College, our policies Campus Guide and Maps ...... Inside back cover and your course of study. You’ll also find out more about student services and the activities available to make the most of your college experience. And if you need to, you may access this catalog online at www.clarkstate.edu. Enjoy your time at Clark State. I look forward to seeing you on campus.

Sincerely,

Karen E. Rafinski, Ph.D. President

Volume XXXIII June 2003 1 This catalog was prepared prior to the 2003-2004 academic broadest general education programs of any technical col- year for informational purposes only. The educational pro- lege in the state. It was this solid foundation, together with grams are changed whenever it is necessary to stay abreast the many strong technical programs, that made the evolu- of rapid changes in technology and our world. Clark State tion to a community college a smooth and logical step. reserves the right to alter or amend any item contained On July 1, 1988, the Ohio Board of Regents approved the herein without notice. We encourage you to consult with change of Clark Technical College to Clark State Commu- your advisor or the appropriate College official for confir- nity College. As a result of this action, Clark State added the

Introduction mation of matters that are essential to your program of Associate of Arts and Associate of Science degrees (univer- study. sity parallel programs) to the nearly 30 technical associate The College’s affirmative action policy has as its objec- degrees and certificates it had offered for years. tive the equal employment and treatment of all individuals Today Clark State looks proudly at its past and looks without regard to race, color, religion, sex, national origin, forward to the future, ready to meet the needs of today’s and age, disability, political affiliation, veteran status or other tomorrow’s students. non job-related factors. In accordance with the Americans with Disabilities Act, Vision Statement it is the policy of Clark State Community College to provide Opportunity without boundaries, learning without end, reasonable accommodations to persons with disabilities. achievement without limits Please address correspondence to Clark State Commu- nity College, Post Office Box 570, Springfield, Ohio 45501 Mission Statement or telephone 937/325-0691. The purpose of Clark State Community College is to foster individual and community prosperity through access to the About Clark State highest quality, learner-centered education. This purpose will be achieved when: Whether you’ve chosen Clark State because of our small Student Success class sizes, our devotion to quality education, our affordability • Students are successful in gaining entry to and advanc- or our exceptional variety of programs, we’re glad you did. ing in the workplace, resulting in pay commensurate The following information will tell you more about Clark with skills attained and personal goals. State and how it evolved into the outstanding learning • Students are successful in transferring to further educa- institution it is today. It will also give you valuable insight tion consistent with skills attained and personal goals. into our mission, and how we can serve you, our students. Workforce Development • Employers are able to improve their competitive posi- History of the College tion by accessing human resource and workforce Clark State Community College began in 1962 as the development services. Springfield and Clark County Technical Education Pro- Lifelong Learning gram in an effort to meet the post-secondary, technical • Students have opportunities for lifelong learning, per- education needs of Springfield and the surrounding area. In sonal growth and values development resulting in improved 1966 the name was changed to Clark County Technical quality of life. Institute (CCTI) and was chartered by the Ohio Board of Access/Opportunity Regents as Ohio’s first technical college. In 1972, ten years • Barriers to accessing education and training are mini- after its birth, CCTI had grown to 1,000 students and mized allowing diverse populations to achieve and get officially became Clark Technical College. New programs what they need. in agriculture, business, engineering technologies, health, Community Development • The community recognizes the College as an energizing public services and general studies were developed in force to address common issues, a vital community response to the community’s changing educational and resource and a source of community pride. economic needs. In the 1970s the College reexamined its mission and determined that programs which can be transferred to four- Guiding Principles year colleges should be included as a secondary focus. In We believe in the power of education to change people’s lives. Toward that end, we: order to accomplish this, many new courses in the humani- • place learners first ties and the social sciences were added to the curriculum. • aspire to be innovative, accepting inherent risks By 1985 Clark Technical College had developed one of the

2 • seek to improve continuously format do not alter the course content or the expected • act as good stewards of the resources with which we are student learning outcomes. The only significant difference entrusted is in the method of instructional delivery. Currently, the Introduction • connect with the diverse communities we serve College supports several distance formats: directed learn- • create synergy through partnerships ing, online, self-paced, video, video conferencing, and • trust, respect and care for those with whom we work and web-enhanced. Clark State offers over 100 credit courses in serve at least one alternative format to learners throughout its • celebrate the creativity, diversity and accomplishments service area. of our college community. Through the College’s DL initiatives, accredited courses are accessible to anyone, anywhere, at any time, providing Assessment of Student Academic Achievement: students with a convenient way to complete their degrees. Improving Student Learning Students enroll and progress through the course in a cohort The Board of Trustees, faculty and staff affirm the following: with fellow students, following an established calendar of Student learning is at the core of our purpose as a College. assignments. As long as they meet the established deadlines The ability to measure learning accomplishes two purposes: for contributions, students can participate at times conve- it allows us to demonstrate our accountability to our various nient for them. publics, but more importantly, it provides us with the Distance learning courses are taught by experts in their capacity to impact and improve the degree of learning that disciplines and, depending on the course, are available in goes on in our College. a variety of delivery formats. The College has developed a Plan to Assess Student Aca- demic Achievement, in accordance with the requirements of Accreditations/Approvals the Higher Learning Commission: A Commission of the Clark State Community College is accredited by The North Central Association of Colleges and Schools. The plan Higher Learning Commission: A Commission of the North ensures the College has specific learning outcomes for each Central Association of College and Schools, 30 North of its degree programs and validates that students earning LaSalle Street, Suite 2400, Chicago, IL 60602-2504, or degrees have achieved those outcomes. Validity measures call 1-800-621-7440. include instructor assessment, certification examinations, The Realtime/Judicial Reporting program is approved by national standard examinations, employer surveys, success the National Court Reporters Association, 8224 Old Court- of student transfer and evaluations by external professionals. house Road, Vienna, VA 22182-3808, 703/556-6272. The The results of the assessment efforts are used to improve Early Childhood Education program is approved by the instruction as necessary to guarantee that our students can Ohio Department of Education for Pre-Kindergarten Asso- succeed in the workforce or in further education. ciate Certification, 65 South Front Street, Columbus, OH 43215, 614/466-3593. The Registered Nursing program is Facilities approved by the Ohio Board of Nursing and accredited by Clark State Community College has two campuses to serve the National League for Nursing Accrediting Commission, you. The Leffel Lane Campus, at 570 East Leffel Lane, is Inc., 61 Broadway, New York, NY 10006, 1-800/669-1656 situated on the southern border of Springfield just north of extension 153, www.nlnac.org. The Practical Nursing pro- Interstate 70. Our Downtown Campus is located in the heart gram is approved by the Ohio Board of Regents and the of downtown Springfield. Major city streets and city bus Ohio Board of Nursing. The Medical Laboratory Technol- service provide easy travel between campuses. You’ll find ogy program is accredited by the National Accrediting our easy-to-follow campus maps on the inside back cover. Agency for Clinical Laboratory Sciences, 8410 West Bryn Clark State also offers classes at other locations in the Mawr Avenue, Suite 670, Chicago, IL 60631. The Para- community. These classes are included in our quarterly medic program is accredited by the Ohio Department of class schedule. Public Safety Services, #308-OH, Emergency Medical Ser- Distance Learning vices, 1970 W. Broad Street, Columbus, OH 43218. The Distance learning (DL) at Clark State offers alternative Physical Therapist Assistant program is accredited by the modes of instructional delivery for its students who for a Commission on Accreditations in Physical Therapy Educa- variety of reasons may not be able to attend traditionally tion of the American Physical Therapy Association, 1111 N. scheduled classes. Courses offered in a distance learning Fairfax Street, Alexandria, VA 22314.

3 Nursing Transition LPN to RN AAS Technical Degrees Physical Therapist Assistant Technology AAS Registered Nursing Technology AAS Our technical degree programs are designed as two-year Social Services Technology AAS programs provided you attend Clark State on a full-time basis. Many of our students, however, take longer than two Public Services Technologies years to complete degree requirements. Although many Corrections Technology AAS courses from the technical programs are transferable, these

Introduction Criminal Justice Technology AAS programs are designed primarily as pre-employment programs. If you choose to complete dual majors in related Certificate Programs associate degree programs, you should allow yourself about Accounting three additional quarters to complete both programs. The Business Management following technical degrees are offered: Associate of Ap- Computer-Aided Design plied Business (AAB), Associate of Applied Science (AAS) Industrial Technology and Associate of Technical Studies (ATS). Electrical Maintenance Manufacturing Agriculture Technologies Office Administration Agricultural Business Technology AAB Paramedic Horticultural Industries Technologies Photography Golf Course Maintenance Option AAS Practical Nursing Landscaping and Nursery Operations Option AAS Turf and Landscape Maintenance Option AAS Associate of Technical Studies Clark State also offers an Associate of Technical Studies degree if your career needs are not met by one of our Business Technologies Accounting Technology AAB technical degree programs. The flexibility of this program Business Management Technology AAB permits you to work with an advisor to construct an Electronic Business Option AAB interdisciplinary degree program from present course of- Graphic Design Technology AAB ferings. The program may include courses from more than Computer Software Development AAB one technology based on your specific goals. Network Administration Technology AAB To pursue an Associate of Technical Studies, you need Technical Systems Support Option AAB to apply prior to completing 60 credit hours. You can apply Legal Assisting (1st year) at any division office. An advisor will be assigned to work Office Administration Technologies with you to devise a specific program, which must then be Medical Office Administration AAB approved by the divisional administrator. Office Administration AAB An Associate of Technical Studies program must contain Realtime Judicial Reporting AAB at least 21 credit hours of basic courses, 23 credit hours of Broadcast Captioning CART Option AAB non-technical courses, 45 credit hours of technical courses and 9 credit hours of electives. Engineering Technologies CAD Drafting Technology AAS General Education Industrial Technology AAS General education is integral to the present and future Manufacturing Engineering Technology AAS success of students in all programs of study at Clark State Community College. It is a general body of common Health and Human Services Technologies Early Childhood Education AAS knowledge, concepts and attitudes essential to functioning Early Childhood Education effectively in a complex and diverse world. General educa- Administration Option AAS tion, also referred to as CORE (common outcomes required Emergency Medical Services/Paramedic in education) by the faculty, supports learners in their Technology AAS journey toward lifelong fulfillment by encouraging devel- Medical Laboratory Technology AAS opment in the areas of: Communication/interpersonal skills, methods of inquiry, culture and human awareness and personal development skills.

4 ENG 130 Introduction to Literature (GA) Requirements in English, Humanities ENG 225 Creative Writing and Social Sciences ENG 230 Great Books: Literature (GA) Introduction As a Clark State student, you are required to complete ENG 241 Poetry (GA) courses that focus on the development of skills and knowl- ENG 243 Fiction (GA) edge in general education. These courses include requirements ENG 245 Drama (GA) in English and Humanities/Social Sciences. ENG 250 American Literature Students in technical programs take English I, English II ENG 261 British Literature to 1700 (GA) and either Business Communications or Technical Report ENG 262 British Literature 1700-present (GA) Writing, whichever is required. HON 291 Science & Religion If you are pursuing a technical degree, you must also take HST 111 Western Civilization through four courses in the humanities and social sciences (includ- the 14th Century (GA) ing at least one in each area). The Arts and Sciences Division HST 112 Western Civilization from recommends that you take no more than one course from the 14th through the 18th Century (GA) each discipline (psychology, sociology, etc.). HST 113 Western Civilization from the In recognition of the growing importance of global awareness, 19th Century to the Present (GA) we also require that at least one of these four general HST 121 American History to 1810 education courses contains a significant amount of interna- HST 122 American History 1810-1900 tional material. Courses meeting this requirement are designated HST 123 American History 1900-Present (GA) with a GA following each course. HST 220 Topics in African-American History and Students registering for courses should use the Culture (GA) following list: HUM 299 Capstone Seminar MUS 130 Music Appreciation (GA) Social Sciences PHL 110 Problems in Philosophy (GA) ECO 110 General Economics* PHL 200 Practical Logic GEO 110 World Human Geography (GA) PHL 210 Ethics (GA) GEO 220 World Regional Geography (GA) PHL 220 Business Ethics (GA) PLS 110 American National Government PHL 230 Medical Ethics (GA) PLS 120 American Issues PHL 240 Philosophy of World Religions (GA) PLS 130 Political Issues (GA) PHL 250 Great Books: Philosophy (GA) PLS 220 Constitutional Law SPN 100 Conversational Spanish PLS 230 International Politics (GA) THE 105 Oral Interpretation of Literature PSY 111 Psychology I THE 130 Introduction to Theatre (GA) RST 260 Regional Studies: Asia-China (GA) THE 270 Theatre History I (GA) RST 262 Regional Studies: Asia-India (GA) THE 271 Theatre History II (GA) RST 270 Regional Studies: Africa (GA) RST 280 Regional Studies: Latin America (GA) *ECO 110 cannot be used as a general education elective for SOC 110 Sociology the Accounting, Business Management or Electronic Busi- SOC 140 Marriage and Family (GA) ness programs. SOC 220 Comparing Cultures (GA) SOC 230 Social Problems Transfer Degrees SOC 240 Racial and Cultural Minorities You can complete the first two years of a baccalaureate degree at Clark State and then transfer to a four-year college Humanities or university to complete the last two years. Clark State has ART 130 Appreciation of the Arts (GA) developed university parallel transfer degrees through ar- ART 133 Art History I (GA) ticulation agreements with most four-year colleges and ART 134 Art History II (GA) universities in the area. The transfer degrees are the Asso- ART 135 Art History III (GA) ciate of Arts (AA) and Associate of Science (AS). ART 138 Arts of Africa (GA) The primary purpose of these associate degrees is to COM 111 Interpersonal Communication (GA) provide transfer credit to four-year colleges and universi- COM 121 Effective Speaking ties. You can transfer successfully to other institutions in

5 areas such as business, psychology, English, theatre, urban in the transfer policy, students interested in transferring to affairs, art, agriculture, engineering sciences, engineering an independent institution are encouraged to check with technologies and others. that college or university regarding transfer agreements. More than half of our transfer students are traditional students between the ages of 18 and 22. Tuition and fees at Planning/Student Responsibilities Clark State are about 50 percent less than those of public If you are seeking an AA or AS degree, you should plan your four-year institutions. This, coupled with small classes and program at Clark State according to the requirements of the

Introduction a low student-to-instructor ratio, makes Clark State a great transfer institution. If you begin your academic career at place to earn the first two years of a bachelor’s degree. Clark State in an Applied Business or Applied Science (AAB In addition, we offer many activities, such as student or AAS) degree program, you may not receive transfer credit government, intercollegiate sports and honors programs, for many of the technical courses within those programs, and support services, such as financial aid and scholar- either for the AA/AS at Clark State or for a major at a four- ships, counseling and tutoring services. year college or university. We have more than 75 curriculum guides available to Here are specific guidelines of student responsibilities to help you plan your course of study at Clark State and to assure maximum transferability of credits: maximize the transferability of your classes to other institutions. • You need to determine the four-year college or university Clark State Community College has transfer agreements to which you will transfer and your prospective major as with the following four-year institutions: early as possible in your academic program. • You should request a catalog from the prospective trans- Antioch University and the McGregor School of Antioch fer institution early and become familiar with its admissions Capital University policies, scholarship options/deadlines and degree re- Central State University quirements. DeVry Institute of Technology • Generally, you’ll receive credit for most of your courses Franklin University and Franklin University at the transfer institutions if you have worked carefully Alliance Programs with Clark State advisors and with personnel at the Miami University, College of Applied Science prospective transfer institutions. The transfer institu- The Ohio State University tions, however, will make the final determinations. University of Dayton, General Education • You will need a minimum of 90 credit hours that clearly Requirements and Engineering Technology meet Clark State’s degree requirements to graduate with Department an AA or AS. University of Phoenix • It is your responsibility to work with an advisor and sign University of Toledo up for appropriate courses each quarter. Urbana University Wilberforce University Transfer Module Wittenberg University The Ohio Board of Regents Transfer and Articulation Policy Wright State University established the Transfer Module, which is a specific subset (Course equivalents exist with Columbus State, Miami or the entire set of a college or university’s general educa- University, Ohio University, and University of Toledo.) tion requirements. The Transfer Module contains 54-60 quarter hours* or 36-40 semester hours of specified course Policy of Statewide Articulation Agreement - credits in English composition, mathematics, communica- Institutional Transfer tions, fine arts, humanities, social science, behavioral science, The Ohio Board of Regents, following the directive of the natural science, physical science and interdisciplinary Ohio General Assembly, has developed a statewide policy coursework. to facilitate movement of students and transfer of credits A Transfer Module completed at one college or university from one Ohio public college or university to another. The will automatically meet the requirements of the Transfer purpose of the state policy is to avoid duplication of course Module at the receiving institution once you are accepted. requirements and to enhance student mobility throughout You may be required, however, to meet additional general Ohio’s higher education system. Since independent col- education requirements that are not included in the Trans- leges and universities in Ohio may or may not be participating fer Module.

*The Transfer Module refers to credit hours as quarter hours. 6 credits at receiving institutions. Conditions for Transfer Admission See Transfer Credits on page 113 for Clark State’s policy Students meeting the requirements of the Transfer Module on the transfer and appeals process. Introduction are subject to the following conditions: Transfer Module • The policy encourages receiving institutions to give pref- The Transfer Module consists of 54 quarter hours of intro- erential consideration for admission if you complete the ductory courses in the following listing. You should follow Transfer Module and either the Associate of Arts or the the directions when selecting courses for the Transfer Associate of Science degrees. You will be able to transfer Module: all courses in which you received a passing grade of C or better. You must have an overall grade point average of • Select courses to fulfill the minimum requirements in 2.0 to be given credit for the Transfer Module. each section below. • The policy also encourages receiving institutions to give • Complete the remaining hours of the Transfer Module preferential consideration for admission if you complete by selecting additional courses listed in any of the the Transfer Module with a C or better in each course and sections to total the 54 quarter hours required for the 90 quarter hours or 60 semester hours. You must have an Transfer Module. Note: Be sure to check with your overall grade point average of 2.0 to be given credit for academic advisor to ensure that the courses selected are the Transfer Module, and only courses in which a C or appropriate for the major and the transfer institution better has been earned will transfer. selected and are consistent with the minimum gradua- • The policy encourages receiving institutions to admit on tion requirements of this institution. Also, check the a non-preferential consideration basis students who complete college catalog for any prerequisites required. the Transfer Module with a grade of C or better in each • Please note that Clark State students completing the AA course and fewer than 90 quarter hours or 60 semester or AS degree requirements will have satisfied this Trans- hours. You will be able to transfer all courses with grade fer Module (unless program articulation agreements of C or better. signed by other colleges and universities dictate otherwise). Admission to an institution, however, does not guarantee that a transfer student will be automatically admitted to all English Composition majors, minors or fields of concentration at that institution. Complete ENG 111 and ENG 112. Once admitted, you follow the same regulations governing applicability of catalog requirements as all other students, COM 111 Interpersonal Communication 3 such as higher GPAs required for admission into specific COM 121 Effective Speaking 3 colleges or programs. Furthermore, transfer students have ENG 111 English I 4 the same class standing and other privileges as native ENG 112 English II 4 students on the basis of the number of credits earned. All ENG 221 Business Communications 3 residency requirements must be successfully completed at ENG 223 Technical Report Writing 3 the receiving institution prior to the granting of a degree. ENG 225 Creative Writing 3 ENG 227 Intermediate Composition 3 Transfer Appeals Process If you disagree with the application of transfer credit by the Mathematics Complete a minimum of three quarter hours chosen from: receiving institution, you have the right to appeal the decision. Each institution is required to make its appeals MTH 105 Mathematics and Today’s World 3 process available to you. MTH 120 College Algebra A 5 If your appeal is denied by the institution after all appeal MTH 121 College Algebra I 3 levels within the institution have been exhausted, the col- MTH 122 College Algebra II 3 lege will advise you in writing of the availability and process MTH 140 Trigonometry 3 of appeal to the state level Articulation and Transfer Appeals MTH 220 Calculus for the Management, Review Committee. Life and Social Sciences 5 The Appeals Review Committee will review and recom- MTH 221 Calculus I 5 mend to institutions the resolution of individual cases of MTH 222 Calculus II 5 appeal from transfer students who have exhausted all local MTH 223 Calculus III 5 appeal mechanisms concerning applicability of transfer MTH 224 Calculus IV 5

7 MTH 230 Differential Equations 5 MTH 240 Linear Algebra 3 Social and Behavioral Sciences STT 264 Statistics I 4 Complete nine quarter hours chosen from at least two STT 265 Statistics II 4 different subject areas from among the following:

Arts and Humanities ECO 110 General Economics 3 Complete nine quarter hours by choosing either: six quarter ECO 221 Principles of Macroeconomics 3

Introduction hours from category A and three quarter hours from cat- ECO 222 Principles of Microeconomics 3 egory B or three quarter hours from category A and six GEO 110 World Human Geography 3 quarter hours from category B. GEO 220 World Regional Geography 3 PLS 110 American National Government 3 Category A PLS 120 American Issues 3 ART 130 Appreciation of the Arts 3 PLS 130 Political Issues 3 ART 133 Art History I 3 PLS 220 Constitutional Law 3 ART 134 Art History II 3 PSY 111 Psychology I 3 ART 135 Art History III 3 PSY 112 Psychology II 3 ART 138 Arts of Africa 3 PSY 221 Human Growth & Development I 3 ENG 130 Introduction to Literature 3 PSY 222 Human Growth & Development II 3 ENG 230 Great Books: Literature 3 PSY 230 Abnormal Psychology 3 ENG 241 Poetry 3 RST 260 Regional Studies: China 3 ENG 243 Fiction 3 RST 262 Regional Studies: India 3 ENG 245 Drama 3 RST 270 Regional Studies: Africa 3 ENG 250 American Literature 3 RST 280 Regional Studies: Latin America 3 ENG 261 British Literature to 1700 3 SOC 110 Sociology 3 ENG 262 British Literature 1700-Present 3 SOC 140 Marriage and Family 3 THE 105 Oral Interpretation of Literature 3 SOC 220 Comparing Cultures 3 THE 130 Introduction to Theatre 3 SOC 230 Social Problems 3 THE 270 Theatre History I 4 SOC 240 Racial and Cultural Minorities 3 THE 271 Theatre History II 4 Natural and Physical Sciences Category B Complete one three-course sequence in the same science HST 111 Western Civilization chosen from the sequences with asterisks or complete three through the 14th Century 3 courses from three separate content areas. HST 112 Western Civilization from the 14th though the 18th Century 3 BIO 110 Fundamentals of Human Biology 4 HST 113 Western Civilization from BIO 111 Biology I 4 the l9th Century to the Present 3 BIO 112 Biology II 4 HST 121 American History to 1810 3 BIO 113 Biology III 4 HST 122 American History 1810-1900 3 HST 123 American History 1900-Present 3 *BIO 121 Anatomy & Physiology I 4 PHL 110 Problems in Philosophy 3 BIO 122 Anatomy & Physiology II 4 PHL 200 Practical Logic 3 BIO 123 Anatomy & Physiology III 4 PHL 210 Ethics 3 PHL 220 Business Ethics 3 BIO 131 Microbiology 4 PHL 230 Medical Ethics 3 BIO 140 Plant Science 4 PHL 240 Philosophy of World Religions 3 PHL 250 Great Books: Philosophy 3 CHM 110 Fundamentals of Chemistry 5 CHM 114 Intro to General Chemistry Review 4

8 CHM 115 Intro to General Chemistry 5 CHM 116 Intro to Organic Chemistry 5 Introduction *CHM 121 General Chemistry I 5 CHM 122 General Chemistry II 5 CHM 123 General Chemistry III 5

CHM 211 Organic Chemistry I 5 CHM 212 Organic Chemistry II 5 CHM 213 Organic Chemistry III 5

*GLG 111 Geology I 4 GLG 112 Geology II 4 GLG 113 Geology III 4 GLG 121 Meteorology 4

PHY 105 Fundamentals of Scientific Methods 3

PHY 110 Fundamentals of Physics 5 PHY 111 Technical Physics I 4 PHY 112 Technical Physics II 4 PHY 113 Technical Physics III 4 PHY 120 Astronomy 4

*PHY 250 General Physics I 6 PHY 251 General Physics II 5 PHY 252 General Physics III 5

9 10 Introduction erePrograms Degree Clark lr tt omnt College Community State Clark rgas Interested intransferring to afour-year college programs. Clark State offers over 35associate degree andcertiﬁcate or university? Check out our Associate of Arts and or university?CheckoutourAssociate ofArts Associate ofScienceprograms State E SMART. GET . Introduction Associate of Arts 11 Students enrolled in the College prior to Fall Quarter 2001 Area 3 - Humanities (9 credit hours) Area 3 - Humanities under History or Philosophy. from those listed Three courses hours) Sciences (15 credit Area 4 - Social including different disciplines from at least two Five courses Science, Geography, Political under Economics, courses listed and Regional Studies. Psychology, Sociology and Computers (6 credit hours) Area 5 - Mathematics one from those listed under Mathematics Two courses including Mathematics)* and one from Information (other than Business (at least 3 credit hours). Technology Systems (12-15 credit hours) Area 6 - Natural Sciences choose the one most suited to your Two options are available; transfer institution. Option 1 each from a different science area. (Possible Take three courses, CHM 110, GLG 110, classes include BIO 110, BIO 131, BIO 140, GLG 114, PHY 110, PHY 120.) Option 2 Chemistry, Geology or Take a three-course sequence in Biology, 111-113, BIO 121-123, Physics. (Possible sequences include BIO GLG 111-113.) CHM 121-123, PHY 111-113, PHY 250-252, Concentration (15-20 credit hours) and count toward the These hours should be clearly transferable relate to the major major at the transfer institution. These classes to be pursued at the four-year institution.* Electives (15-17 credit hours) and count toward the These hours should be clearly transferable should be planned major at the transfer institution. These hours may be used to support carefully with an advisor. These classes fulfill additional general those listed under concentration hours, at the four-year education requirements or serve as free electives institution.* Global Awareness of global awareness, the In recognition of the growing importance the Associate of Arts College also requires that students receiving degree take at least six courses with significant international content. Courses meeting the requirement begin on page 5. Capstone Seminar Effective Fall Quarter 2001, all new students entering the College for the first time pursuing either an AA or AS degree, are now required to take the Capstone Seminar (HUM 299). Students must have earned at least 60 credit hours prior to taking the course and must take the course for graduation. The course will assess student achievement of the specific AA/AS program goals. pursuing either an AA or AS degree, can take the Capstone Seminar (HUM 299) and count the course as a Humanities elective toward graduation. Total credit hours = 90 *The number of credit hours and courses may vary with specific curriculum guides. Check with your advisor first.

The remaining credit hours are divided among the Capstone, The remaining credit of concentration and electives are The courses in an area a student should With careful scheduling and advising, specific purposes. formats. formats. to access resources, to gather data and organize information; to analyze data/evaluate information gathered; and to draw conclusions, synthesize results and solve problems. culture of others. Area 1 - English (8 credit hours) ENG 111 English I and ENG 112 English II Area 2 - Literature and the Arts (9 credit hours) Three courses, at least one of which is chosen from Art (ART 130 Appreciation of the Arts or ART 133 Art History I, ART 134 Art History II or ART 135 Art History III), Theatre (THE 130 Introduc- tion to Theatre, THE 270 Theatre History I or THE 271 theatre History II) or Music (MUS 130 Music Appreciation); and at least one from those listed under English (other than English I and II, Technical Report Writing and Business Communications). Associate of Arts require that generally colleges and universities Four-year two years portion of their first a significant students spend knowledge that build their education courses taking general education. These undergraduate courses and skills in general that a student seeking an AA or AS degree are primarily those of and then transfers to the institution takes at Clark State the 90 credit hours necessary to achieve his/her choice. Of 1- a minimum of 59 must be in areas an AA or AS degree, degree requirements on this page. 6 in the outline of electives. Capstone is for all AA/AS stu- concentration and State. dents new to Clark student’s major at the transfer institu- directed toward the carefully and must tion. These courses must be selected very of coursework in be clearly transferable. Of the 30 hours should be selected these two categories, no more than 15 otherwise indicated from technical/career programs unless with an advisor and in a curriculum guide or planned out The Associate with the divisional administrator’s approval. focus on courses in of Arts and Associate of Science degrees the liberal arts. be able to transfer with junior standing. Learning Outcomes in Associate of Arts, Upon completion of an associate degree a graduate will be able to: • read, retain, restate and apply ideas for a variety of • write clearly and accurately in a variety of contexts and • speak clearly and accurately in a variety of contexts and • demonstrate effective listening skills. • work effectively in teams. • identify problems or issues; to identify possible resources; • demonstrate an awareness of one’s culture as well as the • demonstrate an awareness of global issues. • demonstrate an understanding of human behavior.

T e 12 Introduction Associate of Science Business Communications). English (otherthanIand II,TechnicalReportWritingand Music Appreciation);andatleast onefromthoselistedunder atre HistoryIorTHE271Theatre HistoryII)orMusic(MUS130 Interpretation, THE130IntroductiontoTheatre,270The- History IIorART134ArtIII),Theatre(THE105Oral Appreciation oftheArtsorART133ArtHistoryI,134 Art Two courses,atleastoneofwhichischosenfromArt(ART 130 Area 2-LiteratureandtheArts(6credithours) ENG 111EnglishIand112II Area 1-English(8credithours) demonstrate anunderstandingofhumanbehavior. • demonstrate anawarenessofglobalissues. • demonstrateanawarenessofone’scultureaswellthe • identifyproblemsorissues;topossibleresources; • workeffectivelyinteams. • demonstrateeffectivelisteningskills. • speakclearlyandaccuratelyinavarietyofcontexts • writeclearlyandaccuratelyinavarietyofcontexts • read,retain,restateandapplyideasforavarietyof • Science, agraduatewillbeableto: Upon completionofanassociatedegreeinAssociate Learning Outcomes be abletotransferwithjuniorstanding. the liberalarts. of ArtsandAssociateSciencedegreesfocusoncoursesin with thedivisionaladministrator’sapproval.TheAssociate in acurriculumguideorplannedoutwithanadvisorand from technical/careerprogramsunlessotherwiseindicated these twocategories,nomorethan15shouldbeselected be clearlytransferable.Ofthe30hoursofcourseworkin tion. Thesecoursesmustbeselectedverycarefullyand directed towardthestudent’smajorattransferinstitu- dents newtoClarkState. concentration andelectives.CapstoneisforallAA/ASstu- 6 intheoutlineofdegreerequirementsonthispage. an AAorASdegree,aminimumof59mustbeinareas1- his/her choice.Ofthe90credithoursnecessarytoachieve takes atClarkStateandthentransferstotheinstitutionof are primarilythosethatastudentseekinganAAorASdegree and skillsingeneraleducation.Theseundergraduatecourses taking generaleducationcoursesthatbuildtheirknowledge students spendasignificantportionoftheirfirsttwoyears Four-year collegesanduniversitiesgenerallyrequirethat ofScience Associate culture ofothers. draw conclusions,synthesizeresultsandsolveproblems. tion; toanalyzedata/evaluateinformationgathered;and to accessresources,gatherdataandorganizeinforma- formats. formats. specific purposes. With carefulschedulingandadvising,astudentshould The coursesinanareaofconcentrationandelectivesare The remainingcredithoursaredividedamongtheCapstone, curriculum guides.Checkwith youradvisorfirst. *The numberofcredithoursand coursesmayvarywithspecific Total credithours=90 graduation. (HUM 299)andcountthecourseasaHumanitieselectivetoward pursuing eitheranAAorASdegree,cantaketheCapstoneSeminar achievement ofthespecificAA/ASprogramgoals. must takethecourseforgraduation.Thewillassessstudent have earnedatleast60credithourspriortotakingthecourse and required totaketheCapstoneSeminar(HUM299).Studentsmust for thefirsttimepursuingeitheranAAorASdegree,arenow Effective FallQuarter2001,allnewstudentsenteringtheCollege Capstone Seminar content. Coursesmeetingtherequirementbeginonpage5. degree takeatleastsixcourseswithsignificantinternational College alsorequiresthatstudentsreceivingtheAssociateofArts In recognitionofthegrowingimportanceglobalawareness, Global Awareness institution.* education requirementsorserveasfreeelectivesatthefour-year those listedunderconcentrationhours,fulfilladditionalgeneral carefully withanadvisor.Theseclassesmaybeusedtosupport major atthetransferinstitution.Thesehoursshouldbeplanned These hoursshouldbeclearlytransferableandcounttowardthe Electives (15-17credithours) to bepursuedatthefour-yearinstitution.* major atthetransferinstitution.Theseclassesrelateto These hoursshouldbeclearlytransferableandcounttowardthe Concentration (15-20credithours) CHM 121-123,PHY111-113,250-252,GLG111-113.) Physics. (PossibleclassesincludeBIO111-113,121-123, Take athree-coursesequenceinBiology,Chemistry,Geologyor Choose thisoptionifyourmajorpertainstothenaturalsciences. Option 2 GLG 121,PHY110,120.) classes includeBIO110,131,140,CHMGLG Take threecourses,eachfromadifferentsciencearea.(Possible requirement andnotforthenaturalsciences,choosethisoption. If youhavechosenanASmajorbecauseofthemathematics Option 1 major andtherequirementsofyourtransferinstitution. Two optionsareavailable;choosetheonemostsuitedtoyour Area 6-NaturalSciences(12-15credithours) Technology Systems(atleast3credithours). (other thanBusinessMathematics)*andonefromInformation Four coursesincludingthreefromthoselistedunderMathematics Area 5-MathematicsandComputers(12credithours) Psychology, SociologyandRegionalStudies. courses listedunderEconomics,Geography,PoliticalScience, Five coursesfromatleasttwodifferentdisciplinesincluding Area 4-SocialSciences(15credithours) Two coursesfromthoselistedunderHistoryorPhilosophy. Area 3-Humanities(6credithours) Students enrolledintheCollegepriortoFallQuarter2001 Introduction

Basic Peace Officer 13 Total credit hours 16 Recruits successfully completing this academy will earn this academy completing Recruits successfully Training topics include administra- Basic Peace Officer CourseNumberCRJ 287 Course TitleCRJ 289 I Basic Law Enforcement II Basic Law Enforcement 8 8 Credit Hours training is conducted at both indoor and outdoor ranges at indoor and outdoor conducted at both training is locations. off-campus Technology a Criminal Justice credit toward some college well as state certification. degree as firearms, driving, traffic accident, tion, legal, human relations, traffic enforcement, civil disorders, investigation, patrol, first aid and physical conditioning. unarmed self-defense, The objective of the academy is to provide the recruit The objective of the must meet stringent entrance re- Academy applicants for this academy may be held on Formal class meetings Clark State Community College, in cooperation with local in cooperation Community College, Clark State the Ohio State of Ohio and agencies, the law enforcement Council, offers the Basic Peace Peace Officers’ Training This is the state certifying acad- Officer Training Academy. Ohio Peace Officer Training Council. emy mandated by the of entry-level peace officer with the basic fundamentals training. by the Attorney General of the State quirements as directed of Ohio. location. Firearms the Clark State Campus or at a satellite Basic Peace OfficerPeace Basic Training Academy 14 Introduction Corrections begins onpage5. A completelistingofhumanitiesandsocialscienceelectives Humanities/Social ScienceElectives which varygreatlyamongdifferentagencies. nize thatemploymentinvolvesmeetingphysicalrequirements Anyone consideringalawenforcementcareershouldrecog- Prerequisites haveanappreciationfortheroleofapoliceofficerand • haveanunderstandingoftheeffectsdrugdependency • performthebasicdutiesofacorrectionsofficerin • performthebasicdutiesofacorrectionsofficerinan • haveanunderstandingofthefunctionscorrections/ • graduate willbeableto: Upon completionofanassociatedegreeinCorrections,a Learning Outcomes help inplanningtheirschedules. study. Studentsshouldconsulttheiracademicadvisorsfor developmental courses willrequireadditionalquartersof viduals, especiallypart-timestudentsandthosetaking who havenodevelopmentalrecommendations.Manyindi- time studentswhohavecompletedallprerequisitesand and youthcounselors. parole officersandprobationaswellinvestigators to qualifyforentrylevelpositionsascorrectionsofficers, state andlocalcorrectionalfacilities.Graduatesmayexpect prepares studentsforimmediateemploymentinfederal, broad overviewofthecorrectionalsystem.Theprogram variety tomenandwomenthancriminaljustice. Few careersinpublicserviceoffermorechallengeand Corrections officer. how thatwillinteractwiththeroleofacorrections on inmatesandthegeneraljailpopulation. juvenile prisonfacility. adult prisonenvironment. prisons inthecriminaljusticesystem. The programschedulesthatfollowaredesignedforfull- The Correctionsdegreeprogramoffersthestudenta R 3 oilJsie3 3 4 3 3 4 AdultInstitutionsPracticum CommunityResources 3 SocialJustice COR 282 3 3 CRJ 250 4 CRJ 230 Spring JuvenileInstitutionsPracticum 3 CriminalLaw CriminalInvestigations COR 281 3 InterviewandInterrogation CRJ 231 CRJ 228 CRJ 226 Winter AbnormalPsychology 3 ConstitutionalLaw 3 PSY 230 3 PhilosophyofWorldReligions 3 4 PLS 220 JailPracticum 4 PHL 240 3 COR 280 Fall RacialandCulturalMinorities 3 Sociology SOC 240 TechnicalReportWriting 4 3 SOC 110 4 Adult/JuvenileCorrections ENG 223 InterpersonalCommunication CommunityPolicing COR 130 COM 111 CRJ 125 4 Spring PsychologyI 4 Hours 3 BusinessMathematics PSY 111 Credit EnglishII MTH 106 ProbationandParole JuvenileProcedures ENG 112 4 COR 105 CRJ 120 Winter ChemicalDependencyI EnglishI SWK 105 IntrotoCorrections ENG 111 SystemsApproachtoComputer COR 100 IntrotoCriminalJustice Technology CRJ 116 CRJ 100 Title Course Fall Number Course oa rdthus91 Total credithours Introduction

Criminal Justice 15 or Total credit hours 98 Technology 3 COM 121ENG 112 Effective SpeakingPHO 121 English IISOC 110 Color Photography I SociologyFall CRJ 201CRJ 216CRJ 221 Administration Police ENG 223 Relations Community PLS 220 Science I Forensic Technical Report WritingSWK 105 3 Constitutional Law 3 Chemical Dependency IWinter CRJ 223CRJ 226 4 CRJ 228 Science II Forensic 3 CRJ 231 Interview/Interrogation 3 3 3 – Investigation Criminal – Law Criminal 5 Spring 4 CRJ 230 Humanities/Social Science Elective 3 CRJ 232CRJ 250 Social JusticeCRJ 280 Ohio Criminal Code 3 3 Community Resources 5 Practicum 3 Note: See Criminal Justice coordinator for additional information on technical electives. 3 3 3 3 3 CourseNumberFall Course TitleCRJ 100CRJ 112CRJ 116 Intro to Criminal Justice Traffic ManagementPHO 111Computer Systems Approach to PSY 111 Photography I Psychology IWinter CRJ 118CRJ 120 4 CRJ 123 Forensic PhotographyENG 111 Juvenile Procedures Credit MTH 106 Patrol Operations 3 English I Business Mathematics Hours Spring CRJ 125COM 111 3 Policing Community Interpersonal Communication 3 3 3 3 3 4 3 Opportunities are plentiful in the criminal justice system Opportunities are plentiful that follow are designed for full- The program schedules it at trial. able to package it, preserve it and present to articulate impor- subordinates or peers and will be able tant information in a professional manner. how it applies to a job in law enforcement. importance to a criminal case. of these agencies. have an understanding of the functions Criminal JusticeCriminal with a provides students Justice program The Criminal to our program is responsive curriculum. The contemporary and demands highly educated society which ever-changing to meet the increasing standards well qualified candidates officer agencies. of a variety of peace the municipal police departments, in sheriffs’ departments, corrections agencies and other public state highway patrol, and private agencies. and have completed all prerequisites time students who recommendations. Many indi- who have no developmental part-time students and those taking viduals, especially will require additional quarters of courses developmental academic advisors for study. Students should consult their help in planning their schedules. Learning Outcomes in Criminal Justice, Upon completion of an associate degree a graduate will be able to: • identify pertinent physical evidence at a crime scene, be • make a presentation before a group of his/her superiors, • have an understanding of the criminal justice system and • identify various types of photographic evidence and its • have an array of community agencies available to him and Prerequisites career should recog- Anyone considering a law enforcement physical requirements nize that employment involves meeting which vary greatly among different agencies. Humanities/Social Science Electives A complete listing of humanities and social science electives begins on page 5. 16 Introduction Photography begins onpage5. A completelistingofhumanitiesandsocialscienceelectives Humanities/Social ScienceElectives their schedules. should consulttheiracademicadvisorsforhelpinplanning courses willrequireadditionalquartersofstudy.Students cially part-timestudentsandthosetakingdevelopmental developmental recommendations.Manyindividuals,espe- who havecompletedallprerequisitesandno artistic valuealone. Photography alsomaybeapersonalventure,pleasingforits vital elementinbothentertainmentandcommunications. demand fortrainedphotographers.Photographyisalsoa Scientific, industrialandsocietalneedspointtoagrowing Photography Certificate The programscheduleisdesignedforfull-timestudents H 8 htgah rciu 3 4 3 4 4 3 3 PhotographyPracticum PhotographyPortfolio PHO 180 ColorPhotographyII 3 PHO 124 3 PHO 122 Summer PsychologyI 4 3 EnglishII 3 PSY 111 ArtHistoryIII ENG 112 ColorPhotographyI Hours ART 135 3 PHO 121 Credit Spring ForensicPhotography 3 3 InterpersonalCommunication CRJ 118 AppreciationoftheArts COM 111 PhotographyII ART 130 Humanities/SocialScienceElective PHO 112 Winter EnglishI – – IntroductiontoBusiness ENG 111 PhotographyI BUS 105 PHO 111 Title Course Fall Number Course oa rdthus49 Total credithours Introduction

Theatre Arts 17 performer. tion values. within the performing arts. equipment for a production. tools to construct and paint a set. ment and boards. the theatre. personnel and use correct theatre terminology. • of character development. analyze a script for the purposes • analyze a play’s structure, character, themes and produc- • differentiate among major periods in theatre history. • demonstrate competency in at least two different areas Theatre – Technical Option Two Concentration (15-17 credit hours) for the Non-major Stagecraft I (THE 111)*, II (THE 112), Acting (THE 160), Lighting I (THE 210) Electives (15-17 credit hours) Theatre Labs I (THE Lighting II (THE 211), Sound I (THE 220), II THE 271), Theatre 150), II (THE 151), III (THE 152)**, Sound II electives (3-5 credit hours), Theatre History Learning Outcomes in Technical The- Upon completion of an associate degree atre, a graduate will be able to: • analyze a light plot and use it to hang and focus lighting • analyze a design package and use it along with scene shop • operate sound equipment and boards and lighting equip- • demonstrate competency in fulfilling several roles within • demonstrate an understanding of the roles of all theatre • adhere to theatre safety guidelines. *Take during the first quarter at Clark State. **Up to 6 credit hours may be taken for degree credit. Option One – PerformanceOption One Theatre (15-17 credit hours) Concentration and Voice (THE 203), and Speech 202)*, Acting II Acting I (THE (THE 107) for Actors hours) Electives (15-17 credit 160), Theatre History II (THE 271), Children’s Theatre (THE Theatre Laboratory I (THE 150), II (THE Stagecraft I (THE 111)*, and Theatre electives, Dance electives 151), III (THE 152)**, Music electives must work in at least one technical All performance majors re- by their advisor to fulfill graduation position as approved quirements. an associate degree in Performing Arts, Upon completion of able to: a graduate will be • demonstrate competency with basic audition techniques. • internalize the discipline and professional attitude of a In order to finish their degrees in two years, full-time In order to finish their degrees in two Area 1 - English (8 credit hours) 112) English I (ENG 111) and English II (ENG Area 2 - Literature and the Arts (9 credit hours) History I (THE 270), Introduction to Theatre (THE 130) *, Theatre 245) Creative Writing (ENG 225) or Drama (ENG Area 3 - Humanities (9 credit hours) 112), III (HST 113) Western Civilization I (HST 111), II (HST Area 4 - Social Sciences (15 credit hours) (PSY 230), Sociol- Psychology I (PSY 111), Abnormal Psychology (RST), World Regional ogy (SOC 110), any Regional Studies course (SOC 220) Geography (GEO 220) or Comparing Cultures Area 5 - Mathematics and Computers (6 credit hours) Math in Today’s World (MTH 105) or College Algebra I (MTH 121); Information Technology Systems requirement of three credit hours (Information Technology Basics (ITS 103) is recommended.) Area 6 - Natural Sciences (12-15 credit hours) Take either a three-course sequence in Biology, Chemistry, Geol- ogy or Physics or choose any three laboratory-based courses from the four content areas listed above. The three courses selected must come from three different sciences (example: one class from BIO, CHM and GLG). Capstone Seminar Effective Fall Quarter 2001, all new students entering the College for the first time pursuing either an AA or AS degree, are now required to take the Capstone Seminar (HUM 299). Students must have earned at least 60 credit hours prior to taking the course and must take the course for graduation. The course will assess student achievement of the specific AA/AS program goals. Theatre ArtsTheatre developed in theatre, both offers two programs Clark State Center in Performing Arts with Clark State’s in conjunction of arts option is an associate Springfield. The first downtown fo- theatre concentration, which degree with a technical lighting and sound. Students who enroll cuses on stagecraft, be prepared for entry-level technical in this program should two years of full-time study, although careers at the end of choose to transfer to university pro- some students may focus. The other option is an associate grams with a technical a performing arts concentration, which of arts degree with voice, theatre history, etc. Performance focuses on acting, likely transfer to university programs students will most be focus. Students in both programs will with a performance productions in the Performing Arts involved with theatrical Center. and have students should have completed all prerequisites individuals, espe- no developmental requirements. Many taking developmental cially part-time students and those of study. Students courses will require additional quarters for help in planning should consult their academic advisors their schedules. 18 Introduction Theatre Arts U 4 rnilso aktn 4 4 4 *Humanities electivemeetingGlobalAwarenessrequirement. 4 4 4 Hours 4 PrinciplesofMarketing PrinciplesofBusinessManagement 3 Credit BUS 243 BUS 112 HumanRelationsand 3 PrinciplesofAccountingII BUS 106 PrinciplesofAccountingI ACC 112 ActingfortheNon-major ACC 111 ActingI THE 160 TheatreHistoryII* THE 202 TheatreHistoryI* THE 271 TheatreManagement THE 270 IntroductiontoTheatre* THE 230 StagecraftI THE 130 Title Course THE 111 Number Course Certificate Administration Departmental Arts who wishtodotheircourseworkatadistance. Also, manyoftheseclassesareofferedonlineforstudents following classestotherequirementsforthoseprograms. ment and/orTheatreArts,sostudentscanapplymanyofthe this certificateoverlapthoserequiredinBusinessManage- succeed inartsmanagement.Manyofthecoursesneededfor will givethestudentsbusinessbackgroundtheyneedto the arts.Accounting,marketingandmanagementcourses istration, actingandstagecraftprovideabroadoverviewof General educationcoursesintheatre,aswellartsadmin- students forentry-levelpositionsinartsadministration. The ArtsAdministrationCertificateisdesignedtoprepare Certificate Departmental Theatre Arts oa rdthus38 4 Total credithours Organizational Behavior or or Course Course Credit Accounting Number Title Hours Accountants compile and analyze business transactions and prepare financial reports such as income statements, bal- Fall ance sheets, statement of cash flows, cost studies and tax ACC 111 Principles of Accounting I 4 BUS 105 Introduction to Business 3 reports. The major fields are public, management and gov- ENG 111 English I 4 ernmental accounting. Accountants in any field may work ITS 103 Information Technology Basics 3 in such areas as general accounting, auditing, taxes, cost MTH 106 Business Mathematics 3 accounting, budgeting and control, information processing or systems and procedures. Winter Students with little or no computer background should ACC 112 Principles of Accounting II 4 enroll in ITS 080 Computer Fundamentals as a preparatory BUS 112 Principles of Business Management 4 course before taking other computer courses. Students BUS 260 Business Law 3 without adequate keyboarding skills should enroll in ITS ENG 112 English II or ENG 135 Business Report Writing* 4 102 Keyboarding/Word Processing. ITS 12S Beginning Spreadsheet 1 The program schedule that follows is designed for full- Accounting time students who have completed all prerequisites and Spring who have no developmental recommendations. Many indi- ACC 113 Principles of Accounting III 4 viduals, especially part-time students and those taking ACC 120 Microcomputer Accounting Systems 4 developmental courses, will require additional quarters of BUS – Business Elective** 3 study. Students should consult their academic advisors for COM 121 Effective Speaking 3 help in planning their schedules. ENG 221 Business Communications 3 This program is available to both day and evening students. Students should consult with their advisor for the Fall ACC 211 Intermediate Accounting I 4 recommended sequencing of evening courses. ACC 221 Tax Accounting I 4 BUS 266 Quantitative Business Methods 4 Learning Outcomes ITS 12D Beginning Database 1 Upon completion of an associate degree in Accounting, a – – Social Science Elective 3 graduate will be able to: • perform basic accounting functions in an established Winter accounting system to the satisfaction of an employer. ACC 212 Intermediate Accounting II 4 ACC 222 Tax Accounting II 4 • apply generally accepted accounting principles as they BUS 270 Business Finance 4 relate to recording, measuring and communicating finan- ECO 221 Principles of Macroeconomics 3 cial information. – – Humanities/Social Science Elective 3 • prepare financial reports for internal and external use. • use microcomputer accounting software to perform nec- Spring essary accounting functions for a profit-making enterprise. ACC 213 Intermediate Accounting III 4 • calculate amounts for and prepare fundamental indi- ACC 233 Cost Accounting 4 vidual federal, state and local tax returns. ACC 250 Government and Non-Profit • calculate amounts for and prepare fundamental business Accounting 4 federal, state and local returns. ECO 222 Principles of Microeconomics 3 – – Humanities/Social Science Elective 3 • record, analyze and use cost information for job order and process cost systems. Total credit hours 102

Humanities/Social Science Electives *ENG 135 Business Report Writing will not necessarily transfer as A complete listing of humanities and social science electives the equivalent of ENG 112 English II. begins on page 5. **Any course not already prescribed from BUS, CSD, ITS, MTH, NTK, OAD, RES or Co-op. ITS 080 cannot be used as an elective. The following co-op experiences may be substituted for technical courses as indicated: EBE 100 plus EBE 282 for the business elective and EBE 294 for BUS 270.

19 Course Course Credit Accounting Certificate Number Title Hours Accounting, long referred to as the “language of business,” is an excellent foundation for any type of office position. Fall Most managerial positions require an understanding of ACC 111 Principles of Accounting I 4 ACC – Accounting Elective* 4 accounting. This program provides the basic courses that BUS 105 Introduction to Business 3 teach fundamentals of recording business transactions, the ENG 111 English I 4 balance sheet, the income statement, basic cost accounting ITS 103 Information Technology Basics 3 concepts/entries and individual taxes. Courses are applicable to the associate degree program. Winter Students with little or no computer background should ACC 112 Principles of Accounting II 4 enroll in ITS 080 Computer Fundamentals as a preparatory BUS 260 Business Law 3 course before taking other computer courses. Students ENG 112 English II or without adequate keyboarding skills should enroll in ITS ENG 135 Business Report Writing** 4 ITS 12S Beginning Spreadsheet 1 102 Keyboarding/Word Processing. MTH 106 Business Mathematics 3 The program schedule that follows is designed for full- time students who have completed all prerequisites and Spring who have no developmental recommendations. Many indi- ACC 113 Principles of Accounting III 4 viduals, especially part-time students and those taking ACC 120 Microcomputer Accounting Systems 4 developmental courses, will require additional quarters of BUS – Business Elective*** 3 Accounting study. Students should consult their academic advisors for COM 121 Effective Speaking 3 help in planning their schedules. ENG 221 Business Communications 3 Total credit hours 50

*Any accounting course not already prescribed. **ENG 135 Business Report Writing will not necessarily transfer as the equivalent of ENG 112 English II. ***Any course not already prescribed from ACC, BUS, CSD, ITS, MTH, NTK, OAD, RES or Co-op. ITS 080 cannot be used as an elective.

20 Course Course Credit Agricultural Business Number Name Hours The Agricultural Business program emphasizes preparation for agriculture service industry occupations. Courses Fall are offered in soil science, animal health and nutrition, AGR 104 Agricultural Survey and Employment Skills 3 AGR 150 Soil Science 4 weed and pest management, sales, business management, AGR – Ag/Hort Elective* 3 marketing and economics. The curriculum is designed to ENG 111 English I 4 prepare students for employment in the business world of ITS 103 Information Technology Basics 3 agriculture sales and service. Graduates of this program will find technical and entry-level management positions Winter in crop care companies, feed and livestock product com- AGR 108 Technical Math for Agriculture 3 panies and many other businesses that serve the producer AGR 151 Soil Fertility 4 with goods and services. BIO 140 Plant Science 4

The program schedule that follows is designed for full- ENG 112 English II 4 Agricultural Business – – Social Science Elective 3 time students who have completed all prerequisites and who have no developmental recommendations. Many indi- Spring viduals, especially part-time students and those taking AGR 194 Agribusiness Co-op Experience I 4 developmental courses, will require additional quarters of study. Students should consult their academic advisor for Summer help in planning their schedules. AGR 109 Animal Agriculture 4 COM 121 Effective Speaking 3 Learning Outcomes Upon completion of an associate degree in Agricultural Fall AGR 122 Plant Pests 4 Business, a graduate will be able to: AGR 174 Agribusiness Principles 3 • identify plant nutrient deficiencies and describe correc- AGR 214 Crop Production 4 tive measures. ACC 111 Principles of Accounting I 4 • identify major plant pests, including weeds, insects and – – Humanities/Social Science Elective 3 diseases. • develop a written agricultural business plan. Winter • locate current information in solving technical problems. AGR105 Principles of Ag Sales I 3 • demonstrate effective employability skills. AGR 253 Pest Management 5 • demonstrate basic sales principles. AGR 284 Agribusiness Management 4 AGR – Ag/Hort Elective* 3 ENG 223 Technical Report Writing 3 Scholastic Preparation High school chemistry, biology, geometry, algebra and Spring keyboarding skills are strongly recommended. AGR 106 Ag Sales II 3 AGR 206 Agribusiness Marketing 3 Humanities/Social Science Electives AGR 262 International Ag Trade 3 A complete listing of humanities and social science electives ECO – ECO 110 or ECO 221 or ECO 222 3 begins on page 5. – – Humanities/Social Science Elective 3 Total credit hours 97

*Ag/Hort electives may be any AGR course not required in the program. Suggested Ag/Hort electives include: AGR 185 Vehicle Operations and Management (strongly recommended), AGR 115 Welding, INT 120 Fluid Power, or INT 150 Electrical Systems. Other coursework may be approved by the division.

21 Golf Course Maintenance Option Horticultural Industries Turf science and landscape maintenance as they apply to The Horticultural Industries program provides basic prepa- maintaining the golf course are areas emphasized, leading to rations for careers in the landscape and turfgrass industries. a career in the golf course industry. The campus grounds, including a greenhouse facility and a one-hole golf course, act as a working laboratory to give Course Course Credit students practical training. Clark State students can special- Number Title Hours ize in areas of golf course maintenance, landscaping and nursery operation or turf and landscape maintenance. Fall These program schedules are designed for full-time stu- AGR 104 Agricultural Survey and Employment Skills 3 AGR 133 Turf Science 3 dents who have completed all prerequisites and who have AGR 150 Soil Science 4 no developmental recommendations. Many individuals, ENG 111 English I 4 especially part-time students and those taking developmen- ITS 103 Information Technology Basics 3 tal courses, will require additional quarters of study. Students should consult their academic advisor for help in planning Winter their schedules. AGR 108 Technical Math for Agriculture 3 AGR 151 Soil Fertility 4 BIO 140 Plant Science 4 Learning Outcomes COM 121 Effective Speaking 3 Upon completion of an associate degree in Horticultural ENG 112 English II 4 Industries, a graduate will be able to: • identify plant nutrient deficiencies and describe correc- Spring tive measures. AGR 193 Horticulture Co-op Experience I 3

Horticultural Industries • identify major plant pests, including weeds, insects and AGR 224 Irrigation Systems 3 diseases. • develop a written agricultural business plan. Summer • locate current information in solving technical problems. AGR 293 Horticulture Co-op Experience II 3 • demonstrate effective employability skills. – – Humanities/Social Science Elective 3 • identify common landscape and herbaceous plant materials. Fall • demonstrate the proper care of established plants in the AGR 122 Plant Pests 4 landscape. AGR 143 Landscape Plant Materials 4 AGR 174 Agribusiness Principles 3 Scholastic Preparation AGR 225 Landscape Maintenance 4 High school chemistry, biology, geometry, algebra and AGR 236 Turfgrass Management 3 keyboarding skills are strongly recommended. Winter Humanities/Social Science Electives AGR 253 Pest Management 5 A complete listing of humanities and social science electives AGR 284 Agribusiness Management 4 AGR – Ag/Hort Elective* 3 begins on page 5. ACC 111 Principles of Accounting I 4

Spring AGR 145 Herbaceous Plant Materials 4 AGR 219 Landscape Construction 4 ENG 223 Technical Report Writing 3 – – Social Science Elective 3 – – Humanities/Social Science Elective 3

Total credit hours 98

*Ag/Hort electives may be any AGR course not required in the program. Suggested Ag/Hort electives include: AGR 105 Principles of Ag Sales I, AGR 115 Welding, AGR 226 Landscape Design, INT 120 Fluid Power, or INT 150 Electrical Systems. Other coursework may be approved by the division.

22 Landscaping and Nursery Operations Option Turf and Landscape Maintenance Option Landscape plant materials, landscape installation and land- Turfgrass science and turf management as well as landscape scape plant production are areas emphasized leading to maintenance are emphasized leading to careers in the lawn careers in the landscaping and nursery industries. care and landscape maintenance industries.

Course Course Credit Course Course Credit Number Title Hours Number Title Hours

Fall Fall AGR 104 Agricultural Survey and Employment Skills 3 AGR 104 Agricultural Survey and Employment Skills 3 AGR 143 Landscape Plant Materials 4 AGR 133 Turf Science 3 AGR 150 Soil Science 4 AGR 150 Soil Science 4 ENG 111 English I 4 ENG 111 English I 4

ITS 103 Information Technology Basics 3 ITS 103 Information Technology Basics 3 Horticultural Industries

Winter Winter AGR 108 Technical Math for Agriculture 3 AGR 108 Technical Math for Agriculture 3 AGR 151 Soil Fertility 4 AGR 151 Soil Fertility 4 AGR 226 Landscape Design 4 BIO 140 Plant Science 4 BIO 140 Plant Science 4 COM 121 Effective Speaking 3 ENG 112 English II 4 ENG 112 English II 4

Spring Spring AGR 145 Herbaceous Plant Materials 4 AGR 145 Herbaceous Plant Materials 4 AGR 193 Horticulture Co-op Experience I 3 AGR 193 Horticulture Co-op Experience I 3

Summer Summer AGR 293 Horticulture Co-op Experience II 3 AGR 293 Horticulture Co-op Experience II 3 – – Humanities/Social Science Elective 3 – – Humanities/Social Science Elective 3

Fall Fall AGR 122 Plant Pests 4 AGR 122 Plant Pests 4 AGR 174 Agribusiness Principles 3 AGR 143 Landscape Plant Materials 4 AGR 225 Landscape Maintenance 4 AGR 174 Agribusiness Principles 3 ACC 111 Principles of Accounting I 4 AGR 225 Landscape Maintenance 4 COM 121 Effective Speaking 3 AGR 236 Turfgrass Management 3

Winter Winter AGR 105 Principles of Ag Sales I 3 AGR 105 Principles of Ag Sales I 3 AGR 231 Plant Propagation 4 AGR 253 Pest Management 5 AGR 253 Pest Management 5 AGR 284 Agribusiness Management 4 AGR 284 Agribusiness Management 4 AGR – Ag/Hort Elective* 3 AGR – Ag/Hort Elective* 3 ENG 223 Technical Report Writing 3

Spring Spring AGR 219 Landscape Construction 4 AGR 219 Landscape Construction 4 ENG 223 Technical Report Writing 3 ACC 111 Principles of Accounting I 4 – – Social Science Elective 3 – – Social Science Elective 3 – – Humanities/Social Science Elective 3 – – Humanities/Social Science Elective 3

Total credit hours 100 Total credit hours 98

*Ag/Hort electives may be any AGR course not required in the *Ag/Hort electives may be any AGR course not required in the program. Suggested Ag/Hort electives include: AGR 224 Irrigation program. Suggested Ag/Hort electives include: AGR 115 Welding, Systems, AGR 297 Landscape Design II, or INT 150 Electrical AGR 185 Vehicle Operations and Management, AGR 224 Irrigation Systems. Other coursework may be approved by the division. Systems, AGR 226 Landscape Design II, INT 120 Fluid Power, or INT 150 Electrical Systems. Other coursework may be approved by the division.

23 Course Course Credit Business Management Number Title Hours The Business Management curriculum provides a well- rounded education consisting of basic courses in accounting, Fall information technology, economics, finance, business law, BUS 105 Introduction to Business 3 ACC 111 Principles of Accounting I 4 management, marketing operations, interpersonal and cus- ENG 111 English I 4 tomer service skills and communications. The associate ITS 103 Information Technology Basics* 3 degree in Business Management provides students with MTH 106 Business Mathematics 3 knowledge and skills for managing people, finances and operations. Winter The program schedule that follows is designed for full- BUS 106 Human Relations and time students who have completed all prerequisites and Organizational Behavior 4 who have no developmental recommendations. Many indi- BUS 112 Principles of Business Management 4 viduals, especially part-time students and those taking BUS – Business Elective** or EBE 100 2 ACC 112 Principles of Accounting II 4 developmental courses, will require additional quarters of ENG 112 English II or study. Students should consult their academic advisors for ENG 135 Business Report Writing*** 4 help in planning their schedules. Students who would like to enhance their associate de- Spring gree in any field or those who do not plan to complete an BUS 202 Customer and Quality Management 4 associate degree in Business Management may select an ACC 113 Principles of Accounting III 4 abbreviated education by completing the course require- COM 121 Effective Speaking 3 ments for departmental certificates in Small Business, Customer ENG 221 Business Communications 3

Business Management Service, Supervision or Arts Administration. In addition, ITS 12D Beginning Database* 1 ITS 12S Beginning Spreadsheet* 1 the College offers a one-year certificate program in Business Management. Fall BUS 243 Principles of Marketing 4 Learning Outcomes BUS 266 Quantitative Business Methods or Upon completion of an associate degree in Business Man- STT 264 Statistics I 4 agement, a graduate will be able to: BUS – Business Elective** or Co-op Experience 4 • demonstrate understanding of and apply basic business ECO 221 Principles of Macroeconomics 3 and management concepts, skills and tools. – – Social Science Elective 3 • demonstrate communications and human relations knowledge and skills. Winter BUS 260 Business Law 3 • analyze quantitative data. BUS 270 Business Finance 4 • demonstrate understanding of ethical, social responsibil- BUS 272 Productions/Operations Management 3 ity and legal issues. ECO 222 Principles of Microeconomics 3 • demonstrate understanding of international business – – Humanities/Social Science Elective 3 issues. • demonstrate information technology skills. Spring BUS 225 Human Resource Management 3 BUS 250 Leadership in Organizations 4 Degree Availability BUS 290 Business Strategy and Policy Seminar 4 The Business Management program is available during the BUS – Business Elective** or Co-op Experience 4 day and the evening. Students should consult with their – – Humanities/Social Science Elective 3 advisor for the recommended sequencing of evening courses. Total credit hours 103 Humanities/Social Science Electives A complete listing of humanities and social science electives *Students with little or no computer background should enroll in begins on page 5. ITS 080 Computer Fundamentals as a preparatory course before taking other computer courses. Students without adequate keyboarding skills should enroll in ITS 102 Keyboarding/Word Processing. **Business electives include courses which are not already required for the Business Management program and carry ACC, BUS, CSD, ITS, NTK, OAD or RES prefixes. ITS 080 cannot be used as an elective. Students wishing to complete one or more co-op experiences must take EBE 100 as a business elective prior to the co-op experience. ***ENG 135 Business Report Writing will not necessarily transfer as the equivalent of ENG 112 English II.

24 Electronic Business Option Course Course Credit The Electronic Business option provides students with a Number Title Hours well-rounded education in business management with a Fall focus in management of the electronic business. The broad BUS 105 Introduction to Business 3 education in business management is enhanced with courses ACC 111 Principles of Accounting I 4 in electronic business and information technology, to pro- ENG 111 English I 4 vide knowledge and skill necessary for e-business management. ITS 103 Information Technology Basics* 3 The program schedule that follows is designed for full- MTH 106 Business Mathematics 3 time students who have completed all prerequisites and who have no developmental recommendations. Many indi- Winter BUS 106 Human Relations and viduals, especially part-time students and those taking Organizational Behavior 4 developmental courses, will require additional quarters of BUS 112 Principles of Business Management 4 study. Students should consult their academic advisors for ACC 112 Principles of Accounting II 4 Business Management help in planning their schedules. NTK 152 Internet Technologies 5

Learning Outcomes Spring Upon completion of an associate degree in Electronic Busi- BUS 202 Customer & Quality Management 4 ness, a graduate will be able to: ACC 113 Principles of Accounting III 4 • demonstrate understanding of and apply basic business COM 121 Effective Speaking 3 ENG 112 English II or and management concepts, skills and tools. ENG 135 Business Report Writing** 4 • demonstrate communications and human relations knowl- ENG 221 Business Communications 3 edge and skills. • analyze quantitative data. Fall • demonstrate understanding of ethical, social responsibil- BUS 243 Principles of Marketing 4 ity and legal issues. BUS 266 Quantitative Business Methods or • demonstrate understanding of international business is- STT 264 Statistics I 4 sues. ECO 221 Principles of Macroeconomics 3 • demonstrate information technology skills, including the GPH 105 Design Fundamentals or 3 use of Internet resources and tools. GPH 100 Introduction to Graphic Design 4 ITS 12D Beginning Database* 1 • demonstrate knowledge of electronic business theories ITS 12S Beginning Spreadsheet* 1 and concepts through electronic business site analysis. Winter Degree Availability BUS 140 Introduction to Electronic Business 3 The Electronic Business option is available during the day BUS 260 Business Law 3 and in the evening. Students should consult with their BUS 270 Business Finance 4 advisor for the recommended sequencing of evening courses. – – Social Science Elective 3 – – Humanities/Social Science Elective 3 Humanities/Social Science Electives Spring A complete listing of humanities and social science electives BUS 142 Electronic Business Applications 3 begins on page 5. BUS 225 Human Resource Management 3 BUS 250 Leadership in Organizations 4 BUS 290 Business Strategy and Policy Seminar 4 – – Humanities/Social Science Elective 3

Total credit hours 101 - 102

25 Business Management Certificate The Business Management certificate provides students with an overview of the business environment and a background for understanding and managing people. It provides them with the foundational knowledge of accounting and financial issues needed by all managers. All courses taken for this certificate are applicable to the associate degree in Business Management. The program schedule that follows is designed for full- time students who have completed all prerequisites and who have no developmental recommendations. Many individuals, especially part-time students and those taking developmental courses, will require additional quarters of study. Students should consult their academic advisor for help in planning their schedules.

Course Course Credit Number Title Hours

Fall BUS 105 Introduction to Business 3 ACC 111 Principles of Accounting I 4

Business Management ENG 111 English I 4 ITS 103 Information Technology Basics* 3 MTH 106 Business Mathematics 3

Winter BUS 106 Human Relations and Organizational Behavior 4 BUS 112 Principles of Business Management 4 ACC 112 Principles of Accounting II 4 ENG 112 English II or ENG 135 Business Report Writing*** 4 ITS 12D Beginning Database 1

Spring BUS 202 Customer & Quality Management 4 BUS – Business Elective** 3 ACC 113 Principles of Accounting III 4 COM 121 Effective Speaking 3 ENG 221 Business Communications 3

Total credit hours 51

*Students with little or no computer background should enroll in ITS 080 Computer Fundamentals as a preparatory course before taking other computer courses. Students without adequate keyboarding skills should enroll in ITS 102 Keyboarding/Word Processing. **Business electives include courses which are not required for the Business Management certificate and carry BUS, ACC, CSD, ITS, NTK, OAD or RES prefixes. ITS 080 cannot be used as an elective. ***ENG 135 Business Report Writing will not necessarily transfer as the equivalent of ENG 112 English II.

26 Small Business Departmental Certificate Business Management This certificate is focused on developing the essential knowledge Departmental Certificates needed by an individual who wants to start a small business. It will provide the student with the necessary tools for Supervisory Departmental Certificate developing a successful business operation. All courses can This certificate is focused on developing the essential skills be applied to the associate degree in Business Management. and knowledge needed by first-line supervisors. This will Course Course Credit provide an individual with the tools with which to motivate, Number Title Hours challenge and manage employees. All courses can be applied to the associate degrees in Business Management and Elec- BUS 105 Introduction to Business 3 tronic Business. BUS 106 Human Relations and Organizational Behavior 4

Course Course Credit BUS 112 Principles of Business Management 4 Business Management Number Title Hours BUS 140 Introduction to Electronic Business 3 BUS 202 Customer & Quality Management 4 BUS 105 Introduction to Business 3 BUS 214 Small Business Theory & Practice 4 BUS 106 Human Relations and BUS 243 Principles of Marketing 4 Organizational Behavior 4 BUS 245 Sales/Sales Promotion 3 BUS 112 Principles of Business Management 4 BUS 250 Leadership in Organizations 4 BUS 202 Customer & Quality Management 4 BUS 260 Business Law 3 BUS 225 Human Resource Management 3 ACC 111 Principles of Accounting I 4 BUS 250 Leadership in Organizations 4 ACC 112 Principles of Accounting II 4 ACC 111 Principles of Accounting I 4 ITS 103 Information Technology Basics 3 ITS 103 Information Technology Basics 3 PSY 111 Psychology I 3 Total credit hours 47

Total credit hours 32

Customer Service Departmental Certificate This certificate is focused on developing the essential skills and knowledge needed by anyone desiring to provide excellent service to customers–both internal and external to the organization. This is particularly focused on meeting needs and expectations of an organization’s customers. All courses can be applied to the associate degree in Business Management.

Course Course Credit Number Title Hours

BUS 105 Introduction to Business 3 BUS 106 Human Relations and Organizational Behavior 4 BUS 112 Principles of Business Management 4 BUS 202 Customer & Quality Management 4 BUS 243 Principles of Marketing 4 BUS 245 Sales/Sales Promotion 3 ITS 103 Information Technology Basics 3 PSY 111 Psychology I 3

Total credit hours 28

27 Course Course Credit CAD Drafting Technology Number Title Hours Students completing an associate degree in CAD Drafting Technology are qualified to play a support role to the Fall engineering professions in industrial, research and aca- DFT 102 Drafting II 3 ENT 101 Engineering Methods 3 demic areas preparing drawings, blueprints, layouts, bills of ENT 121 Computer Basics for Applied Technology 3 materials, manufacturing and product support documenta- ENG 111 English I 4 tion. In addition to applied technical courses, CAD Drafting INT 101 Metrology I 2 Technology includes an optional co-op experience. Train- MTH 101 Technical Math Applications A 1 ing in the area of advanced computer-aided drafting is also included. Students are responsible for finding an industry- Winter related work experience and documenting how that experience DFT 211 Computer-Aided Design I 4 has expanded their understanding of the career field. ENG 112 English II 4 Most of the first-year courses are offered as both day and MAT 110 Manufacturing Processes 3 evening sections. It is intended that the programs can be MAT 111 Manufacturing Laboratory 2 MTH 107 Technical Math Applications B 1 completed by taking courses in the evening on a part-time MTH 121 College Algebra I 3 basis. Students may be required to take evening classes to complete the program since day sections may not be offered Spring for some of the second-year courses. DFT 212 Computer-Aided Design II 4 The program schedule that follows is designed for full- ENG 223 Technical Report Writing 3

CAD Drafting time students who have completed all prerequisites and ENT 111 Engineering Materials 3 who have no developmental recommendations. Many indi- MTH 108 Technical Math Applications C 1 viduals, especially part-time students and those taking MTH 140 Trigonometry 3 developmental courses, will require additional quarters of PHY 111 Physics I 4 study. Students should consult their academic advisors for Fall help in planning their schedules. DFT 103 Descriptive Geometry 4 ENT 205 Circuits and Machines 4 Learning Outcomes ENT 211 Statics 3 Upon completion of an associate degree in CAD Drafting PHY 112 Physics II 4 Technology, a graduate will be able to: • produce a finished product per quality specifications Winter provided by the instructor using knowledge of engineer- DFT 214 Solid Modeling 4 ing materials, metrology and manufacturing processes. COM 121 Effective Speaking 3 ENT 213 Strength of Materials 4 • prepare drawings to completely describe a part for manu- – – Global Awareness Humanities/ facture per American National Standards Institute (ANSI) Social Science Elective* 3 specifications. – – Technical Elective** 2 • apply drafting skills, knowledge and ability in Computer- Aided Design (CAD) to produce mechanical drawings Spring using a CAD system. DFT 203 Technical Publication 4 • use knowledge of construction materials and practices to ECO 110 General Economics* 3 specify and provide cost and material estimates for a SOC 110 Sociology* 3 construction project. – – Technical Elective** 4 • apply drafting skills and proficiency with Computer- Total credit hours 96 Aided Design (CAD) to produce an illustrated part/ maintenance manual. *Other humanities/social science electives may be substituted. **Students must select a minimum of six credits of technical Scholastic Preparation elective coursework from the following to complete graduation Students starting the program should have had two years of requirements: DFT 215, EBE 100 (only if EBE 282, EBE 283, or high school drafting and one year each of high school EBE 284 is selected), EBE 284, ENT 212, INT 140, INT 252, INT algebra, trigonometry and physics or equivalent. Students 255, INT 260, INT 280, MAT 100, MAT 112. Other technical coursework may be approved by the division. may take these preparatory courses at Clark State but it will require a longer amount of time to complete their degree program. Students who have not had two years of high school drafting or significant work experience in drafting will be required to take DFT 101 Drafting I. Those without high school physics must complete PHY 110 Fundamentals of Physics.

28 Course Course Credit Computer-Aided Design (CAD) Number Title Hours

Certificate Fall The Computer-Aided Design (CAD) Certificate is designed DFT 102 Drafting II 3 to provide the technical background necessary to produce ENT 101 Engineering Methods 3 mechanical drawings using both manual and computer- ENT 121 Computer Basics for Applied Technology 3 aided drafting techniques. Manufacturing coursework is ENG 111 English I 4 INT 101 Metrology I 2 included to help students understand the principles of MTH 101 Technical Math Applications A 1 manufacturability in mechanical design. Certificate programs are designed for those students who Winter seek to enhance their job-related skills in a specialized area. DFT 211 Computer-Aided Design I 4 These certificates are typically a portion of the courses in MAT 110 Manufacturing Processes 3 one of the associate degree programs. Certificate programs MAT 111 Manufacturing Laboratory 2 Computer-Aided Design will take somewhat longer than one year to complete due to MTH 107 Technical Math Applications B 1 the sequence of prerequisites and the terms in which courses MTH 121 College Algebra I 3 are offered. Coursework included in a certificate program may ultimately be applied for the associate degree in the Spring DFT 212 Computer-Aided Design II 4 related technology program. ENT 111 Engineering Materials 3 The program schedule that follows is designed for full- MTH 108 Technical Math Applications C 1 time students who have completed all prerequisites and MTH 140 Trigonometry 3 who have no developmental recommendations. Many individuals, especially part-time students and those taking Fall developmental courses, will require additional quarters of DFT 103 Descriptive Geometry 4 study. Students should consult their academic advisors for help in planning their schedules. Winter DFT 214 Solid Modeling 4

Scholastic Preparation Total credit hours 48 The amount of time required to complete a certificate program is dependent on the level of student preparation. Students starting the programs should have had one year each of high school algebra, trigonometry and physics or equivalent. Students electing the CAD certificate program should also have had two years of high school drafting. Students may take these preparatory courses at Clark State but it will require a longer amount of time to complete their program.

29 Course Course Credit Engineering Transfer Number Title Hours The Engineering and Industrial Technologies Transfer program is a calculus-based pre-engineering curriculum that Fall will prepare a student to transfer into a baccalaureate degree CHM 121 General Chemistry I 5 ENG 111 English I 4 engineering program at a college or university. It serves as HST 111 Western Civilization to 14th Century 3 a general guideline for transfer. The best selection of MTH 221 Calculus I ** 5 courses for a given student will vary depending upon the area of engineering one wishes to pursue and the institution Winter to which the student plans to transfer. DFT 211 Computer Aided Design I 4 The program schedule that follows is designed for full- ENG 112 English II 4 time students who have completed all prerequisites and HST 112 Western Civilization from th th who have no college preparatory education recommenda- 14 through 18 Centuries 3 tions. Many individuals, especially part-time students and MTH 222 Calculus II 5 those taking college preparatory education courses, will Spring require additional quarters of study. Students should con- ENG 230 Great Books: Literature 3 sult their academic advisors for help in planning their HST 113 Western Civilization from 19th schedules. Century to Present 3 MTH 223 Calculus III 5 Learning Outcomes SOC 110 Sociology 3 Upon completion of an associate degree in pre-engineering, a graduate will be able to meet the goals Summer

Engineering Transfer ECO 110 General Economics 3 outlined for the general associate of science degree plus the MTH 240 Linear Algebra 3 student will be able to: PLS 130 Political Issues 3 • formulate the mathematical models for physical and engineering problems Fall • analyze the mathematical models of physical and engi- MTH 224 Calculus IV/Multivariate Calculus 5 neering problems PHY 250 General Physics I *** 6 • formulate kinematics and dynamics problems PSY 111 Psychology I 3 • analyze kinematics and dynamics problems GEO 220 World Regional Geography or SOC 220 Comparing Cultures 3 Scholastic Preparation Students entering this program should have taken all of the Winter ENT 261 Engineering Mechanics I 5 high-level mathematics and calculus-based courses offered MTH 230 Differential Equations or by their high schools. Students who cannot test into CHM 122 General Chemistry II **** 5 Calculus I will need to take the necessary prerequisite PHY 251 General Physics II 5 mathematics courses before beginning the calculus sequence. ART 130 Appreciation of the Arts or Students should also have taken all of the high school MUS 130 Music Appreciation or physics and chemistry courses available to them. If they THE 130 Introduction to Theatre 3 have not had adequate preparation in these areas, they will need to take the prerequisite chemistry (CHM 110) and Spring ENT 262 Engineering Mechanics II 5 physics courses (PHY 110). PHL 250 Great Books: Philosophy 3 PHY 252 General Physics III 5 RST – Regional Studies Course 3

Total credit hours 107

**Students not prepared for calculus, must take the necessary math prerequisites before MTH 221. Students who need the college algebra sequence and trigonometry courses, will need three years to progress through the course sequence.

***Students who cannot test out of PHY 110 will need to take that as a prerequisite to PHY 250.

****Some students may wish to complete the 3-quarter chemistry sequence for transfer purposes.

30 Industrial Technology Industrial Technology The associate of applied science degree in Industrial Tech- The Industrial Technology program has been developed in nology provides a broad base in the maintenance of electrical, response to the great need expressed by manufacturers in mechanical and fluid power systems. Further specialized the Champaign, Clark, Greene and Logan County areas for coursework in electrical power, controls and automation skilled technicians. The program is intended to train for prepares the student for an entry-level position as a main- career fields such as electrician, machine repair technician tenance technician. or maintenance technician. Technical coursework in the program is designed such Course Course Credit that it can be used to support company-sponsored appren- Number Title Hours ticeship programs. Fall INT 101 Metrology I 2 Learning Outcomes INT 120 Fluid Power I 4 Upon completion of an associate degree in Industrial Tech- DFT 101 Drafting I 3 nology, a graduate will be able to: ENG 111 English I 4

• demonstrate basic knowledge of electrical, mechanical ENT 121 Computer Basics for Applied Technology 3 Industrial and fluid power machines. • use commonly available instruments to assist in analysis Winter and troubleshooting of electrical and electrically con- INT 115 Industrial Calculations 3 trolled systems. INT 125 Fluid Power II 4 • use schematics, operating manuals and troubleshooting INT 150 Electrical Systems 4 guides to troubleshoot equipment. DFT 211 Computer-Aided Design I 4 ENG 112 English II 4 • design, build and document an industrial project. • demonstrate a basic knowledge of operation and pro- Spring gramming automated systems. INT 140 Industrial Safety 3 • apply computers in troubleshooting, maintenance plan- INT 155 Motors and Motor Controls 4 ning and report writing using application software. INT 170 Mechanical Maintenance 4 COM 111 Interpersonal Communications 3 Directed Learning Laboratory EBE 100 Employability Skills 2 Clark State Community College has recognized the need for students who are currently working to have flexible class Summer EBE 284 Co-op Education I 4 hours. As a result, many of the courses in the Industrial Technology program will be offered in the College’s Di- Fall rected Learning Laboratory. Most Industrial Technology INT 250 Programmable Logic Controllers 3 (INT) courses, along with other selected technical courses, EBE 294 Co-op Education II 4 will be offered in a modular format that will allow students NTK 176 PC Network Essentials I 6 to come to the lab on their own schedule and complete the SPN 100 Conversational Spanish* 3 coursework and laboratory assignments. The lab will be staffed by a faculty member and open both day and evening Winter hours to accommodate many working schedules. The days INT 255 Electrical Troubleshooting 4 INT 260 Electrical Distribution 4 and times that students complete the coursework in the lab ENG 223 Technical Report Writing 3 is up to the individual student within the open hours of the – – Global Awareness Humanities/ lab. Some group assignments may be required. Social Science Elective 3

Scholastic Preparation Spring Students should have had one year of high school algebra or INT 252 Automated Systems 4 equivalent. Students may take these preparatory courses at INT 270 Industrial Machine Maintenance 4 Clark State, but it will require a longer amount of time to INT 280 Industrial Technology Projects 4 complete their degree program. The format of classes in the COM 121 Effective Speaking 3 ECO 110 General Economics 3 Directed Learning Laboratory is primarily self-directed with support provided by a faculty member. The ability to learn Total credit hours 103 on an independent basis will help ensure student success in this program. *Other humanities and social science electives may be substituted. At least one must be a social science elective.

31 Electronics Certificate Industrial Technology The Electronics Certificate provides an extensive study of solid- state devices and systems for industrial operations. Electrical Maintenance Certificate The Electrical Maintenance Certificate provides a broad Course Course Credit base of courses in the field of industrial maintenance. Number Title Hours Fall Course Course Credit INT 101 Metrology 2 Number Title Hours INT 105 Blueprint Reading and Schematics 3 INT 115 Industrial Calculations 3 Fall INT 125 Foundations of digital Control 4 INT 101 Metrology I 2 INT 150 Electrical Systems 4 INT 120 Fluid Power I 4 ENT 101 Computer Basics for Applied Technologies 3 DFT 101 Drafting I 3 ENT 121 Computer Basics for Applied Technology 3 ENG 111 English I 4 Winter INT 212 Electronic Systems 4 INT 250 Programmable Logic Controllers 3 Winter COM 121 Effective Speaking 3 INT 115 Industrial Calculations 3 EBE 100 Employability Skills 2 INT 125 Fluid Power II 4 ENG 111 English I 4 INT 150 Electrical Systems 4 Industrial INT 170 Mechanical Maintenance 4 EBE 100 Employability Skills 2 Spring INT 155 Motors and Motor Controls 4 INT 225 Industrial Electronics 3 Spring INT 252 Automated Systems 4 INT 155 Motors and Motor Controls 4 EBE 284 Co-Op I 4 INT 250 Programmable Logic Controllers 3 COM 121 Effective Speaking 3 Total credit hours 48 EBE 284 Co-op Education I 4

Total credit hours 47

32 Course Course Credit Manufacturing Engineering Number Title Hours

Technology Fall The Manufacturing Engineering Technology program pre- DFT 102 Drafting II 3 pares students for a variety of positions within a manufacturing ENT 101 Engineering Methods 3 enterprise. The program builds on the student’s knowledge ENT 121 Computer Basics for Applied Technology 3 of computer-aided design, electronics and manufacturing INT 101 Metrology I 2 ENG 111 English I 4 processes, providing additional skills in areas such as statis- MTH 101 Technical Math Applications A 1 tical process control, automation and computer numerical control. Winter The program schedule that follows is designed for full- MAT 110 Manufacturing Processes 3 time students who have completed all prerequisites and MAT 111 Manufacturing Processes Lab 2 who have no developmental recommendations. Many indi- DFT 211 Computer-Aided Design 4 ENG 112 English II 4 viduals, especially part-time students and those taking Manufactturing developmental courses, will require additional quarters of MTH 107 Technical Math Applications B 1 study. Students should consult their academic advisors for MTH 121 College Algebra I 3 help in planning their schedules. Spring DFT 212 Computer-Aided Design II 4 Learning Outcomes ENT 111 Engineering Materials 3 Upon completion of an associate degree in Manufacturing EBE 100 Employability Skills 2 Technology, a graduate will be able to: MTH 108 Technical Math Applications C 1 • demonstrate basic knowledge of manufacturing processes MTH 140 Trigonometry 3 including fabrication and assembly of metals, plastics, PHY 111 Physics I 4 ceramics and composites. • use basic computer-aided design skills to draw parts, Summer ENT 205 Circuits and Machines 4 fixtures and equipment layouts. ENT 210 Engineering Statistics 3 • demonstrate a basic knowledge of quality assurance. EBE 284 Co-op Education I 4 • demonstrate a basic knowledge of process control including CNC programming and PLC controls. Fall • demonstrate a basic knowledge of materials properties, ENT 211 Statics 3 manufacturing methods and cost. INT 215 Statistical Process Control 3 • design, build and document an industrial project. INT 250 Programmable Logic Controllers 3 COM 121 Effective Speaking 3 ENG 223 Technical Report Writing 3 Humanities/Social Science Electives A complete listing of humanities and social science electives Winter begins on page 5. MAT 221 Computer Numerical Control 4 ENT 213 Strength of Materials 4 INT 252 Automated Systems* 4 – – Global Awareness Humanities/ Social Science Elective 3 SOC 110 Sociology** 3

Spring EBE 294 Co-op Education II 4 ECO 110 Economics** 3 – – Technical Elective *** 3 – – Technical Elective *** 3

Total credit hours 107

*Students can select MAT 297 Robotics and Industrial Robots instead of INT 252 Automated Systems. **Other humanities/social science electives may be substituted. ***Students must select a minimum of six credits of technical elective coursework from the following to complete graduation requirements: DFT 203, DFT 214, DFT 215, INT 252 (or MAT 297), INT 255, INT 260, INT 280, MAT 100, MAT 112, MAT 222, and NTK 176. Other technical coursework may be approved by the division.

33 Course Course Credit Manufacturing Certificate Number Title Hours The Manufacturing Certificate is designed for students who wish to enhance their skills in areas related to manufactur- Fall DFT 102 Drafting II 3 ing. Courses in drafting, computer-aided design, programmable ENT 101 Engineering Methods 3 logic controllers, automated systems and robotics are in- ENT 121 Computer Basics for Applied Technology 3 cluded since these skills are needed in new and in updating ENG 111 English I 4 existing manufacturing processes. The program courses are MTH 101 Technical Math Applications A 1 all included in the Manufacturing Technology associate MTH 121 College Algebra I 3 degree so students can continue with that program after achieving their certificate. Some of the courses are taught in Winter the Directed Learning Lab so they can fit the student’s MAT 110 Manufacturing Processes 3 schedule. MAT 111 Manufacturing Processes Lab 2 DFT 211 Computer-Aided Design I 4 ENT 205 Circuits and Machines 4 Scholastic Preparation MTH 107 Technical Math Applications B 1 The time required for a student to complete the certificate MTH 140 Trigonometry 3 will depend on their level of participation. They should have high school drafting, algebra, trigonometry and physics or Spring its equivalent. These preparatory courses can be taken at INT 101 Metrology I 2 Clark State but that will increase the time required to INT 250 Programmable Logic Controllers 3 complete the program. INT 252 Automated Systems 4 Manufacturing ENG 112 English II 4 MTH 108 Technical Math Applications C 1 PHY 111 Technical Physics I 4

Total credit hours 52

34 Course Course Credit Graphic Design Number Title Hours Graphic design is one of the fastest growing and most diverse professions in the communications field. Graphic designers Fall develop a variety of visual communication solutions for GPH 100 Introduction to Graphic Design 4 GPH 105 Design Fundamentals 3 clients including magazine and newspaper advertising, an- ART 111 Drawing I 3 nual reports, product packaging, brochures, corporate identity, BUS 105 Introduction to Business 3 catalogs, editorial graphics, book covers, and posters. ENG 111 English I 4 The aim is integration of the conceptual and the technical. Students will develop critical and conceptual thinking Winter abilities so that they can communicate any idea clearly and GPH 110 Digital Illustration 3 powerfully. Students will be prepared for the practice of GPH 112 Digital Typography I 3 design in the professional context and provided the basis for ART 112 Drawing II 3 their continued creative and personal growth. With a prob- ENG 112 English II 4 SOC 220 Comparing Cultures 3 lem-solving format, students will develop visual communication Graphic Design skills, explore the integration of type and images through a Spring variety of traditional and computer media, and imagina- GPH 114 Digital Typography II 3 tively deliver messages responsive to the needs of the sender GPH 201 Electronic Imagery I 3 and the receiving audience. ART 113 Drawing III 3 The Graphic Design program is a two-year computer ART 135 Art History III 3 intensive learning experience focusing on industry-stan- ENG 223 Technical Report Writing 3 dard practices. Dedicated to keeping up with technological advances affecting the visual arts, the program integrates Fall GPH 120 Logo, Symbol, Corporate ID 3 technology with fine arts sensibility. GPH 202 Electronic Imagery II 3 The program course schedule is designed for full-time GPH 211 Computer Layout I 3 students who have completed all prerequisites and who ART 130 Appreciation of the Arts 3 have no developmental recommendations. Many individu- PHL 220 Business Ethics 3 als, especially part-time students and those taking developmental courses, will require additional quarters of study. Students Winter should consult their academic advisor for help in planning GPH 203 Electronic Imagery III 3 their schedules. GPH 212 Computer Layout II 3 GPH 220 Illustration Techniques 3 GPH 251 Professional Development I 3 Learning Outcomes BUS 140 Introduction to Electronic Business 3 Upon completion of an associate degree in Graphic Design, a graduate will be able to: Spring • utilize QuarkXpress effectively as a layout tool. GPH 205 Advertising Layout 3 • utilize Adobe PhotoShop effectively as an image-editing GPH 230 Introduction to Web Design 3 tool. GPH 252 Professional Development II 3 • utilize Adobe Illustrator effectively as a vector graphic/ GPH 285 Graphic Design Internship 3 illustration tool. BUS 106 Human Relations and • verbally communicate their ideas, concepts and design Organizational Behavior 4 knowledge. Total credit hours 94 • design effectively with type. • present themselves in an organized and professional Note: It is extremely important that students save all artwork from manner. the first quarter forward to enable them to build a portfolio in GPH • write and design a professional resume and portfolio. 251 and GPH 252. • manage a design problem from conceptualization to a finished layout.

35 computer courses. Students without adequate keyboard- Information Technology Systems ing skills should enroll in ITS 102 Keyboarding/Word Information technology is one of the fastest-growing career Processing. fields today. Computer Software Development students can increase Degree Availability their learning (and earning) potential by participating in These programs are available during the day and evening. the cooperative education work experience program. Through Contact your academic advisor about evening curriculum this program, students can spend up to two quarters guides. working in the information technology field while earning college credits. Interested students should contact Humanities/Social Science Electives their academic advisor or the director of Career Services A complete listing of humanities and social science electives for more information. begins on page 5. The program schedule that follows is designed for full- time students who have completed all prerequisites and Course Course Credit who have no developmental or college preparatory educa- Number Title Hours tion recommendations. Many individuals, especially part-time students and those taking developmental or college prepa- Fall CSD 104 Programming Fundamentals 5 ratory education courses, will require additional quarters of ENG 111 English I 4 study. Students should consult their academic advisors for ITS 107 HTML Fundamentals 3 help in planning their schedules. ITS 108 XML/Web Services 3 ITS 109 Introduction to SQL 3 Computer Software Development

Information Technology The Computer Software Development curriculum prepares Winter the students to analyze, design and develop solutions to CSD 114 Visual Basic for Web Services 5 business problems through the use of technology. Students CSD 130 Database Modeling 3 CSD 160 Database Design 5 learn and work with a variety of popular programming PHL 200 Practical Logic 3 languages and industry-standard development tools, as well – – CSD, ITS, NTK Elective or EBE 100* 2 as database management tools. Object-oriented and client- server application environments are used. Student will Spring work within a variety of operating system environments. CSD 116 Web Services Applications 5 Specific attention will be paid to the Web Services program- CSD 118 Programming with ADO 3 ming model. CSD 150 Database Administration 5 ENG 112 English II or Learning Outcomes ENG 135 Business Report Writing ** 4 Upon completion of an associate degree in Computer Soft- Fall ware Development, a graduate will be able to: CSD 208 Programming XML Web Services 3 • analyze business requirements. CSD 210 Programming Applications for Windows 3 • initiate, design and develop an information system. CSD 216 C Concepts I 5 • code and develop structural/procedural, object-oriented BUS 105 Introduction to Business 3 and scripting programming routines. ENG 221 Business Communications 3 • develop data models. • develop process models. Winter CSD 217 C Concepts II 5 • create objects and components. CSD 220 Systems Analysis 4 • develop prototypes. CSD 240 Component Object Model Development 5 • perform software testing, validation and evaluation. COM 121 Effective Speaking 3 • develop database programs. • demonstrate knowledge of software development meth- Spring odology via Systems Development Life Cycle (SDLC) CSD 222 Systems Design 4 usage. CSD 270 Creating and Publishing Websites 4 • demonstrate knowledge of Database Management Sys- BUS 106 Human Relations and tems (DBMS) basics. Organizational Behavior 4 COM 111 Interpersonal Communications 3 – – Social Science Elective 3 Scholastic Preparation Computer Software Development students need a high Total credit hours 105 school algebra background equivalent to DEV 101 or CPE 101 (Introduction to Algebra). Students with little or no *ITS 080 cannot be used as an elective. computer background should enroll in ITS 080 Computer **ENG 135 Business Report Writing will not necessarily transfer Fundamentals as a preparatory course before taking other as the equivalent of ENG 112 English II.

36 Microsoft Database Administration/Networking Computer Software Development Certificate Departmental Certificates This certificate is mapped to the MCDBA certification and A number of departmental certificates are offered in Infor- focuses on the networking track. mation Technology and are designed for individuals working in the field who may wish to upgrade their skills. Students Course Course Credit Number Title Hours who have little or no computer background are cautioned that these certificates may not provide the necessary infor- CSD 130 Database modeling 3 mation technology skills for them to achieve their goals. All CSD 150 Database Administration 5 course work completed is applicable to the appropriate CSD 160 Database Design 5 associate degree program. These certificates can be applied ITS 108 XML Web Services 3 for by filling out the certificate application form in the ITS 109 Intro to SQL 3 Information Technology Business Technologies Division office in the Brinkman Edu- NTK 270 Administering Microsoft Professional 5 NTK 272 Administering Microsoft Server 5 cational Center. NTK 274 Administering Microsoft Network 5

Computer Software Development/Programming Total Credit Hours 34 Certificate This certificate provides the knowledge and skills necessary to design and develop computer software applications. Systems Analysis Certificate Programming languages will include both procedural and This certificate provides the knowledge and skills necessary object-oriented. to analyze and develop business information systems. Both traditionally structured procedural methodologies and ob- Course Course Credit ject-oriented methodologies will be included. Number Title Hours Course Course Credit CSD 104 Programming Fundamentals 5 Number Title Hours CSD 114 Visual Basic for Web Services 5 CSD 118 Programming with ADO 3 CSD 104 Programming Fundamentals 5 CSD 130 Database modeling 3 CSD 130 Database Modeling 3 CSD 160 Database Design 5 CSD 150 Database Administration 5 CSD 210 Programming Applications for Windows 3 CSD 160 Database Design 5 CSD 216 C Concepts I 5 CSD 220 Systems Analysis 4 CSD 217 C Concepts II 5 CSD 222 Systems Design 4 CSD 240 Component Object Model Development 5 ITS 108 XML Web Services 3 ITS 107 HTML Fundamentals 3 ITS 109 Intro to SQL 3 ITS 108 XML Web Services 3 ITS 200 Project Management 5 ITS 109 Intro to SQL 3 Total credit hours 37 Total Credit Hours 48 Web Services Certificate Microsoft Database Administration/Programming The focus of this certificate is to provide the knowledge and skills necessary to develop web applications and e-business Certificate systems. Web languages will include both procedural and This certificate is mapped to the MCDBA certification and object-oriented. focuses on the programming track. Course Course Credit Course Course Credit Number Title Hours Number Title Hours CSD 104 Programming Fundamentals 5 CSD 104 Programming Fundamentals 5 CSD 114 Visual Basic for Web Services 5 CSD 114 Visual Basic for Web Services 5 CSD 116 Web Services Applications 5 CSD 116 Web Services Applications 5 CSD 118 Programming with ADO 3 CSD 118 Programming with ADO 3 CSD 130 Database Modeling 3 CSD 130 Database Modeling 3 CSD 150 Database Administration 5 CSD 160 Database Design 5 CSD 160 Database Design 5 CSD 208 Programming XML Web Services 3 CSD 208 Programming XML Web Services 3 CSD 270 Creating and Publishing Web Sites 4 ITS 107 HTML Fundamentals 3 ITS 107 HTML Fundamentals 3 ITS 108 XML Web Services 3 ITS 108 XML Web Services 3 ITS 109 Intro to SQL 3 ITS 109 Intro to SQL 3 NTK 270 Administering Microsoft Professional 5 NTK 272 Administering Microsoft Server 5 Total credit hours 42

Total Credit Hours 53 37 Degree Availability Information Technology Systems These programs are available during the day and evening. Information technology is one of the fastest-growing career Contact your academic advisor about evening curriculum fields today. guides. Network Administration students can increase their learning (and earning) potential by participating in the cooperative Humanities/Social Science Electives education work experience program. Through this pro- A complete listing of humanities and social science electives gram, students can spend up to two quarters working in the begins on page 5. information technology field while earning college credits. Interested students should contact their academic advisor. Course Course Credit The program schedule that follows is designed for full- Number Title Hours time students who have completed all prerequisites and who have no developmental recommendations. Many indi- Fall NTK 176 PC/Network Essentials I 6 viduals, especially part-time students and those taking ACC 111 Accounting I 4 developmental courses, will require additional quarters of BUS 105 Introduction to Business 3 study. Students should consult their academic advisors for ENG 111 English I 4 help in planning their schedules. Winter Network Administration NTK 152 Internet Technologies 5 The Network Administration curriculum prepares students NTK 178 PC/Network Essentials II 6 to plan, design, implement, troubleshoot and administer – – Business Management/Accounting Elective** 3 microcomputer-based networks. Students learn how to maintain ENG 112 English II or

Information Technology microcomputer systems, administer network server resources/ ENG 135 Business Report Writing* 4 services and design and implement the network infrastructure. This curriculum focuses on assisting students in preparing Spring for the following certification: CompTIA (A+, Server+, Net- NTK 250 Novell Administration 5 work+, i-Net+, Linux+, Security+, Project+), Novell (Certified ENG 221 Business Communication 3 NetWare Administrator), Microsoft (Microsoft Certified Pro- ITS 200 Project Management 5 fessional) and Cisco (Certified Network Associate). – – Social Science Elective 3

Fall Learning Outcomes NTK 201 Cisco Associate I 5 Upon completion of an associate degree in Network Admin- NTK 240 Unix/Linux Administration I 5 istration, a graduate will be able to: NTK 270 Administering Windows Professional 5 • demonstrate knowledge of PC Server terms and concepts. – – Humanities Elective 3 • demonstrate the ability to troubleshoot basic desktop and server hardware and operating system problems. Winter • demonstrate the ability to install, configure and manage NTK 202 Cisco Associate II 5 Internet services. NTK 221 Information Security I 5 • demonstrate proficiency in installing, managing and con- NTK 272 Administering Windows Server 5 – – Humanities/Social Science Elective 3 figuring network operating systems. • demonstrate knowledge of basic LAN/WAN technologies. Spring • demonstrate proficiency in implementing intermediate NTK 203 Cisco Associate III 5 LAN/WAN technologies and hardware components. NTK 279 Managing a MS Network Environment 5 • demonstrate proficiency in implementing basic network NTK 288 Advanced Networking Topics or 5 security technologies and tools. EBE 100* Employability Skills and EBE 283 Co-Op Scholastic Preparation – – Humanities/Social Science Elective 3 Network Administration students should have completed Total credit hours 105 high school algebra or DEV 101 or CPE 101 (Introduction to Algebra) by the completion for their first year. Students *ENG 135 Business Report Writing will not necessarily transfer as with little or no computer background should enroll in ITS the equivalent of ENG 112 English II. 080 Computer Fundamentals as a preparatory course before **If a student wishes to complete EBE 283 or some other co-op, taking other computer courses. Students without adequate he or she must take EBE 100 prior to signing up for the co-op keyboarding skills should enroll in ITS 102 Keyboarding/ experience (EBE 283). Word Processing.

38 Degree Availability Information Technology Systems These programs are available during the day and evening. Information technology is one of the fastest-growing career Contact your academic advisor about evening curriculum fields today. guides. Technical Systems Support students can increase their learning (and earning) potential by participating in the coop- Humanities/Social Science Electives erative education work experience program. Through this A complete listing of humanities and social science electives program, students can spend up to two quarters working in begins on page 5. the information technology field while earning college credits. Interested students should contact their academic advisor Course Course Credit or the director of Career Services for more information. Number Title Hours The program schedule that follows is designed for full- Fall time students who have completed all prerequisites and Information Technology who have no developmental or college preparatory educa- NTK 176 PC/Network Essentials I 6 ACC 111 Principles of Accounting I 4 tion recommendations. Many individuals, especially part-time BUS 105 Introduction to Business 3 students and those taking developmental or college prepa- ENG 111 English I 4 ratory education courses, will require additional quarters of study. Students should consult their academic advisors for Winter help in planning their schedules. NTK 178 PC/Network Essentials II 6 – – Business Management or Accounting Technical Systems Support Option Elective 3 The Technical Systems Support curriculum prepares stu- ENG 112 English II or ENG 135 Business Report Writing* 4 dents to support computer and network end-users and setup technical support structures. Students learn how to Spring maintain microcomputer systems, administer network server ITS 200 Project Management 5 resources/services, implement and maintain technical sup- NTK 250 Novell Administration 5 port systems and setup information security structures. This ENG 221 Business Communications 3 curriculum focuses on assisting students in preparing for – – Social Science Elective 3 the following certifications: CompTIA (A+, Server+, Net- work+, i-Net+, Linux+, Security+, Project+), Novell (Certified Fall NetWare Administrator), Microsoft (Microsoft Certified – – ITS or NTK Elective** 5 Professional) and the Information Security Professional (CISSP). NTK 240 Unix/Linux Administration I 5 NTK 270 Administering Microsoft Professional 5 – – Humanities Elective 3 Learning Outcomes Upon completion of an associate degree in Technical Sys- Winter tems Support, a graduate will be able to: ITS – ITS Elective(s) ** 5 • demonstrate knowledge of PC Server terms and concepts. NTK 221 Information Security I 5 • demonstrate the ability to troubleshoot basic desktop and NTK 272 Administering Microsoft Server 5 server hardware and operating system problems. – – Humanities/Social Science Elective 3 • demonstrate the ability to install, configure and manage Internet services. Spring ITS – ITS Elective 5 • demonstrate proficiency in installing, managing and con- NTK 279 Managing a MS Network Environment 5 figuring network operating systems. NTK 288 Advanced Networking Topics or 5 • demonstrate proficiency in implementing basic network EBE 100 Employability Skills and security technologies and tools. EBE 283 Co-Op • demonstrate the ability to appropriately use desktop – – Humanities/Social Science Elective 3 applications. Total credit hours 105

Scholastic Preparation *ENG 135 Business Report Writing will not necessarily transfer as Technical Support students need a high school algebra the equivalent of ENG 112 English II. background equivalent to DEV 101 or CPE 101 (Introduc- **ITS 080, ITS 102, and ITS 103 cannot be used as an elective. tion to Algebra). Students with little or no computer background should enroll in ITS 080 Computer Fundamentals as a preparatory course before taking other computer courses. Students without adequate keyboarding skills should enroll in ITS 102 Keyboarding/Word Processing.

39 Microsoft System Administration Certificate Network Administration This certificate is focused on providing the knowledge and Departmental Certificates skills necessary to plan, install, configure and administer a A number of departmental certificates are offered in Infor- Microsoft network. mation Technology and are designed for individuals working in the field who may wish to upgrade their skills. Students Course Course Credit Number Title Hours who have little or no computer background are cautioned that these certificates may not provide the necessary infor- NTK 176 PC/Network Essentials I 6 mation technology skills for them to achieve their goals. All NTK 178 PC/Network Essentials II 6 course work completed is applicable to the appropriate NTK 270 Administering Microsoft Professional 5 associate degree program. These certificates can be applied NTK 272 Administering Microsoft Server 5 for by filling out the certificate application form in the NTK 274 Administering Microsoft Business Technologies Division in the Brinkman Educa- Network Infrastructure 5 NTK 279 Managing a Microsoft Network tional Center. Environment 5

Network Administration Certificate Total credit hours 32 This certificate is focused on providing the knowledge and skills necessary to install, configure and administer a variety of network operating systems and services. Technical Support Certificate This certificate is focused on providing the knowledge and Course Course Credit skills necessary to support computer and network end-users Number Title Hours and setup technical support structures. Network Administration NTK 152 Internet Technologies 5 NTK 176 PC/Network Essentials I 6 Course Course Credit NTK 178 PC/Network Essentials II 6 Number Title Hours NTK 201 Cisco Associate I 5 NTK 152 Internet Technologies 5 NTK 250 Novell Administration 5 NTK 176 PC/Network Essentials I 6 NTK 270 Administering Microsoft Professional 5 NTK 178 PC/Network Essentials II 6 NTK 272 Administering Microsoft Server 5 NTK 221 Information Security I 5 Total credit hours 37 NTK 240 Unix/Linux Administration I 5 ITS – ITS Elective * 5 ITS – ITS Elective * 5

Network Design Certificate Total credit hours 37 This certificate is focused on providing the knowledge and skills necessary to design, configure, install and manage a * ITS 080, ITS 102, and ITS 103 cannot be used as electives. computer network infrastructure.

Course Course Credit Number Title Hours

ITS 200 Project Management 5 NTK 176 PC/Network Essentials I 6 NTK 178 PC/Network Essentials II 6 NTK 201 Cisco Associate I 5 NTK 202 Cisco Associate II 5 NTK 203 Cisco Associate III 5 NTK 220 Information Security I 5

Total credit hours 37

40 Course Course Credit Legal Assisting Number Title Hours The Legal Assisting Technology program trains persons to assist attorneys in the delivery of legal services. Legal assis- ACC 111 Principles of Accounting I 4 ACC 112 Principles of Accounting II 4 tants are employed by private law firms, financial institutions, COM 111 Interpersonal Communication 3 courts, prosecutors’ offices, legal aid societies, public de- ECO 221 Principles of Macroeconomics 3 fenders’ programs and corporate law offices. ENG 111 English I 4 Clark State cooperates with Sinclair Community College ENG 112 English II 4 to offer approximately one year of courses leading toward an ENG 227 Intermediate Composition 3 associate degree with a major in legal assisting. Students are MTH 106 Business Mathematics or cautioned that it will take more than a year to complete the MTH 121 College Algebra I 3 remainder of the courses at Sinclair. By taking a year of PLS 110 American National Government 3 coursework at Clark State, many students are able to mini- PSY 111 Psychology I or mize commuting time. SOC 110 Sociology 3

Students enrolled in the Clark State program are asked to Legal Assisting One of the following humanities electives: contact the dean of the Business Technologies Division. ART 130 Appreciation of the Arts 3 ENG 130 Introduction to Literature 3 PHL 110 Philosophy 3 PHL 230 Medical Ethics 3 PHL 240 Philosophy of World Religions 3

One of the following career-related electives: ACC 113 Principles of Accounting III 4 ACC 221 Tax Accounting I 4 ECO 222 Principles of Microeconomics 3 PHL 200 Practical Logic 3 PLS 220 Constitutional Law 3 RES 240 Real Estate Appraisal 2 RES 245 Real Estate Finance 2

Total Clark State credit hours 38-41

41 Office Administration Office Administration Office administrators are the key office support personnel All students in Office Administration (OAD) take the same whose skill and technical expertise enable organizations to courses the first year. Beginning the second year, students operate smoothly. They serve as managers who may perform elect to specialize in Office Administration or Medical Office traditional secretarial functions and supervise clerical em- Administration. ployees. By performing their responsibilities well, they may The program schedules that follow are designed for full- have opportunities for promotion to management positions. time students who have completed all prerequisites and who have no developmental or college preparatory educa- Course Course Credit tion recommendations. Many individuals, especially part-time Number Title Hours students and those taking developmental or college preparatory education courses, will require additional quarters of Fall study. Students should consult their academic advisors for OAD 101 Document Formatting 5 OAD 105 Business English 4 help in planning their schedules. ITS 103 Information Technology Basics 3 MTH 106 Business Mathematics 3 Learning Outcomes – – Social Science Elective 3 Upon completion of an associate degree in Office Adminis- tration, a graduate will be able to: Winter • produce business letters, memorandums, reports, forms, OAD 102 Document Production 5 tables and other business documents applying proper OAD 130 Advanced Grammar and Proofreading 4 formatting, grammar, spelling and punctuation. COM 121 Effective Speaking 3 • file using alphabetic, numeric, geographic and subject ENG 111 English I 4

Office Administration ITS 12A Windows Concepts 2 rules. • perform routine office functions, including managing an Spring office, working without supervision and establishing work OAD 103 Integrated Office Applications 4 priorities. OAD 135 Office Procedures 4 • demonstrate word processing functions using word pro- OAD 140 Records Management 3 cessing software. ENG 112 English II 4 • use medical technology terms (Medical Office Adminis- ENG 221 Business Communications 3 tration only). • compose business correspondence, research and write Fall OAD 245 Basic Machine Transcription 4 business reports and deliver oral presentations. ACC 111 Principles of Accounting I 4 • transcribe documents using transcribing machines. COM 111 Interpersonal Communication 3 • type 50-54 nwpm on a 5-minute timed writing. ITS 12D Beginning Database 1 • demonstrate good oral communication skills. ITS 12S Beginning Spreadsheet 1 • demonstrate good customer service skills. ITS 101 Using the Internet/Web Development 4 • exhibit an ability to think quickly on the job. – – Social Science Elective 3

Scholastic Preparation Winter Students must possess the ability to key the alphabet and OAD 246 Advanced Machine Transcription 4 OAD 260 Office Simulation 5 numeric keys “by touch” using appropriate techniques to EBE 100 Employability Skills 2 enroll in OAD 101 Document Formatting. Students coming ENG 135 Business Report Writing 4 into the course should be keyboarding at a minimum of 20 ITS 12P Beginning Presentation Graphics 1 nwpm. Students with little or no computer background ITS 14S Intermediate Spreadsheet 2 should enroll in ITS 080 Computer Fundamentals as a preparatory course before taking other computer courses. Spring Students without adequate keyboarding skills should enroll OAD 200 Administrative Office Management 3 in ITS 102 Keyboarding/Word Processing. OAD 285 Co-op Education 2 ITS 14D Intermediate Database 2 ITS 14P Intermediate Presentation Graphics 2 Humanities/Social Science Electives – – Humanities/Social Science Elective 3 A complete listing of humanities and social science electives begins on page 5. Total credit hours 101

42 Medical Office Administration Course Course Credit Medical administrators work in physicians’ offices, hospi- Number Title Hours tals, nursing homes and other medical settings. They may Fall transcribe dictation, prepare medical records or charts, OAD 101 Document Formatting 5 schedule appointments, handle correspondence, prepare OAD 105 Business English 4 bills and process insurance forms. In addition to excellent ITS 103 Information Technology Basics 3 keyboarding skills, medical office administrators need ex- MTH 106 Business Mathematics 3 pertise with medical terminology and familiarization with – – Social Science Elective 3 medical references. Strong human relations skills are also important as they deal with people in stressful situations. Winter OAD 102 Document Production 5 OAD 130 Advanced Grammar and Proofreading 4 Scholastic Preparation COM 121 Effective Speaking 3

Students must possess the ability to key the alphabet and ENG 111 English I 4 Office Administration numeric keys “by touch” using appropriate techniques to ITS 12A Windows Concepts 2 enroll in OAD 101 Document Formatting. Students coming into the course should be keyboarding at a minimum of 20 Spring wpm. Students with little or no computer background OAD 103 Integrated Office Applications 4 should enroll in ITS 080 Computer Fundamentals as a OAD 135 Office Procedures 4 preparatory course before taking other computer courses. OAD 140 Records Management 3 ENG 112 English II or Students without adequate keyboarding skills should enroll ENG 135 Business Report Writing* 4 in ITS 102 Keyboarding/Word Processing. ENG 221 Business Communications 3

Humanities/Social Science Electives Fall A complete listing of humanities and social science electives OAD 248 Basic Medical Machine Transcription 4 begins on page 5. BIO 102 Medical Terminology 4 BIO 105 Intro to Anatomy and Physiology 4 COM 111 Interpersonal Communication 3 ITS 12S Beginning Spreadsheet 1

Winter OAD 249 Advanced Medical Machine Transcription 4 OAD 256 Medical Office Management 4 OAD 270 CPT - Coding 5 EBE 100 Employability Skills 2 ITS 12P Beginning Presentation Graphics 1

Spring OAD 272 ICD-9-CM Coding 5 OAD 285 Co-op Education 2 ITS 12D Beginning Database 1 – – BUS or ITS Elective* 3 – – Humanities/Social Science Elective 3

Total credit hours 100

*ENG 135 Business Report Writing will not necessarily transfer as the equivalent of ENG 112 English II. **Students are required to take three credit hours of BUS or ITS courses not already prescribed. ITS 080, ITS 12W, ITS 14W and ITS 102 will not count toward graduation requirements.

43 Office Administration Certificate Communications Departmental Certificate A one-year certificate in Office Administration is available Course Course Credit for students who need a quicker entry into the job market. Number Title Hours This will provide the student with the skills needed for entry-level positions in today’s computer oriented and fast- OAD 105 Business English 4 paced business office. Students can fully apply this one-year OAD 130 Advanced Grammar and Proofreading 4 COM 111 Interpersonal Communication 3 certificate toward the completion of either the Office Ad- COM 121 Effective Speaking 3 ministration or the Medical Office Administration associate ENG 111 English I 4 degree programs. ENG 135 Business Report Writing 4 ENG 221 Business Communications 3 Course Course Credit Number Title Hours Total credit hours 25

Fall OAD 101 Document Formatting 5 OAD 105 Business English 4 Machine Transcription Departmental Certificate ITS 103 Information Technology Basics 3 MTH 106 Business Mathematics 3 Course Course Credit – – Social Science Elective 3 Number Title Hours

Winter OAD 101 Document Formatting 5 OAD 102 Document Production 5 OAD 105 Business English 4 OAD 130 Advanced Grammar and Proofreading 4 OAD 130 Advanced Grammar and Proofreading 4 Office Administration COM 121 Effective Speaking 3 OAD 245 Basic Machine Transcription 4 ENG 111 English I 4 OAD 246 Advanced Machine Transcription 4 ITS 12A Windows Concepts 2 Total credit hours 21 Spring OAD 103 Integrated Office Applications 4 OAD 135 Office Procedures 4 Medical Transcription Departmental Certificate OAD 140 Records Management 3 ENG 112 English II 4 Course Course Credit ENG 221 Business Communications 3 Number Title Hours

Total credit hours 54 OAD 101 Document Formatting 5 OAD 248 Basic Medical Machine Transcription* 4 Three departmental certificates are available for students OAD 249 Advanced Medical Machine Trans. 4 who want to upgrade skills in a particular area. These BIO 102 Medical Terminology 4 BIO 105 Intro to Anatomy and Physiology 4 certificates can be applied for by filling out the certificate application form in the Business Technologies Division in Total credit hours 21 the Brinkman Educational Center. Please note: The courses listed above in the departmental certificates may have prerequisites beyond the courses listed that are part of the certificate. Students with appropriate backgrounds may have the prerequisites listed below waived by their program advisor. A student can take OAD 245 or OAD 248 concurrently with OAD 101 if he or she can type at least 35 nwpm and knows Microsoft Word to a level equivalent to ITS 102 or ITS 12W. *Prerequisite(s): OAD 105 and OAD 130

44 Scholastic Preparation Judicial Reporting Prospective students should be disciplined, self-motivated, Judicial reporters record the verbatim proceedings of a computer-literate and possess above-average language skills. courtroom, deposition, hearing, arbitration or meeting and They also need to be able to meet deadlines, work well under provide an accurate transcript of the proceedings. pressure and concentrate for long periods of time. Clark State student learn to write realtime using a Students with little or no computer background should computerized machine and to prepare transcripts using enroll in ITS 080 Computer Fundamentals as a preparatory computer-assisted translation (CAT) software. Students’ course before taking other computer courses. Students writing skills are perfected by utilizing a mock computer- without adequate keyboarding skills should enroll in ITS integrated courtroom (CID). All Realtime Reporting students 102 Keyboarding/Word Processing. are required to purchase a computerized writer and a Entering students must be high school graduates or laptop computer. possess a certificate of general education (GED). The program schedule that follows is designed for full- time students who have completed all prerequisites and Graduation Requirements Judicial Reporting who have no developmental recommendations. Many indi- The Realtime Reporting program is approved by the Na- viduals, especially part-time students and those taking tional Court Reporters Association. This association’s developmental courses, will require additional quarters of requirements are met or exceeded with the following study. Students should consult their academic advisors for standards: help in planning their schedules. • The student shall pass three 5-minute tests with 95% Students will follow the curriculum of the Realtime Re- accuracy at each of the following speeds: 225 wpm porter through the first year before deciding whether they testimony (two-voice), 200 wpm jury charge and 180 will select Judicial Reporting or Broadcast Captioning/CART wpm literary. as their career goal. All Realtime Reporting students may • The student shall complete at least 80 verified hours of also elect to follow both tracks, graduating with a degree in internship under the supervision of a practicing judicial both options. reporter.

Learning Outcomes Clark State Community College reserves the right to change Upon completion of an associate degree in Judicial Report- these standards when determined educationally expedient. ing, a graduate will be able to: • Write and transcribe testimony at 225 wpm with at least Humanities/Social Science Electives 95 percent accuracy. A complete listing of humanities and social science electives • Write and transcribe jury charge at 200 wpm with at least begins on page 5. 95 percent accuracy. • Write and transcribe literary at 180 wpm with at least 95 percent accuracy. • Prepare a complete trial transcript using computer-aided transcription. • Write realtime in a computer-integrated courtroom. • Prepare a 40-page marketable transcript.

45 Course Course Credit Number Title Hours

Fall RTR 100 Realtime Theory 6 RTR 110 Survey of Realtime Reporting 1 ENG 111 English I 4 ITS 103 Information Technology Basics 3 OAD 105 Business English 4

Winter RTR 101 Beginning Speed Building I 4 RTR 120 Law and Legal Terminology 2 RTR 141 Beg Computer Assisted Trans 1 RTR 152 Realtime Transcription 2 ENG 112 English II 4 ENG 221 Business Communications 3 OAD 125 Vocabulary and Reference Use 2

Spring RTR 102 Beginning Speed Building II 3 RTR 111 Beginning Testimony I 3 RTR 142 Adv Computer Assisted Trans. 5 RTR 152 Realtime Transcription 2 Judicial Reporting BIO 102 Medical Terminology 3

Summer RTR 112 Beginning Testimony II 3 RTR 151 Realtime Transcription 1 – – Humanities Elective 3 – – Social Science Elective 3 – – Humanities/Social Science Elective 3

Fall RJR 211 Advanced Testimony I 3 RJR 231 Jury Charge I 3 RTR 153 Realtime Transcription 3 RTR 201 Advanced Speed Building I 3 Humanities/Social Science Elective 3

Winter RJR 212 Advanced Testimony II 3 RJR 232 Jury Charge II 3 RJR 245 Office Management 3 RTR 153 Realtime Transcription 3 RTR 202 Advanced Speed Building II 3

Spring RJR 213 Advanced Testimony III 3 RJR 233 Jury Charge III 3 RTR 153 Realtime Transcription 3 RTR 203 Advanced Speed Building III 3 RTR 280 Realtime Reporting Practice 3

Total Credit Hours 110

46 Scholastic Preparation Broadcast Captioning/CART Prospective students should be dependable, flexible, inno- Options vative, organized, professional, punctual, trustworthy, discipline, Broadcast captioners capture the spoken word on televi- able to work under pressure and possess above-average sion shows instantly, and their work product is visible language skills. nationally as the caption scrolls across the television screen. Students with little or no computer background should The realtime reporter who provides this service may be enroll in ITS 080 Computer Fundamentals as a preparatory working in the television studio itself or from a broadcast course before taking other computer courses. Students studio that is set up in his/her home. This very demanding without adequate keyboarding skills should enroll in ITS profession mandates that the Clark State Realtime Report- 102 Keyboarding/Word Processing. ing student be trained to write realtime in a computerized Entering students must be high school graduates or writer that is cabled to a laptop computer. This allows the possess a certificate of general education (GED). student to practice accurate writing techniques from the Broadcast Captioning beginning of his/her college career, resulting in the speed Graduation Requirements and accuracy required for this specialty. All Realtime • Prepare an acceptable realtime translation of one hour of Reporting students are required to purchase a computer- CART services. ized writer and a laptop computer. • Prepare an acceptable captioned translation of one hour CART (Communication Access Realtime Translation) re- of captioning services. porters provide instantaneous text of the spoken word • Complete 40 hours of actual writing time in the CART displayed on a computer screen or large projection screen. environment. CART is classified as an assistive technology and is consid- • Complete 40 hours of actual writing in the captioning ered a reasonable accommodation under the Americans environment. with Disabilities Act. It is a service provided in the academic • Pass three 5-minute tests with 95% accuracy at 200 wpm setting for students with hearing impairment as well as in literary. public settings such as conventions, churches, corporate meetings, funerals, police interrogations, etc. This specialty Clark State Community College reserves the right to in- also requires realtime writing as describe above as well as crease these standards when determined educationally training in deaf culture so that the student understands and appropriate. is sensitive to the needs of the consumer. Students will follow the curriculum of the Realtime Re- Humanities/Social Science Electives porter through the first year before deciding whether they A complete listing of political science electives can be found will select Broadcast Captioning/CART or Judicial Report- on page 5. ing as their career goals. All Realtime Reporting students may also elect to follow both tracks, graduating with a degree in both options.

Learning Outcomes Upon completion of an associate degree majoring in Realtime Reporting with an option in Broadcast Captioning/CART, a graduate will be able to: • write and transcribe straight matter at a speed of 200 wpm with at least 95 percent accuracy. • write realtime at 180-200 wpm with a translation rate of 96 percent or above. • prepare and write a television broadcast in a professional studio. • prepare and write a classroom session and provide a transcript. • name and manage computer dictionaries. • punctuate the spoken word. • set up and maintain all hardware components.

47 Course Course Credit Number Title Hours

Fall RTR 100 Realtime Theory 6 RTR 110 Survey of Realtime Reporting 1 ENG 111 English I 4 ITS 103 Information Technology Basics 3 OAD 105 Business English 4

Spring RTR 102 Beginning Speed Building II 3 RTR 111 Beginning Testimony I 3 RTR 142 Adv Computer Assisted Trans. 5 RTR 152 Realtime Transcription 2

Broadcast Captioning BIO 102 Medical Terminology 3

Summer RTR 112 Beginning Testimony II 3 RTR 151 Realtime Transcription 1 GLG 110 Earth Science 4 PLS Political Science Elective 3

Fall RCC 111 Introduction to Deaf Community 5 RCC 211 Captioning/CART I 3 RCC 220 Phonology 2 RTR 151 Realtime Transcription 1 RTR 201 Advanced Speed Building I 3 ENG 250 American Literature 3

Winter RCC 212 Captioning/CART II 3 RCC 245 Business Practices 2 RTR 151 Realtime Transcription 1 RTR 202 Advanced Speed Building II 3 CHM 110 Fundamentals of Chemistry 5 SOC 110 Sociology 3

Spring RTR 151 Realtime Transcription 1 RTR 203 Advanced Speed Building III 2 RTR 280 Realtime Reporting Practice 3 GEO 220 World Regional Geography 3 HST 123 American History 1900 - Present 3

Total Credit Hours 110

48 Course Format Early Childhood Education Selected courses are presented in both traditional and on- The Early Childhood Education (ECE) program prepares line formats. All courses with labs will be conducted on individuals for employment in licensed child centers, nurs- campus regardless of the format. Contact your advisor for ery schools, hospitals, group homes, children’s homes and further information. other programs concerned with the well-being, development and education of the infant, toddler, preschool child Overview and the school-aged child enrolled in a child program. Students receive a total of 320 clock hours of supervised Graduates of the Early Childhood Education degree work experiences in approved early childhood education settings with children, helping them develop into the whole, pro- during Practicums I and II. They are given the opportunity to ductive persons they are meant to be. observe and to complete student teaching with young chil- The program schedules that follow are designed for full- dren in the learning environment. Students have the unique time students who have completed all prerequisites and opportunity to spend their practicums in the new state-of- who have no college preparatory/developmental recom- the-art Early Childhood Education Center adjacent to the mendations. Many individuals, especially part-time students Leffel Lane Campus, operated by Clark State and Springfield- Early Childhood and those taking college preparatory education/develop- Clark JVS. Seminars I and II give the students the chance to mental requirements, will require additional quarters of discuss their experiences and share ideas concerning curricu- study. Students should consult their academic advisors for lum planning and behavior management. help in planning their schedules. Certification Learning Outcomes The Early Childhood Education program is approved by the Upon completion of an associate degree in Early Childhood State Board of Education as meeting all criteria for preparing Education, a graduate will be able to: individuals for pre-kindergarten associate certification. Stu- • recognize, identify and explain early childhood theories. dents who choose to obtain Pre-K certification must meet all • demonstrate the ability to implement developmentally guidelines listed in the pre-kindergarten associate certifica- appropriate activities to enhance the development of the tion orientation packet which is available in the ECE Office. whole child. • recognize communicable disease in a childcare setting. Graduation Requirements • encourage human creativity in young children. A grade of C or better in all ECE courses is required for • analyze and appraise developmentally appropriate litera- graduation. ture for use in the pre-school classroom. • demonstrate ability to write lessons plans, resumes and Liability Insurance technical communications. Students will be billed for liability insurance for the year • plan and implement the full day routine and activities of of practicum courses. licensed childcare or pre-school programs. Humanities/Social Science Electives A complete listing of humanities and social science electives begins on page 5.

49 Course Course Credit Number Title Hours

Fall ECE 100 Intro to Early Childhood Education 3 ECE 114 Art, Music and the Child 3 ENG 111 English I 4 PSY 111 Psychology I 3 SOC 110 Sociology 3

Winter ECE 110 Infant/Toddler Education 3 ECE 112 Resources in Early Childhood Education 4 ENG 112 English II 4 PSY 221 Human Growth and Development I 3 – – Technical Elective* 2

Spring ECE 106 Observing Young Children 2 ECE 120 Language Dev and the Child 3 ECE 250 Behavior Management of Children 3 COM 121 Effective Speaking 3 ITS 12W Beginning Word Processing 1

Early Childhood SOC 240 Racial and Cultural Minorities 3

Fall ECE 211 Sensory Motor Skills Development 3 ECE 213 Health, Safety and Nutrition 3 ECE 215 Math/Science Activities 3 ECE 223 Preschool Curriculum 3 ENG 223 Technical Report Writing 3

Winter ECE 217 Special Needs Child 4 ECE 224 School Age Curriculum 3 ECE 271 ECE Practicum I 2 ECE 291 Child Care Seminar I 2 MTH 121 College Algebra I** 3 – – Technical Elective* 3

Spring ECE 225 Professional, Legal, Ethical Issues 2 ECE 230 Organization and Management of Child Care Centers 3 ECE 272 ECE Practicum II 2 ECE 292 Child Care Seminar II 2 – – Technical Elective* 3 – – Humanities/Social Science Elective 3

Total credit hours 94

*Technical electives include: ECE 210, ECE 220, ECE 221, ECE 222 or Special Topics course with program coordinator approval. **Students may substitute MTH 106 Business Mathematics for MTH 121 Algebra I.

50 Course Course Credit Early Childhood Education Number Title Hours

Administration Fall The Early Childhood Education Administration degree will ECE 100 Intro to Early Childhood Education 3 prepare the graduate to be endorsed as a director of a ECE 114 Art, Music and Child 3 preschool/child care center. BUS 112 Principles of Business Management 4 This option will follow the guidelines of the Ohio Depart- ENG 111 English I 4 PSY 111 Psychology I 3 ment of Human Services, Licensing Rules, #5101:2-12-25, for a child care administrator. Winter The Early Childhood Administration graduate will have ECE 110 Infant/Toddler Education 3 knowledge of early childhood development theories, devel- ECE 112 Resources in Early Childhood Education 4 opmentally appropriate practice in early childhood and ENG 112 English II 4 business and management skills. PSY 221 Human Growth and Development I 3 – – Humanities/Social Sciences Elective 3 Students will receive 160 hours of supervised experi- Early Childhood ences under an administrator in an approved early childhood education program during Practicum II. Spring ECE 250 Behavior Management of Children 3 Selected courses are presented in both traditional and on- BUS 106 Human Relations and line formats. All courses with labs will be conducted on Organizational Behavior 4 campus regardless of the format. Contact your advisor for COM 121 Effective Speaking 3 further information. ITS 12W Beginning Word Processing 1 OAD 200 Administrative Office Management 3 SOC 110 Sociology 3

Fall ECE 213 Health, Safety and Nutrition 3 ECE 223 Preschool Curriculum 3 ACC 111 Principles of Accounting I 4 ENG 223 Technical Report Writing 3 – – Technical Elective* 2

Winter ECE 217 Special Needs Child 4 ECE 224 School Age Curriculum 3 ECE 271 ECE Practicum I 2 ECE 275 Leadership in Mentoring 2 ECE 291 Child Care Seminar I 2

Spring ECE 225 Professional, Legal, Ethical Issues 2 ECE 230 Organization and Management of Child Care Centers 3 ECE 283 ECE Practicum - Administration 2 ECE 293 Child Care Seminar - Administration 2 SOC 240 Racial and Cultural Minorities 3 – – Technical Elective* 3

Total credit hours 94

*Technical electives include: ECE 106, ECE 210, ECE 220, ECE 221, ECE 222 or Special Topics course with program coordinator approval.

51 Early Childhood Administration Departmental Early Childhood Education Certificate Departmental Certificates The Early Childhood Administration Certificate enables Two departmental certificates are available for students students to meet the state minimum requirements for a interested in gaining specialized knowledge in literacy or director of a licensed child care center. The certificate can early childhood administration. A certificate application be completed in one academic year. Instructor permission form is available in the Early Childhood Education office is required for this certificate. located in the Applied Science Center, Room 123 B. These certificates can be completed in one year. Course Course Credit Number Title Hours

Early Literacy Development Departmental Certificate ECE 100 Intro to Early Childhood Education 3 The Early Literacy Development Certificate is intended to ECE 110 Infant/Toddler Education 3 expand the core knowledge of in-service teachers. Instruc- ECE 213 Health, Safety and Nutrition 3 tor permission is required for this certificate. ECE 217 Special Needs Child 4 ECE 225 Professional, Legal, Ethical Issues 2 Course Course Credit ECE 230 Organization and Management of Number Title Hours Child Care Centers 3 ENG 111 English I 4 ECE 120 Language and the Developing Child 3 ITS 12W Beginning Word Processing 1 ECE 210 Children’s Literature 3 MTH 106 Business Math 3 ECE 220 Early Literacy Development - Session A 3 PSY 111 Psychology 3 Early Childhood ECE 221 Early Literacy Development - Session B 3 ECE – Technical Elective 2 ECE 222 Early Literacy Development - Session C 3 ECE – Technical Elective 3

Total credit hours 15 Total credit hours 32

Note: Enrollment must be approved in advance. Instructor permission required. Approval application available in Early Childhood Education office. Limit of three transfer credit hours.

Pre-Elementary Teaching Degree A pre-elementary teaching degree geared for paraprofessionals and students seeking preliminary coursework toward a teaching license is currently under development and will be available during the 2003-2004 academic year. More information will be available on the Clark State website.

52 Prior to entering EMS 101, the student must meet the Emergency Medical Services following entrance requirements: Emergency medical services are expanding rapidly with more opportunities developing for emergency medical tech- • Complete a Request to Enter form in the Admissions nicians (EMTs) and paramedics. Office Although working in EMS has traditionally meant work- • Proof of minimum age of 18 ing for a fire department, rescue squad or ambulance, there • Ohio EMT-Basic certification are also positions in education, management, research pub- • Current CPR provider card lishing, communications, support services and health agencies. • Three letters of recommendation The program schedule that follows is designed for full- • A 75% on paramedic admission test time students who have completed all prerequisites and • Physical exam and health requirements who have no college preparatory/developmental recommendations. Many individuals, especially part-time students Humanities/Social Science Electives and those taking college preparatory/educational/develop- A complete listing of humanities and social science electives Emergency Medical mental requirements, will require additional quarters of begins on page 5. study. Students should consult their EMS advisors for help in planning their schedules. Course Course Credit Number Title Hours Learning Outcomes Upon completion of an associate degree in Emergency Summer BIO 102 Medical Terminology 3 Medical Services, a graduate will be able to: BIO 105 Intro to Anatomy and Physiology 4 • demonstrate the necessary knowledge and practical skills to provide out-of-hospital medical care using the current Fall standards of practice. EMS 101 Paramedic Theory/Practice I 7 • communicate effectively with victims, families and other EMS 112 Hospital Practice I 1 healthcare providers to ensure total quality care is given. ENG 111 English I 4 • utilize critical thinking skills and decision-making pro- ITS – Computer Modules 3 cesses in assessing patients. • demonstrate proper use of equipment for pre-hospital Winter EMS 102 Paramedic Theory/Practice II 7 care. EMS 114 Hospital Practice II 2 EMS 120 ALS Field Observation I 1 Overview ENG 112 English II 4 Clark State Community College offers a two-year associate PSY 111 Psychology I 3 degree and several certification programs. The certification courses may be taken separately or in conjunction with the Spring associate degree program. The program introduces the stu- EMS 105 Paramedic Theory/Practice III 6 dent to a variety of emergency care situations and experiences EMS 116 Hospital Practice III 2 both in the hospital setting and on emergency vehicles. Both EMS 122 ALS Field Observation II 1 COM 111 Interpersonal Communication 3 day and evening courses are available. The associate degree – – Humanities/Social Science Elective 3 program is normally held in the evening, but many courses may be taken during the day. Fall EMS 230 EMS Supervision 3 Scholastic Preparation PHL 210 Ethics 3 All entering students must have a high school diploma or its – – Humanities/Social Science Elective 3 equivalent. (In addition, each student must take reading, – – Technical Elective* 3 writing and math placement tests.) If needed, the basic math course must be completed with a C or better. A student may Winter EMS 220 EMS Pharmacology 3 need to take other developmental courses as shown by EMS 240 Hazardous Material/Disaster Management 3 placement testing scores. EMS 280 Advanced Rescue 4 PSY 221 Human Growth and Development I 3 Prerequisites An individual seeking a career in emergency medical ser- Spring vices should realize that to be successful, he/she must be EMS 225 Advanced Patient Assessment 4 emotionally stable, flexible and physically fit enough to EMS 250 EMS Legal Insights 2 perform the minimum entry level job requirements. ENG 223 Technical Report Writing 3 – – Humanities/Social Science Elective 3

Total credit hours 91

*Technical electives include: SWK 105, SWK 220.

53 Course Course Credit Emergency Medical Services Number Title Hours

Departmental Certificates Summer EMT-Intermediate Certification Program BIO 102 Medical Terminology 3 BIO 105 Intro to Anatomy & Physiology 4 This program builds on the existing knowledge and skill of the EMT-Basic certification in eight distinct areas: roles and Fall responsibilities of the advanced level provider, pre-hospital EMS 101 Paramedic Theory/Practice I 7 environment, preparatory skills including advanced patient EMS 112 Hospital Practice I 1 assessment, medical communications, advanced airway management, defibrillation, epinephrine administration and Winter shock management with intravenous fluid therapy. The EMS 102 Paramedic Theory/Practice II 7 four courses listed below provide the foundation for state EMS 114 Hospital Practice II 2 EMS 120 ALS Field Observation I 1 and National Registry Certification at the intermediate level. The student could apply to enter the paramedic program in Spring the winter quarter. EMS 105 Paramedic Theory/Practice III 6 EMS 116 Hospital Practice III 2 Course Course Credit EMS 122 ALS Field Observation II 1 Number Title Hours Total credit hours 34 Summer

Emergency Medical BIO 102 Medical Terminology 3 BIO 105 Intro to Anatomy & Physiology 4 Paramedic Certification Program for Registered Nurses Fall This program is designed to provide education encompass- EMS 101 Paramedic Theory/Practice I 7 ing the six divisions of the USDOT National Standard EMS 112 Hospital Practice I 1 Paramedic Training Curriculum in an enhanced format. The registered nurse who has prior education and experi- Total credit hours 15 ence in emergency and/or critical care will have the opportunity to achieve advanced standing in the Paramedic Certification Program. Paramedic Certification Program The Paramedic Certification Program provides quality edu- Prerequisites cation in the “art and science” of advanced out-of-hospital An individual seeking a career in emergency medical ser- emergency care. This curriculum provides for integration vices should realize that to be successful, he/she must be of knowledge and skills including pre-hospital environ- emotionally stable, flexible and physically fit enough to ment, preparatory skills, trauma and burns, medical emergencies, perform the minimum entry level job requirements. OB/GYN emergencies, behavioral emergencies and crisis Prior to entering EMS 288, the student must meet the intervention. Upon successful completion, the student will following entrance requirements: meet and exceed the objectives of the National Standard Paramedic Training Curriculum, providing eligibility for • Complete a Request to Enter form in the Admissions Office National Registry Certification exam. • Ohio EMT-Basic certification • Current CPR provider card; ACLS Provider; PALS or Prerequisites PHTLS or BTLS An individual seeking a career in emergency medical ser- • Three letters of recommendation vices should realize that to be successful, he/she must be • A 75% on paramedic admission test emotionally stable, flexible and physically fit enough to • Physical exam and health requirements perform the minimum entry level job requirement. • Proof of licensure for RN, nurse practitioner or physician’s assistant Prior to entering EMS 101, the student must meet the following entrance requirements: Liability Insurance Students will be billed for liability insurance. • Complete a Request to Enter form in the Admissions Office • Proof of minimum age of 18 Course Course Credit • Ohio EMT-Basic certification Number Title Hours • Current CPR provider card • Three letters of recommendation EMS 288 Paramedic Theory for RNs 6 • A 75% on paramedic admission test • Physical exam and health requirements • Successful completion of BIO 102, BIO 105 54 Course Format Medical Laboratory Each MLT course is composed of two required components– Medical Laboratory is a career opportunity in the labora- an online lecture component and a lab component, which tory. Two-year associate degree programs with supervised may be taught at the College or another clinical experience in approved laboratories provide the college approved supervised site. opportunity to enter this challenging, ever-changing career. The program schedule that follows is designed for full- Scholastic Preparation time students who have completed all prerequisites and All entering students must have completed at least one year who have no college preparatory/developmental recom- of high school algebra and chemistry or achieved an appro- mendations. Many individuals, especially part-time students priate score on the College’s algebra and chemistry placement and those taking college preparatory educational/develop- tests. If the chemistry requirement has not been fulfilled, an mental requirements, will require additional quarters of introductory course in chemistry is recommended. If the study. Students should consult the MLT program advisor for student does not have high school algebra, DEV 101 or CPE help in planning their schedules. 101 (Introductory Algebra) is highly recommended. Medical Laboratory

Learning Outcomes Certification Upon completion of an associate degree in Medical Labora- Upon completion of the accredited program, graduates are tory, a graduate will be able to: required to take national certifying examinations. This pro- • communicate professionally and accurately by demon- gram is accredited by the Committee on Allied Health strating the ability to follow written and verbal instructions; Education and Accreditation and the National Accrediting the practice of professional conduct in interactions with Agency for Clinical Laboratory Sciences (NAACLS). other health care professionals, administration, patients and public; and the ability to log in specimens, prepare Health Requirements and keep accurate records, prepare and transmit clear Medical Laboratory Technology students must have physi- and complete reports. cal exams by the end of the Spring Quarter of their first year • select and use appropriate, safe and effective tools to in order to meet requirements for the directed practice solve a variety of problems pertaining to collecting, courses. Hepatitis B vaccination is required prior to Di- handling and conducting tests on samples and to perform rected Practice I. corrective and preventative maintenance on instruments. Applicants must be physically and emotionally able to • demonstrate the ability to think critically by assessing fulfill the functions of the medical laboratory technician. proper correlation between the results and predeter- mined values, by performing quality control activities, by Graduation Requirements relating laboratory results to common disease process To qualify for an associate degree, a Medical Laboratory and by drawing and defending reasonable conclusions. student must pass all the required courses, have a cumula- • demonstrate the necessity for life-long learning to update tive average of 2.0 and must have a C as a minimum grade skills and gain new knowledge. in all the technical courses of the program. • demonstrate the ability to use technology and scientific principles to adapt to the technologically changing society. Liability Insurance • demonstrate an awareness of cultural diversity as pertain- Students will be billed for liability insurance for each year ing to both patients and peers. of clinical courses.

Humanities/Social Science Electives A complete listing of humanities and social science electives begins on page 5.

Medical Laboratory curriculum featured on next page.

55 Course Course Credit Number Title Hours

Fall MLT 101 Medical Laboratory Orientation 2 MLT 102 Medical Laboratory Orientation Lab 1 MLT 111 Chemistry for Technicians 3 MLT 112 Applications of Chemistry for Tech 1 MLT 116 Phlebotomy 2 MLT 117 Phlebotomy Laboratory 2 BIO 105 Intro to Anatomy & Physiology 4 ENG 111 English I 4

Winter MLT 123 Medical Microbiology I 3 MLT 124 Medical Microbiology I Lab 2 MLT 125 Hematology I 3 MLT 126 Hematology I Lab 3 ENG 112 English II 4 ITS 103 Information Technology Basics 3

Spring MLT 131 Clinical Chemistry 3 MLT 132 Clinical Chemistry Lab 3

Medical Laboratory MLT 135 Urinalysis and Body Fluids 2 MLT 136 Urinalysis and Body Fluids Lab 2 ENG 221 Business Communications 3 PSY 111 Psychology I 3

Summer MLT 181 Directed Practice I 4 MLT 191 Seminar I 3 COM 111 Interpersonal Communication 3

Fall MLT 211 Immunology 3 MLT 212 Immunology Lab 1 MLT 213 Medical Microbiology II 3 MLT 214 Medical Microbiology II Lab 3 COM 121 Effective Speaking 3 – – Humanities/Social Science Elective 3

Winter MLT 223 Hematology II 3 MLT 224 Hematology II Lab 3 MLT 226 Immunohematology 4 MLT 227 Immunohematology Lab 4

Spring MLT 270 MLT Review & Update 4 MLT 281 Directed Practice II 4 MLT 291 Seminar II 3

Total credit hours 104

56 CPE 091/DEV 091 and/or CPE 101/DEV 101). Students Nursing Transition LPN to RN are excused from taking the math placement test if they This nursing sequence is a four-quarter modification to have taken and received a “C” or better in a college level meet the educational needs of the licensed practical nurse math course within the past three years. who wishes to become a registered nurse. Other course • Recent (within past 10 years) completion of either one requirements remain the same as in the two-year Registered unit of high school chemistry or a college chemistry Nursing program. The Registered Nursing program com- course (CHM 110, Fundamentals of Chemistry or its bines didactic and clinical learning experiences. The program equivalent) with a grade of “C” or better. is accredited by the National League for Nursing Accrediting • A cumulative grade point average of 2.0 or greater in the Commission and approved by the Ohio Board of Nursing. required courses in the curriculum. Graduates are prepared to function in beginning staff-level • Licensure as practical nurse (PN) for at least one year registered nurse positions in hospitals, extended care facili- • Current practice as a PN. (Minimum of one year within ties, clinics, and comparable health care facilities as members the past three years) of a health care team. • Current professional CPR provider certification Nursing Transition • Satisfactory completion of NUR 114 – Dosage Calcula- Learning Outcomes tions proficiency test or course within the two years prior Upon completion of an associate degree in Registered Nurs- to admission into NUR 173, the first clinical nursing ing, a graduate will be able to: course. • communicate effectively with patients, families and other • A “C” or better on the Excelsior “Fundamentals of Nursing” healthcare providers. exam • manage nursing care for individuals and small groups of • Completion of the prerequisite course requirements for clients with common and recurring health problems. NUR 173, the first clinical nursing course. • use the nursing process to provide holistic care for individual and families from diverse cultures through the life Additional information about admission requirements can cycle. be obtained from the RN program coordinator. • integrate knowledge of nursing, biological sciences, social sciences and humanities into the practice of nursing. Licensure • develop and implement health teaching plans for indi- Upon completion of the program, the graduate is eligible to viduals and small groups to assist them in achieving apply to take the NCLEX-RN examination. Licensure is maximum health potential. mandatory for practice as a RN. Candidates for licensure in • practice within the ethical/legal framework of nursing. Ohio must disclose information related to any prior misdemeanor or felony involving alcohol or drug use or any crime Course Format involving gross immorality or moral turpitude and are also Required courses are presented in both a traditional lecture required to submit finger prints for a required criminal format and an online format. All lab sessions are conducted records check. The Ohio Board of Nursing will determine on campus and/or at a health care facility, regardless of the whether the candidate may take the licensing exam. format. Contact your nursing advisor for further information on online courses. Health Requirements Transition students must meet health requirements before Scholastic Preparation they take the first clinical nursing course. Specific informa- The number of students that can be admitted to the program tion will be provided prior to beginning the nursing transition each year is restricted due to the limited availability of clinical course. sites. All applicants are considered for admission by the date in which they have completed the pre-requisite courses/ Graduation Requirements requirements. The admission requirements include: To qualify for an associate degree, Transition students must • A minimum COMPASS reading score of 75. If the student pass all the required courses, have a cumulative average of does not obtain a 75, he/she is required to take and pass 2.0 and have a C as a minimum grade in each anatomy and with a grade of “C” or better the appropriate college physiology course and in all of the courses taken in the preparatory course(s) (CPE 061/DEV 061 and/or CPE clinical nursing courses. 062/DEV 062). Students are excused from taking the reading placement test if they have taken the ACT or SAT Liability Insurance exam within the last five years and received English Students will be billed for liability insurance for the clinical scores of greater than or equal to 20 on the ACT and 500 courses. on the SAT or have obtained a C or better in a college-level English course. Humanities/Social Science Electives • A minimum COMPASS score of 47 on Basic Math and 29 A complete listing of humanities and social science electives on the Algebra test. If the student does not obtain the begins on page 5. required scores, he/she must take and pass with a grade of “C” or better the appropriate college preparatory course(s)

57 Course Course Credit Number Title Hours

Fall NUR 114 Dosage Calculations 1 BIO 121 Anatomy and Physiology I 4 ENG 111 English I 4 PSY 111 Psychology I 3

Winter BIO 122 Anatomy and Physiology II 4 ENG 112 English II 4 ITS 103 Information Technology Basics 3 PSY 221 Human Growth and Development I 3

Spring BIO 123 Anatomy and Physiology III 4 BIO 131 Microbiology I 4 PSY 230 Abnormal Psychology 3

Spring or Summer NUR 173 Nursing Transition 8

Fall Nursing Transition NUR 274 Nursing IV 5 NUR 275 Nursing V 5 ENG 223 Technical Report Writing 3 – – Humanities/Social Science Elective 3

Winter NUR 276 Nursing VI 11 SOC 110 Sociology 3 – – Humanities/Social Science Elective 3

Spring NUR 267 Nursing VII 4 NUR 268 Nursing VIII 3 NUR 269 Nursing IX 6 NUR 280 Nursing Seminar 2

Total credit hours 93

58 Learning Outcomes Physical Therapist Assistant Upon completion of an associate degree in Physical Thera- The Physical Therapist Assistant program is a seven-quarter pist Assistant, graduates will be able to: curriculum which combines didactic and clinical learning • demonstrate skill in implementing treatment practices to experiences that are within the legal scope of responsibility complete a comprehensive treatment plan. of physical therapist assistants. • demonstrate skill in utilizing testing and measurement The physical therapist assistant delivers services under techniques appropriate to the plan of care established by the supervision of a physical therapist who completes an the physical therapist. initial examination of the patient and determines the appro- • implement effective communication when working with priate treatment plan and goals for the patient. The physical patients, families, colleagues, other health car providers. therapist assistant shares the responsibility for administer- • work in an ethical, legal, safe and effective manner under ing treatments, instructing patients in exercises and activities the supervision of a physical therapist. of daily living and documenting the patient’s response to • apply appropriate role utilization in the physical therapy Physical Therapist Assistant therapy. Graduates will be prepared to function in their role delivery system. to provide treatment in a variety of settings such as inpa- • practice lifelong learning that reflects social responsibil- tient, outpatient and home care services. ity and career development. Upon successful completion of all aspects of the PTA program, graduates are eligible to take the state licensing Graduation Requirements examination. Licensure is mandatory for practice as a physi- A 2.0 cumulative average on a 4.0 scale is the standard used cal therapist assistant. for the major courses in the PTA curriculum. The program schedule that follows is designed for full- time students who have completed all prerequisites and Health Requirements who have no college preparatory/developmental recom- A physical exam, a two-step Mantoux test, hepatitis B mendations. Many individuals, especially part-time students immunization or waiver, a health history including record and those taking college preparatory educational/develop- of childhood immunizations or adult titers, fingerprinting, mental courses, will require additional quarters of study. professional CPR and First Aid training are required, prior Students should consult their academic advisors for help in to beginning the second year. Additional medical tests and planning their schedules. other requirements may be necessary depending upon clini- The Physical Therapist Assistant program has a limited cal site placement. enrollment and there is a special admissions process for entering the Physical Therapist Assistant course sequence. Liability Insurance Contact the Admissions Office to request a petitioning Students will be billed for liability insurance for the aca- packet. The policies for this program and for admission to demic year of directed practice courses. this program take precedence over any general policy outlined in the College catalog. Certification Fees Students will be billed for certification fees during the second year of the program to cover a portion of the licensure examination.

Accreditation The Clark State PTA program is accredited by the Commis- sion on Accreditation in Physical Therapy Education of the American Physical Therapy Association.

Humanities/Social Science Electives A complete listing of humanities and social science electives begins on page 5.

59 Course Course Credit Number Title Hours

Fall PTA 110 PTA Survey 3 PTA 120 Introduction to Patient Management 2 BIO 102 Medical Terminology 3 BIO 118 Muscle Anatomy 2 BIO 121 Anatomy and Physiology I 4 ENG 111 English I 4 ITS 103 Information Technology Basics 3

Winter PTA 145 PTA Procedures I 4 BIO 122 Anatomy and Physiology II 4 BIO 230 Biomechanics 4 ENG 112 English II 4 PSY 111 Psychology I 3

Spring PTA 146 PTA Procedures II 5 PTA 160 PTA Rehabilitation I 6 BIO 123 Anatomy and Physiology III 4 PSY 221 Human Growth and Development I 3

Physical Therapist Assistant Summer PTA 241 PTA Procedures III 5 PSY 222 Human Growth and Development II 3 – – Humanities/Social Science Elective 3

Fall PTA 260 PTA Rehabilitation II 6 PTA 281 Directed Practice I 3 PTA 291 Seminar I 2 COM 111 Interpersonal Communication 3

Winter PTA 265 PTA Rehabilitation III 6 PTA 270 PTA Trends and Issues 2 PTA 282 Directed Practice II 3 PTA 292 Seminar II 2 ENG 223 Technical Report Writing 3 – – Humanities/Social Science Elective 3

Spring PTA 283 Directed Practice III 6 PTA 293 Seminar III 2

Total credit hours 110

60 Licensure Upon completion of the program, the graduate may apply Practical Nursing Certificate to take the NCLEX-PN Examination. Candidates for licen- The 12-month Practical Nursing Certificate is approved by sure in Ohio must disclose information related to any prior the Ohio Board of Nursing and the Ohio Board of Regents. misdemeanor or felony involving alcohol or drug use or any The program schedule that follows is designed for full- crime involving gross immorality or moral turpitude. The time students who have completed all prerequisites and Ohio Board of Nursing will determine whether the candi- who have no college preparatory education recommenda- date may take the licensing exam. tions. Many individuals may require additional quarters of study. Students should consult their academic advisors for Health Requirements help in planning their schedules. Practical Nursing students must meet health requirements before they take LPN 160 Fundamentals of Nursing I. Learning Outcomes Upon completion of this program of practical nurse educa-

Graduation Requirements Practical Nursing tion, the graduate will be able to: To qualify for a certificate in Practical Nursing, students • contribute to the data collection of the health care client must have a cumulative average of 2.0 and must have a C as from newborn through aged within prescribed settings. a minimum grade in BIO 105 and all LPN courses. • participate in the planning, implementation and evaluation of nursing care using the nursing process. Liability Insurance • provide safe nursing care in prescribed situations using Students will be billed for liability insurance for the clinical nursing skills and principles from the biological and courses. behavioral sciences. • report and document significant findings of the client’s Course Course Credit condition to the appropriate individual. Number Title Hours • identify learning needs of assigned clients and assist in teaching the health care client. Summer NUR 114 Dosage Calculations 1 • function as an active member of the nursing care team BIO 102 Medical Terminology 3 and assume responsibility for continuing growth in nurs- BIO 105 Intro to Anatomy and Physiology 4 ing knowledge and skills. ENG 111 English I 4 • demonstrate a code of behavior based on ethical prin- ITS 12W Beginning Word Processing 1 ciples and an understanding of the legal scope of practice PSY 111 Psychology I 3 of the practical nurse. PSY 221 Human Growth and Development I 3

Scholastic Preparation Fall Entering students must demonstrate math, reading and LPN 108 Nutrition and Diet Therapy 2 LPN 125 Introduction to Disease Processes 4 writing competency through the COMPASS placement tests. LPN 130 Nursing Trends I 2 Any student who dos not have an appropriate score on the LPN 160 Fundamentals of Nursing I 6 respective test must complete the College Preparatory Edu- cation (CPE)/Developmental Education (DEV) course with Winter a “C” or better. In addition, students must complete all non- LPN 145 Pharmacology 3 nursing courses and MST 181 or its equivalent prior to the LPN 164 Fundamentals of Nursing II 6 fall quarter that the student is admitted into the PN pro- LPN 181 Obstetrical Nursing Theory 2 gram. The student is also required to present a current LPN 185 Pediatric Nursing 5 professional CPR card prior to taking LPN 160 or any Spring subsequent clinical course. LPN 133 Nursing Trends II 2 LPN 191 Medical-Surgical Nursing 10 Course Format LPN 195 Medical-Surgical Nursing II 4 Required courses are presented in both a traditional lecture format and an online format. All lab sessions are conducted Total credit hours 65 on campus and/or at a health care facility, regardless of the format. Contact your nursing advisor for further information on online courses.

61 Scholastic Preparation Registered Nursing The number of students that can be admitted to the program The Registered Nursing program is a seven-quarter associate each year is restricted due to the limited availability of degree program, which combines didactic and clinical learning clinical sites. All applicants are considered for admission by experiences. The program is accredited by the National the date in which they file a petition in the Admissions League for Nursing Accrediting Commission and approved Office to be placed on the waiting list. by the Ohio Board of Nursing. Graduates are prepared to To be eligible to petition to the Registered Nursing function in beginning staff-level registered nurse position in program, the student must have: hospitals, extended care facilities, clinics, and comparable • A minimum COMPASS reading score of 75. If the student health care facilities as members of a health care team. does not obtain a 75, he/she is required to take and pass The program schedule that follows is designed for full- with a grade of “C” or better the appropriate college time students who have completed all prerequisites and preparatory/developmental course (CPE 061/DEV 061 who have no college preparatory educational/developmen- and/or CPE 062/DEV 062). Students are excused from tal educational recommendations. Many individuals, especially taking the reading placement test if they have taken the part-time students and those taking college preparatory ACT or SAT exam within the last five years and received education/developmental education courses, will require English scores of greater than or equal to 20 on the ACT additional quarters of study. Students should consult their and 500 on the SAT or have obtained a “C” or better in academic advisors for help in planning their schedules. a college-level English course. • A minimum COMPASS score of 47 on Basic Math and 29 Learning Outcomes on the Algebra test. If the student does not obtain the Upon completion of an associate degree in Registered Nurs- required scores, he/she must take and pass with a grade

Registered Nursing ing, a graduate will be able to: of “C” or better the appropriate college preparatory/ • communicate effectively with patients, families and other developmental education course(s) (CPE 091/DEV 091 healthcare providers. and/or CPE 101/DEV 101). Students are excused from • manage nursing care for individuals and small groups of taking the math placement test if they have taken and clients with common and recurring health problems. received a “C” or better in a college-level math course • use the nursing process to provide holistic care for indi- within the past three years). vidual and families from diverse cultures through the life • A recent (within past 5 years) grade of “C” or better in cycle. either high school chemistry or a college chemistry course • integrate knowledge of nursing, biological sciences, so- (CHM 110, Fundamentals of Chemistry or its equivalent) cial sciences and humanities into the practice of nursing. • A GPA of greater than or equal to 2.0 in the courses • develop and implement health teaching plans for indi- pertaining to the identified nursing major. viduals and small groups to assist them in achieving maximum health potential. In order to be accepted into the clinical nursing courses, the • practice within the ethical/legal framework of nursing. student must maintain a 2.0 cumulative grade point average in the required courses in the curriculum while on the Course Format waiting list. College preparatory/developmental education Required courses are presented in both a traditional lecture courses and other courses, which are not listed as part of the format and an online format. All lab sessions will be con- curriculum are not included in calculating the GPA. If the ducted on campus and/or at a healthcare facility, regardless student does not maintain a 2.0 GPA, his or her name will of the format. Contact your nursing advisor for further be removed from the waiting list. While students are information on online courses. waiting to be accepted into the clinical nursing courses, they may take any of the non-nursing courses in the curriculum. Entry into clinical nursing courses occurs once a year in the fall. Initial acceptance letters for fall entry are mailed out in February and the acceptance process continues until all the openings are filled. Prior to entering the first clinical nursing course (NUR 170), students must have current professional CPR provider status. Students must also have current state-tested nurse aide credentials and/or satisfactorily completed MST 181 or its equivalent within the past two years. Please contact your nursing advisor for further information about these requirements.

62 Licensure Course Course Credit Upon completion of the program, the graduate is eligible to Number Title Hours apply to take the NCLEX-RN examination. Licensure is Summer mandatory for practice as a RN. Candidates for licensure in BIO 102 Medical Terminology 3 Ohio must disclose information related to any prior misde- ENG 111 English I 4 meanor or felony involving alcohol or drug use or any crime ITS 103 Information Technology Basics 3 involving gross immorality or moral turpitude and are also required to submit fingerprints for a required criminal records Summer or Fall check. The Ohio Board of Nursing will determine whether NUR 114 Dosage Calculations 1 the candidate may take the licensing exam. Fall NUR 170 Nursing I 6 Health Requirements BIO 121 Anatomy and Physiology I 4 Registered Nursing students must meet health requirements ENG 112 English II 4 before they take the first clinical nursing course. Second- PSY 111 Psychology I 3 Registered Nursing year students must update health requirements prior to taking clinical courses. Specific information will be pre- Winter sented at orientation after acceptance into the Registered NUR 171 Nursing II 6 Nursing program. BIO 122 Anatomy and Physiology II 4 PSY 221 Human Growth and Development I 3 SOC 110 Sociology 3 Graduation Requirements To qualify for an associate degree, Registered Nursing stu- Spring dents must pass all the required courses, have a cumulative NUR 172 Nursing III 8 average of 2.0 and have a C as a minimum grade in each BIO 123 Anatomy and Physiology III 4 anatomy and physiology course and in all of the clinical BIO 131 Microbiology I 4 nursing courses. PSY 230 Abnormal Psychology 3

Liability Insurance Fall Students will be billed for liability insurance for each year NUR 274 Nursing IV 5 of clinical courses. NUR 275 Nursing V 5 ENG 223 Tech Report Writing 3 – – Humanities Elective 3 Humanities/Social Science Electives A complete listing of humanities and social science electives Winter begins on page 5. NUR 276 Nursing VI 11 – – Humanities/Social Science Elective 3

Spring NUR 267 Nursing VII 4 NUR 268 Nursing VIII 3 NUR 269 Nursing IX 6 NUR 280 Nursing Seminar 2

Total credit hours 108

63 Scholastic Preparation Registered Nursing - Evening The number of students that can be admitted to the program A six-quarter sequence of nursing courses is offered as an each year is restricted due to the limited availability of evening program. Because the nursing course schedule does clinical sites. All applicants are considered for admission by not allow options for other evening classes at the same time, the date in which they file a petition in the Admissions all other required courses should be completed before a Office to be placed on the waiting list. student enrolls in the first evening nursing course. To be eligible to petition to the Registered Nursing The Registered Nursing program combines didactic and program, the student must have: clinical learning experiences. The program is accredited by • A minimum COMPASS reading score of 75. If the student the National League for Nursing Accrediting Commission does not obtain a 75, he/she is required to take and pass and approved by the Ohio Board of Nursing. Graduates are with a grade of “C” or better the appropriate college prepared to function in beginning staff-level registered preparatory/developmental education course (CPE 061/ nurse positions in hospitals, extended care facilities, clinics, DEV 061 and/or CPE 062/DEV 062). Students are ex- and comparable health care facilities as members of a health cused from taking the reading placement test if they have care team. taken the ACT or SAT exam within the last five years and The program schedule that follows is designed for part- received English scores of greater than or equal to 20 on time students who have completed all prerequisites and the ACT and 500 on the SAT or have obtained a “C” or who have no college preparatory education recommenda- better in a college-level English course. tions. Individuals taking college preparatory education courses • A minimum COMPASS score of 47 on Basic Math and 29 will require additional quarters of study. Students should on the Algebra test. If the student does not obtain the consult their academic advisors for help in planning their required scores, he/she must take and pass with a grade schedules.

Regiestered Nursing of “C” or better the appropriate college preparatory/ developmental educational course(s) (CPE 091/DEV 091 Learning Outcomes and/or CPE 101/DEV 101). Students are excused from Upon completion of an associate degree in Registered Nurs- taking the math placement test if they have taken and ing, a graduate will be able to: received a “C” or better in a college-level math course • communicate effectively with patients, families and other within the past three years). healthcare providers. • A recent (within past 5 years) grade of “C” or better in • manage nursing care for individuals and small groups of either high school chemistry or a college chemistry course clients with common and recurring health problems. (CHM 110, Fundamentals of Chemistry or its equivalent) • use the nursing process to provide holistic care for indi- • A GPA of greater than or equal to 2.0 in the courses vidual and families from diverse cultures through the life pertaining to the identified nursing major. cycle. • integrate knowledge of nursing, biological sciences, so- In order to be accepted into the clinical nursing courses, the cial sciences and humanities into the practice of nursing. student must maintain a 2.0 cumulative grade point average • develop and implement health teaching plans for indi- in the required courses in the curriculum while on the viduals and small groups to assist them in achieving waiting list. College preparatory courses and other courses, maximum health potential. which are not listed as part of the curriculum are not • practice within the ethical/legal framework of nursing. included in calculating the GPA. If the student does not maintain a 2.0 GPA, his or her name will be removed from Course Format the waiting list. While students are waiting to be accepted Required courses are presented in both a traditional lecture into the clinical nursing courses, they may take any of the format and an online format. All lab sessions will be con- non-nursing courses in the curriculum. Entry into clinical ducted on campus and/or at a healthcare facility, regardless nursing courses occurs once a year in the fall. Initial of the format. Contact your nursing advisor for further acceptance letters for fall entry are mailed out in February information on online courses. and the acceptance process continues until all the openings are filled. Prior to entering the first clinical nursing course (NUR 170), students must have current professional CPR provider status. Students must also have current state-tested nurse aide credentials and/or satisfactorily completed MST 181 or its equivalent within the past two years. Please contact your nursing advisor for further information about these requirements.

64 Licensure Course Course Credit Upon completion of the program, the graduate is eligible to Number Title Hours apply to take the NCLEX-RN examination. Licensure is Fall mandatory for practice as a RN. Candidates for licensure in ENG 111 English I 4 Ohio must disclose information related to any prior misde- ITS 103 Information Technology Basics 3 meanor felony involving alcohol or drug use or any crime PSY 111 Psychology I 3 involving gross immorality or moral turpitude and are also required to submit fingerprints for a required criminal Winter records check. The Ohio Board of Nursing will determine ENG 112 English II 4 whether the candidate may take the licensing exam. PSY 221 Human Growth and Development I 3

Spring Health Requirements ENG 223 Technical Report Writing 3 Registered Nursing students must meet health requirements PSY 230 Abnormal Psychology 3 before they take the first clinical nursing course. Second- Registered Nursing year students must update health requirements prior to Summer taking clinical courses. Specific information will be pre- BIO 102 Medical Terminology 3 sented at orientation after acceptance into the Registered BIO 131 Microbiology 4 Nursing program. Fall BIO 121 Anatomy and Physiology I 4 Graduation Requirements SOC 110 Sociology 3 To qualify for an associate degree, Registered Nursing students must pass all the required courses, have a cumulative Winter average of 2.0 and have a C as a minimum grade in each BIO 122 Anatomy and Physiology II 4 anatomy and physiology course and in all clinical nursing – – Humanities Elective 3 courses. Spring Liability Insurance BIO 123 Anatomy and Physiology III 4 Students will be billed for liability insurance for each year – – Humanities/Social Science Elective 3 of clinical courses. Fall NUR 114 Dosage Calculations 1 Humanities/Social Science Electives NUR 170 Nursing I 6 A complete listing of humanities and social science electives begins on page 5. Winter NUR 171 Nursing II 6

Spring NUR 172 Nursing III 8

Summer NUR 274 Nursing IV 5 NUR 275 Nursing V 5

Fall NUR 276 Nursing VI 11

Winter NUR 267 Nursing VII 4 NUR 268 Nursing VIII 3 NUR 269 Nursing IX 6 NUR 280 Nursing Seminar 2

Total credit hours 108

65 mentation skills, basic listening skills, and an awareness of Social Services personal biases as they affect clients. Social work education is at the core of the Social Services program. Social work is devoted to helping people function Liability Insurance as well as they can within their environments. Areas of Students will be billed for liability insurance for the year of employment include alcohol and drug treatment, children’s practicum courses. services, juvenile services, mental health, mental retardation and developmental disabilities and public assistance. Humanities/Social Science Electives The field placement portion of the curriculum provides over A complete listing of humanities and social science electives 480 hours of supervised learning experiences in local social begins on page 5. services agencies. The program schedules that follow are designed for full- Course Course Credit time students who have completed all prerequisites and Number Title Hours who have no college preparatory/developmental recom- Fall mendations. Many individuals, especially part-time students SWK 100 Intro to Social Welfare and Social Work* 4 and those taking college preparatory educational/develop- SWK 105 Chemical Dependency I 4 mental requirements, will require additional quarters of ENG 111 English I* 4 study. Students should consult their academic advisors for ITS 103 Information Technology Basics* 3 help in planning their schedules. PSY 111 Psychology I 3

Learning Outcomes Winter Social Services SWK 121 Social Work Methods and Procedures 5 Upon completion of an associate degree in Social Services, ENG 112 English II 4 a graduate will be able to: PSY 221 Human Growth and Development I 3 • adhere to a professional code of ethics in working with SOC 110 Sociology 3 clients. – – Humanities/Social Sciences Elective 3 • demonstrate effective oral and written communication skills. Spring SWK 136 Affective Education 4 • complete professional documentation reports, including BIO 110 Fundamentals of Human Biology 4 progress notes, psycho/social histories and mental status ENG 223 Technical Report Writing 3 evaluations, as well as other professional documentation. PSY 222 Human Growth and Development II 3 • demonstrate an awareness of personal biases, values, SOC 240 Racial and Cultural Minorities 3 attitudes, and their effect on clients. • demonstrate basic listening skills in combination with a Fall helping interview. SWK 231 General Practice/Crisis Intervention 3 • know the roles of the social services practitioner/chemi- SWK 271 Social Service Practicum I** 2 SWK 291 Social Service Seminar I** 2 cal dependency counselor and will apply them in practice. PSY 230 Abnormal Psychology 3 – – Technical Elective** 3 Registration Graduates of this program who have achieved a grade of C Winter or better in all Social Services courses are eligible to be SWK 232 Generalist Practice with Families 3 registered as Social Work Assistants by the Ohio Counselor SWK 236 Case Management 5 and Social Worker Board. SWK 272 Social Services Practicum II 2 SWK 292 Social Services Seminar II 2 – – Humanities/Social Science Elective 3 Prerequisites Persons seeking a career in social services should recognize Spring that to be successful, they must be emotionally stable, SWK 130 Social Policy and Service 4 creative and flexible. A social services professional must be SWK 238 Social Work and Group Work 3 able to work effectively with diverse groups of people and SWK 273 Social Services Practicum III 2 individuals with a wide variety of ages, racial and cultural SWK 293 Social Services Seminar III 2 backgrounds and life situations. ENG 111, ITS 103, and – – Technical Elective*** 3 – – Technical Elective*** 3 SWK 100 must be completed with a grade of “C” or better before enrolling in additional courses. Total credit hours 95

Health Requirements * ENG 111, ITS 103, and SWK 100 MUST be completed with a Students must meet health requirements before taking the “C” or better before enrolling in additional social service courses first practicum course. (SWK) **SWK 271 Social Service Practicum I and SWK 291 Social Service Graduation Requirements Seminar I must be taken together. Students must attend Practicum Graduates must demonstrate professional ethical behavior, orientation to be admitted into SWK 271. ***Technical electives include: SWK 205, SWK 215, SWK 220, effective oral and written communication, professional docu- and SWK 297. 66 Social Services Departmental Certificates A departmental certificate is available for students to meet requirements for the Ohio Credentialing Board and Ohio Department of Mental Retardation and Developmental Dis- abilities. This certificate can be applied for by filling out the certificate application form in the administrative office in the Applied Science Center.

Chemical Dependency Departmental Certificate This certificate is focused on providing 110 clock hours toward the required 5000 hours that must be earned to become a certified chemical dependency counselor. (SWK Social Services 205 and SWK 215 are also technical electives for the Social Work degree.)

Course Course Credit Number Title Hours

SWK 105 Chemical Dependency I 4 SWK 205 Chemical Dependency II 4 SWK 215 Special Populations in Chemical Dependency 3

Total credit hours 11

67 68 Course Descriptions o reDescriptions Course Clark lr tt omnt College Community State Clark Take acloserlook!Find outmore aboutcourses in your ofwhat program andgetanoverview you can expect toyou learnatClark State canexpect State E SMART. GET . Course Descriptions 69 (AGR) Agriculture AGR 104 Agricultural Survey and Employment Skills (3) Survey of Agriculture Business and Horticulture Industries; career opportunities, goals, employability skills, including microcomputer as primary tool for maintaining accounting for maintaining as primary tool microcomputer of windows- generation. Use financial statement records and both service Includes study of software. based accounting businesses. and merchandising instructor permission ACC 111 or Prerequisite(s): Accounting I (4) ACC 211 Intermediate principles and procedures, including Review of accounting and users of financial information, financial reporting, of standards. Advanced study development of accounting to include the income statement, retained financial statements balance sheet, and statement of cash earnings statement, flows. 112 Prerequisite(s): ACC Accounting II (4) ACC 212 Intermediate sold and inventories Cash and receivables. Cost of goods estimation and non- including cost allocation, valuation, operating assets cost valuation procedures. Non-current retirement. including acquisition, utilization, and Prerequisite(s): ACC 113, ACC 211 ACC 213 Intermediate Accounting III (4) liabilities. Owner’s Current, contingent, and long-term and retained earnings. equity, including contributed capital Financial reporting and analysis. Prerequisite(s): ACC 212 ACC 221 Tax Accounting I (4) application under the Theory of individual taxes and their and preparation of Internal Revenue Code. Introduction individual tax returns. Prerequisite(s): DEV 061 or CPE 061 ACC 222 Tax Accounting II (4) its application in the Introduction to business tax law and and local corporate preparation of domestic federal, state tax forms. A working knowledge in the preparation of personal property, sales, franchise tax returns. Prerequisite(s): ACC 221 Corequisite(s): ACC 112 ACC 233 Cost Accounting (4) Cost accounting principles including job order cost, process cost and standard cost accounting. Variance analysis and budgeting also covered. Prerequisite(s): ACC 113, ITS 12S ACC 250 Government and Nonprofit Accounting (4) Fundamental accounting procedures for nonprofit and governmental institutions. To include state and local governmental accounting, accounting for health care organizations, and accounting for colleges and universities. Prerequisite(s): ACC 113, ACC 211

Sometimes the prior knowledge required for a course can Sometimes the prior knowledge required be aware of course It is the student’s responsibility to Courses numbered under 100 or identified with the prefix Courses numbered ACC 111 Principles of Accounting I (4) and procedures; Fundamental accounting concepts, terms, analyzing, classifying and recording accounting data; subsidiary ledgers; special journals, adjusting and closing accounts; accounting cycle completion; financial statements; payroll and payroll taxes; control over cash; bank reconciliation. Prerequisite(s): DEV 061 or CPE 061 ACC 112 Principles of Accounting II (4) Accounting for a merchandising business, receivables, inventories, plant and intangible assets. Corporations: organization and equity rights, retained earnings, and dividends. Additional emphasis on financial statements. Prerequisite(s): ACC 111 ACC 113 Principles of Accounting III (4) Corporations—long term liabilities. Financial statement analysis, statement of cash flows, managerial accounting principles and systems, manufacturing operations and job order cost accounting, differential analysis. Prerequisite(s): ACC 111, ACC 112 ACC 120 Microcomputer Accounting Systems (4) Integrated accounting systems applications with use of (ACC) Accounting Prerequisite(s)/Corequisite(s) or a certain degree of prior knowledge Some courses require example, a college competence called a prerequisite. For course in reading or preparatory education (CPE or DEV) prerequisite to most mathematics may be considered a on the student’s courses or mathematics courses, depending courses are placement test scores. In other cases prerequisite course of a sequence. necessary to enter the second or third itself. In this case, be obtained at the same time as the course courses must be taken it is called a corequisite. Corequisite selected course. during the same term or prior to the are listed in the course prerequisites and corequisites which prior to the listed descriptions and also any courses required with the divisional prerequisite(s). Faculty, in conjunction withdraw students dean or Dean of Student Affairs, may they do not have the who are enrolled in courses for which prerequisite(s) or corequisite(s). Course Numbering System Course Numbering course while area of the identify the subject Alpha prefixes series are Courses in the 100 identifies the level. the number in the courses while courses first-year usually considered However, second-year courses. are usually considered 200 series their recommended curriculum guides students should follow advisors when making final decisions and the advice of their and sequence of courses. regarding the level and may not be accepted by other colleges DEV CPE or credit. College Preparatory Education universities for transfer do not meet graduation requirements (Developmental) courses at Clark State.

T e 70 Course Descriptions landscape plantsutilizinga varietyoflearningresources. golf courses.Usage,design, installation,careandcultureof plant materialscommonlyused inlandscapes,grounds,and Recognition oftrees,shrubs, groundcoversandrelated AGR 143LandscapePlantMaterials (4) Lab Fee:$10 Prerequisite(s): DEV061orCPE specialized usesincludingmowing,fertilization,irrigation. Routine culturalpracticesnecessaryforgrowingturf for AGR 133TurfScience(3) Lab Fee:$15 Prerequisite(s): BIO140 cycles, typesofdamageandnaturalcontrol. Identifying insects,diseases,andweeds.Astudyofpest life AGR 122PlantPests(4) Lab Fee:$25 Prerequisite(s): DEV061orCPE metal arcandoxyacetylenewelding. Introduction tobasicprinciplesandpracticesofshield AGR 115Welding(3) Prerequisite(s): ENG111 health andfacilityrequirements. and function.Instructioninfeedsnutrition,animal of basictypeslivestockrelatedtoproduction,purpose importance ofthelivestockandpoultryindustries.Identification Introduction toanimalsciencefocusingontheeconomic AGR 109AnimalAgriculture(4) Prerequisite(s): DEV101orCPE techniques. percents, measurements,graphingandproblemsolving fundamentals withemphasisonapplicationsinvolvingequations, in agricultureincludingalgebra,geometryandtrigonometry Development andapplicationofpracticalmathematicprinciples AGR 108TechnicalMathforAgriculture(3) Prerequisite(s): AGR105 communication principles;andtechniquesinadaptiveselling. confronting salespeople;conceptsofbuyerbehavior; salespeople andtheircustomers;ethicallegalresponsibilities of selling;establishingpartneringrelationshipsbetween An in-depthstudyofpersonalselling,includingtheimportance AGR 106PrinciplesofAgSalesII(3) Prerequisite(s): DEV061orCPE and professionalism. of salespeopleasaprofession,traitsforsuccess,salesskills, it means,anditsrelationshiptomarketing.Responsibilities A basiccourseinsalesfunctions.Theroleofselling,what AGR 105PrinciplesofAgSalesI(3) Prerequisite(s): DEV061orCPE responsibilities; industryexpectations. development, collegeanddegreerequirements,student resumes, coverletters,interviewpreparation,professional Prerequisite(s): AGR104 required. op instructor.Oraland/orwritten reportsoftheexperience weeks selectedbythestudentwithassistancefromAg Co- location. Worksiteforfull-time(40hours)work 10 Co-op workexperienceinchosencareerfieldatindustry AGR 194AgribusinessCo-opExperienceI(4) Prerequisite(s): AGR104 required. op instructor.Oraland/orwrittenreportsoftheexperience weeks selectedbythestudentwithassistancefromAg Co- location. Worksiteforpart-time(30hours)work 10 Co-op workexperienceinchosencareerfieldatindustry AGR 193HorticultureCo-opExperienceI(3) Prerequisite(s): DEV061orCPE techniques undersupervisionofcollegestaffandfaculty. Application ofagriculturalorhorticulturalprinciplesand AGR 189AppliedPracticesinAgricultureI(1) Lab Fee:$12 Corequisite(s): AGR104 Prerequisite(s): DEV061orCPE businesses. Agribusiness andHorticulturemajorsonly. equipment utilizedinvariousagricultural/horticultural Operating principles,safetyandmaintenanceoftransport AGR 185VehicleOperationandManagement(3) Prerequisite(s): DEV061orCPE operating asmallagribusinesssuccessfully. Basic managementprinciplesforplanning,organizingand AGR 174AgribusinessPrinciples(3) Lab Fee:$15 Prerequisite(s): AGR150 sources applicationmethodsandenvironmentalconcerns. Principles ofsoilfertility,plantnutrientrequirements, AGR 151SoilFertility(4) Lab Fee:$12 Prerequisite(s): DEV061orCPE soil organisms. physical properties,watermovement,organicmatterand A basicunderstandingofsoils,thestudysoilformation, AGR 150SoilScience(4) Lab Fee:$10 Prerequisite(s): DEV061orCPE a varietyoflearningresources. and cultureofherbaceousplantsinthelandscapeutilizing used inthegardenandlandscape.Usage,design,installation Recognition ofannuals,perennials,bulbsandmonocots AGR 145HerbaceousPlantMaterials(4) Lab Fee:$10 Prerequisite(s): DEV061orCPE Course Descriptions 71 AGR 253 Pest Management (5) AGR 253 practices of approved pest problems through Managing methods and chemical cultural, biological control using of pesticides. and application the safe use, handling including of interest. special area study of the student’s Individualized 122 Prerequisite(s): AGR Lab Fee: $15 Ag Trade (3) AGR 262 International and and food policy both in the U.S. A study of agriculture implications of world trade and political internationally. The production. Food and agriculture aspects of world food and their consequences. problems, policy alternatives Prerequisite(s): ENG 111 112 Corequisite(s): ENG AGR 284 Agribusiness Management (4) an agribusiness. In-depth coverage of both creating and managing creating a business Emphasis is on the steps necessary for plan. Prerequisite(s): AGR 174 Corequisite(s): ENG 112 II (1) AGR 289 Applied Practices in Agriculture principles and Application of agricultural or horticultural staff and faculty. techniques under supervision of college Prerequisite(s): AGR 189 II (3) AGR 293 Horticulture Co-op Experience chosen career field at A second Co-op work experience in (30 hours) work industry location. Work site for part-time assistance from Ag for 10 weeks selected by the student with of the experience Co-op instructor. Oral and/or written reports required. Prerequisite(s): AGR 104, AGR 193 AGR 294 Agribusiness Co-op Experience II (4) A second Co-op work experience in chosen career field at industry location. Work site for full-time (40 hours) work for 10 weeks selected by the student with assistance from Ag Co-op instructor. Oral and/or written reports of the experience required. Prerequisite(s): AGR 104, AGR 194 AGR 297 Landscape Design II (4) Advanced study of landscape design concepts with emphasis on planning, designing and pricing diversified landscapes. Prerequisite(s): AGR 226 Lab Fee: $12 AGR 298 Applied Practices in Agriculture III (1) Application of agricultural or horticultural principles and techniques under supervision of college staff and faculty. Prerequisite(s): AGR 289 AGR 206 Agribusiness Marketing (3) Agribusiness Marketing AGR 206 and problems, structure principles, policies, Fundamental the role of Includes agribusiness marketing. strategy of a marketing the development of in agribusiness and marketing plan. 174, ENG 111 Prerequisite(s): AGR (4) AGR 214 Crop Production of cultural practices and cost analysis Adoption, utilization, crops grown in Ohio. Product quality major field and forage related to production. Computer and commercial standards to crop production inputs. programs specific 140, ENG 111 Prerequisite(s): BIO Lab Fee: $10 Construction (4) AGR 219 Landscape practices of landscape Fundamental principles, theories and safety principles, construction. Site plan and preparation, and construction tool use and identification, landscape project management. materials, job bid development and Prerequisite(s): DEV 061 or CPE 061 Lab Fee: $25 AGR 224 Irrigation Systems (3) Primary emphasis Irrigation system operation and design. is toward turf and horticultural applications. Prerequisite(s): DEV 061 or CPE 061 AGR 225 Landscape Maintenance (4) of landscape sites. Practices involved in the maintenance and general Pruning, transplanting, mulching, watering plant care. Prerequisite(s): DEV 061 or CPE 061 Lab Fee: $15 AGR 226 Landscape Design (4) with emphasis A basic study of landscape design concepts on site planning, design principles, plant utilization and irrigation systems Prerequisite(s): DEV 061 or CPE 061 Lab Fee: $12 AGR 231 Plant Propagation (4) Principles, techniques, materials, and necessary facilities needed by commercial horticulture growers to propagate floral, greenhouse, and landscape plants. Prerequisite(s): DEV 061 or CPE 061 Lab Fee: $20 AGR 236 Turfgrass Management (3) Management of turfgrass culture practices as applied to various turfgrass industries. Includes equipment selection and maintenance, fertilizer and pest management, scheduling, record keeping and budgeting. Prerequisite(s): AGR 133 Lab Fee: $20 72 Course Descriptions Lab Fee:$3 Corequisite(s): ENG111 Prerequisite(s): DEV061orCPE 061andDEV071orCPE Survey ofvisualartduringpost impressionisttomodernera. ART 135ArtHistoryIII(3) Lab Fee:$3 Corequisite(s): ENG111 Prerequisite(s): DEV061orCPEand071 of themodernera. Survey ofvisualartfromlatemedievaltimestobeginnings ART 134ArtHistoryII(3) Lab Fee:$3 Corequisite(s): ENG111 Prerequisite(s): DEV061orCPEand071 Introduction tobasicconceptsofvisualandstylisticanalysis. Survey ofvisualartfrommedievaltimestoRenaissance. ART 133ArtHistoryI(3) Lab Fee:$3 Corequisite(s): ENG111 Prerequisite(s): DEV061orCPEand071 the historical,cultural,andsocialenvironment. problems ofthecreativeexperienceanditsrelationshipto context. Individualworksusedtoillustratethenatureand sculpture, architecture,music,anddancewithinanhistorical Awareness andaestheticappreciationofliterature,painting, ART 130AppreciationoftheArts(3) Lab Fee:$20 Prerequisite(s): ART112 design artists. and whitesimplecolor.Forbothfinegraphic Interpretation ofthefigureusingwetanddrymedia,black ART 113DrawingIII(3) Lab Fee:$5 Prerequisite(s): ART111 as perspective.Introductiontofiguredrawing. their proportionandstructurewithlightshadeaswell visual drawingskills.Studyoflocationformsinspace, Explores theuseofline,value,shapeandcolorindeveloping still life,landscape,andintroductiontosomefigurework. and simplecolordrawingtodevelopvisualskills.Useof with complexcompositionarrangements,wet/drymedia Continuing representationalandcontemporaryproblems ART 112DrawingII(3) Lab Fee:$5 Prerequisite(s): DEV061orCPE as wellperspective. space, theirproportionandstructurewithlightshade are given.Alsoincludedisthestudyoflocationformsin visual drawingskills.Twoandthree-dimensionalproblems Explores theuseoflinevalue,shapeandcolorindeveloping ART 111DrawingI(3) (ART) Art Lab Fee:$40 Prerequisite(s): DEV061or CPE061 function andbehavior. The humanasan organism; acomparative lookatstructure, BIO 113BiologyIII(4) Lab Fee:$40 Prerequisite(s): DEV061orCPE allowing organismstoexistinachangingenvironment. results fromsuchchangesandtheadaptationsthatoccur which organismschangeovertime,thediversityoflifethat Evolution, diversityandecologyororganisms.Processes by BIO 112BiologyII(4) Lab Fee:$40 School Chemistryorinstructorpermission Prerequisite(s): DEV061orCPE061,CHM110,High genetics. photosynthesis, cellularreproduction.Mendelianandmolecular anatomy, cellularprocessesincludingrespirationand Cell biologyandgenetics.Cellularmolecules,cellular BIO 111BiologyI(4) Lab Fee:$40 Prerequisite(s): DEV061orCPE061,091 included. growth anddevelopment.Aging,diseasesdisorders and homeostasis,metabolism,responsiveness,reproduction, The humanorganism:structureandorganization,integrity BIO 110FundamentalsofHumanBiology(4) Prerequisite(s): DEV061orCPE all systems. The humanbody’sstructureandfunctionwithemphasison BIO 105IntroductiontoAnatomyandPhysiology(4) Prerequisite(s): DEV061orCPE terminology. for medicaldocumentationandapplyknowledgeof prefixes, suffixes,androotwords.Learntouseabbreviations an understandingofthemeaningsmedicaltermsincluding health personnel.Useofmedicaldictionariesanddevelop to bettercommunicatewithphysicians,nursesandother Understand thelanguageofmedicineandexpandvocabulary BIO 102MedicalTerminology(3) (BIO) Biology Corequisite(s): ENG111 Prerequisite(s): DEV061orCPEand071 discussed astransmittersoftraditionalculturalvalues. interrelated artformssuchasmusic,dance,anddramaalso reflected inthevisualarts.Focusonarts,other and appreciationoftraditionalAfricanartcultureas General surveycoursetoenhancethestudent’sunderstanding ART 138ArtsofAfrica(3) Course Descriptions 73 BUS 106 Human Relations And Organizational Behavior (4) Organizational Behavior Human Relations And BUS 106 perception, self-concept, of self, personality, An assessment Includes skills. and nonverbal communications and verbal Discussion and practices. behavior concepts organizational work development of effective job success, and of diversity, workplace dynamics including conflict relations. A view of team problem solving and decision resolution, assertiveness, making. 061 or CPE 061 Prerequisite(s): DEV Lab Fee: $10 of Business Management (4) BUS 112 Principles functions: planning, organizing, The four basic management Topics include ethics, decision leading, and controlling. power and authority, delegation, making, planning, structure, and and motivational theories leadership and teamwork, productivity. Prerequisite(s): DEV 061 or CPE 061 (3) BUS 140 Introduction to Electronic Business and the unique A basic understanding of electronic business the electronic media requirements of conducting business in of the Internet. Prerequisite(s): BUS 105; GPH 100 or ITS 103 (3) BUS 142 Electronic Business Applications and tools. Application of electronic business techniques sites; management Development of electronic commerce social responsibility issues of electronic commerce. Legal, ethical, issues. Prerequisite(s): BUS 140 Lab Fee: $10 (4) BUS 202 Customer & Quality Management management through Customer satisfaction and quality improvement, employee involvement. Continuous process supplier partnerships, performance measures, Statistical Process Control (SPC), ISO9000, benchmarking, product liability, and the use of various management tools used for managing quality. Prerequisite(s): BUS 105 or BUS 106 or BUS 112, or instructor permission BUS 214 Small Business Theory and Practice (4) Small business and entrepreneurship. Decision for self- employment through small business opportunities; business planning, financing, marketing, and management. Integration of functional business courses into a balanced overview of entrepreneurship. Application through group activities and projects. Prerequisite(s): ACC 111, BUS 105, BUS 112 Corequisite(s): BUS 270 BUS 225 Human Resource Management (3) Examination of the human resource functions in the business organization. Job analysis, recruitment, hiring, training, performance appraisal, and compensation. Psychological (BUS) Business BUS 105 Introduction to Business (3) A broad survey of the American business system encompassing social responsibilities of business, our legal environment and business ethics, government regulation and taxation, forms of business ownership, small business administration, business management, organized labor, and other topics. Prerequisite(s): DEV 061 or CPE 061 BIO 118 Muscle Function (2) BIO 118 Muscle the origin, and function and skeletal structure Study of muscles. and extremity and action of trunk insertion, activities. muscle function during to palpation and Introduction CPE 061 DEV 061 or Prerequisite(s): 102, PTA 110 and PTA 120 Corequisite(s): BIO Physiology I (4) BIO 121 Anatomy and skin, bones, muscles, nervous system Human cells, tissues, system. cells, autonomic nervous 110 Prerequisite(s): CHM 102 Corequisite(s): BIO Lab Fee: $25 Physiology II (4) BIO 122 Anatomy and respiratory, urinary, digestive systems, Human circulatory, metabolism. acid-base and fluid and electrolyte balance, Prerequisite(s): BIO 102, BIO 121 Lab Fee: $25 BIO 123 Anatomy and Physiology III (4) senses, endocrine Central and peripheral nervous system, special reproduction. and lymphatic systems, immunity and Prerequisite(s): BIO 122 Lab Fee: $25 BIO 131 Microbiology I (4) chlamydia, Study of bacteria, fungi, protista, rickettsiae, on bacteria and their viruses, and helminths. Emphasis relationship to health. Prerequisite(s): DEV 061 or CPE 061 Lab Fee: $90 BIO 140 Plant Science (4) including growth, Basic structure and function of plants, photosynthesis, vegetative, and reproductive structures, heredity, and development. respiration, and the control of growth Prerequisite(s): DEV 061 or CPE 061 and DEV 071 or CPE 071 Corequisite(s): ENG 111 Lab Fee: $40 BIO 230 Biomechanics (4) The science of human motion and the systematic application of mechanical laws to movement. Includes fundamentals of posture and gait analysis. Laboratory practice. Prerequisite(s): BIO 118, BIO 121, PTA 120 Corequisite(s): BIO 122, PTA 145 Lab Fee: $15 74 Course Descriptions making intheareasofmarketing, production,researchand differential, andnichestrategies. Includesmanagementdecision- in competitivepositioning,environmental analysis,competitive strategy, aswellsupporting functionalstrategies.Concepts Integrated corporatestrategyand policy,includingcompetitive BUS 290BusinessStrategyand PolicySeminar(4) Prerequisite(s): BUS112and266orSTT264 materials requirementplanning,andprojectmanagement. location, layout,humanresources,just-in-timesystems, productivity, qualityissues,strategy,capacityplanning, The designandmanagingofproductionoperations,including BUS 272ProductionandOperationsManagement(3) Prerequisite(s): ACC112,MTH106 capital markets,andtimevalueofmoney. on financialplanning,capitalmanagement,budgeting, Financial managementofbusinessenterpriseswithemphasis BUS 270BusinessFinance(4) Prerequisite(s): BUS105 business andworldwideoperations. the managerialperspectiveonissuesarisingfrominternational institutions oftrade,investment,andmanagementemphasizing Global dimensionsofbusiness;anoverviewtheoriesand BUS 268IntroductiontoInternationalBusiness(4) Prerequisite(s): MTH106 processes toanalyzebusinesssituations. Application ofpracticalbusinessmathematicsandstatistical BUS 266QuantativeBusinessMethods(4) Prerequisite(s): DEV061orCPE partnership, corporations,andrealproperty. personal property.Thelawofnegotiableinstruments, History ofthelaw,lawcontracts,agency,salesand BUS 260BusinessLaw(3) of instructor Prerequisite(s): BUS105or106112permission concepts andpracticeingroupsettings. Development ofleadershipskills,personalphilosophy.Integrates BUS 250LeadershipinOrganizations(4) Prerequisite(s): DEV061orCPE goods andservices. and techniquesofsellinginrelationtovarioustypes the salesprocess,motivationofsalesperson.Fundamentals The roleofsellinginoureconomy.Psychologyselling, BUS 245Sales/SalesPromotion(3) Prerequisite(s): DEV061orCPE promotional aspects,alongwithelectronicmarketing. development, channelsofdistribution,pricingstructures, The functionsofmarketingproductsandservices.Product BUS 243PrinciplesofMarketing(4) Prerequisite(s): BUS105,106,112 forces motivatingworkers,discipline,andmorale. Corequisite(s): BUS270 Prerequisite(s): BUS105,112,243,ITS103 development. development, andfinanceaswellteamdynamics Lab Fee:$30 Corequisite(s): ENG111and MTH120or121 chemistry placementtest,DEV 103orCPE Prerequisite(s): CHM115or anappropriatescoreonthe energy andthermochemistry. VSEPR. Principlesandapplications ofstoichiometry,reactivity, of atoms,molecules,formulaunitsincludingbonding and mixtures. Theory,principlesandapplicationsofstructure Basic chemicalprinciplesofelements,compounds, and CHM 121GeneralChemistryI(5) Lab Fee:$20 Corequisite(s): ENG111 CHM 115orhighschoolchemistrywithin5years Prerequisite(s): DEV103orCPE103,andCHM114 or vitamins inmetabolism.Emphasisonhealth-relatedapplications. acids, proteins.Introductiontotheroleofenzymesand carbohydrates, carboxylicacids,esters,lipids,amides,amino of hydrocarbons,alcohols,phenols,ethers,aldehydes,ketones, Introduction tothestructures,chemicalandphysicalproperties CHM 116IntroductiontoOrganicandBiologicalChemistry(5) Lab Fee:$15 Corequisite(s): ENG111 Prerequisite(s): DEV103orCPEand071 equilibrium, acidsandbases. matter, energychanges,solutions,reactionratesandchemical atomic structure,bonding,chemicalreactions,statesof transformations ofmatter,includingdimensionalanalysis, Introduction tothecomposition,structure,properties,and Intended aspreparationforGeneralChemistry(CHM121). CHM 115IntroductiontoGeneralChemistry(5) Corequisite(s): ENG111 Prerequisite(s): DEV103orCPE and chemicalequilibrium,acidsbases. states ofmatter,energychanges,solutions,reactionrates analysis, atomicstructure,bonding,chemicalreactions, properties, andtransformationsofmatter,includingdimensional chemistry. Introductiontothecomposition,structure, (CHM 121)forstudentswhohavecompletedhighschool Intended asareviewcoursepriortotakingGeneralChemistry CHM 114IntroductiontoGeneralChemistryReview(4) Lab Fee:$15 Prerequisite(s): DEV061orCPE061,101101. biochemistry. chemical reactions,introductiontonuclear,organicand compounds, molesandmolarity,acidsbases,energyin of matter,atomicstructureandperiodicity,ioniccovalent chemistry coursefortheirmajor.Classificationandproperties Concepts inchemistryforstudentsrequiringonlyone CHM 110FundamentalsofChemistry(5) (CHM) Chemistry Course Descriptions 75 (COR) Corrections COR 100 Introduction to Corrections (4) history and Survey of the corrections system, including components of growth; role in the criminal justice system; federal corrections the correctional process; local, state, and present and future establishments; structures and operations; issues. Prerequisite(s): DEV 061 or CPE 061 Corequisite(s): CRJ 100 Lab Fee: $10 COR 105 Probation and Parole (4) History and philosophy of probation, aftercare, and other community programs for juvenile and adult offenders; function and philosophy of parole, current laws and case studies. Prerequisite(s): COR 100 Corequisite(s): CRJ 120 COR 130 Adult/Juvenile Corrections (4) Facilities, programs, and procedures for detention and incarceration; variations due to age, sex, offense of individual, social structure of facilities; humanistic control of incarcerated persons. Prerequisite(s): COR 100, CRJ 120 Lab Fee: $10 COR 280 Jail Practicum (4) Field service training, educational experience through appropriate observation and work assignment to witness function and operation of the jail, case laws, and current trends. Prerequisite(s): COR 100, COR 130, CRJ 120 Lab Fee: $10 COM 131 Introduction to Mass Communication (3) Introduction to Mass COM 131 public television, magazines, newspapers, radio, A study of topics as and allied advertising, photojournalism, relations, media and institutions affecting analysis of forces well as the quality of performance. and the resulting behavior, 061 or CPE 061 and DEV 071 or CPE 071 Prerequisite(s): DEV 111 Corequisite(s): ENG and News Writing (3) COM 200 Basic Reporting an in reporting and news writing with A beginning course style and grammar, basic news emphasis on journalistic and interview, coverage of speeches story structure, the and feature writing for print meetings, and elementary Also examines laws and ethics. electronic media. 111 Prerequisite(s): ENG 112 Corequisite(s): ENG COM 221 Effective Speaking II (3) on elements of Presentation design with an emphasis with appropriate argumentation, building a strong case for a specific evidence, order of arguments, and delivery audience outcome. Prerequisite(s): COM 121 Corequisite(s): ENG 112 (COM) Communications COM 111 Interpersonal Communication (3) Techniques, understanding, and skills required for effective interpersonal communication, focusing on linguistic, psychological and cultural factors affecting the communication process. Prerequisite(s): DEV 061 or CPE 061 and DEV 071 or CPE 071 Corequisite(s): ENG 111 COM 121 Effective Speaking I (3) Speaking in a variety of situations. Selection, development, and evaluation of public communication. Prerequisite(s): DEV 061 or CPE 061 and DEV 071 or CPE 071 Corequisite(s): ENG 111 CHM 122 General Chemistry II (5) General Chemistry CHM 122 of solids, of properties and applications Theory, principles and gas laws, phase changes, gases including liquids and applications principles and properties. Theory, colligative chemical chemical kinetics, reactions including of chemical applications of equilibrium (buffers, equilibrium, acids, bases, solubility products). common ion effect, 121, ENG 111 Prerequisite(s): CHM 112, MTH 122 Corequisite(s): ENG Lab Fee: $30 Chemistry III (5) CHM 123 General and and applications of quantitative Theory, principles emphasizing: thermodynamics, descriptive chemistry group chemistry, coordination chemistry, electrochemistry, main nuclear chemistry, organic chemistry solid state chemistry, and biochemistry. Prerequisite(s): CHM 122 Lab Fee: $30 CHM 211 Organic Chemistry I (5) of carbon Nomenclature, structure and stereochemistry properties of alkanes compounds. Chemical and physical Infrared spectroscopy and cycloalkanes and related compounds. and nuclear magnetic resonance. Prerequisite(s): CHM 123 Lab Fee: $35 CHM 212 Organic Chemistry II (5) hydrocarbons, Chemical and physical properties of unsaturated aromatic compounds oxygen containing carbon compounds, of polymers. and their derivatives, organic synthesis Prerequisite(s): CHM 211 Lab Fee: $35 CHM 213 Organic Chemistry III (5) related compounds. Polycyclic compounds, amines and Chemistry of biomolecules and biochemical synthesis and metabolism. Prerequisite(s): CHM 212 Lab Fee: $35 76 Course Descriptions Lab Fee:$10 Prerequisite(s): COR100,130,280,CRJ120 assignment instateoperatedadultcorrectionsfacilities. experience throughappropriateobservationandwork Field servicetraining,designedtobroadeneducational COR 282AdultInstitutionsPracticum(4) Lab Fee:$10 Prerequisite(s): COR100,130,280,CRJ120 assignment instateoperatedjuvenilecorrectionfacilities. experience throughappropriateobservationandwork Field servicetraining,designedtobroadeneducational COR 281JuvenileInstitutionsPracticum(4) study. ModuleBfocuseson sentencestructure(comma the specificwritingneedsfor individualareasofconcentrated abilities andrequirementsof English111and112aswell This courseisdesignedto prepareyouforthewriting CPE 074WritingFundamentalsModuleB(1) computer-based workonyourowntypecourse. proper punctuation.Institutionalcreditonly.This is a study. ModuleAfocusesonthemechanicsofwritingusing the specificwritingneedsforindividualareasofconcentrated abilities andrequirementsofEnglish111112aswell as This courseisdesignedtoprepareyouforthewriting CPE 073WritingFundamentalsModuleA(1) CSCC standard Prerequisite(s): Writingplacementtestresultbelowthe manner willalsobecovered.Institutionalcreditonly. ideas tosupporttopicsentencesinanorganizedandcoherent weekly writingassignments.Developmentoftopicand skills bycombiningexercisesingrammar/mechanicsand study. Thecourseattemptstoimprovesentenceandwriting the specificwritingneedsforindividualareasofconcentrated abilities andrequirementsofEnglish111112aswell This courseisdesignedtoprepareyouforthewriting CPE 071WritingFundamentals(4) CSCC standardorDEV061 Prerequisite(s): Readingplacementtestscorebelowthe credit only. development, andstudyskillsstrategies.Institutional 061, includinggeneralreadingcomprehension,vocabulary A continuationofreadingskilldevelopmentbeguninDEV CPE 062ReadingComprehensionII(4) placement testscorebelowtheCSCCstandard Prerequisite(s): Reading credit only. development andstudyskillsstrategies.Institutional including generalreadingcomprehension,vocabulary A semi-individualizedprogramofreadingskilldevelopment, CPE 061ReadingComprehensionI(4) (formerly DevelopmentalEducation[DEV]) (CPE) CollegePreparatoryEducation based workonyourowntype course. conversions. Institutionalcredit only.Thisisacomputer- with themetricsystem.ModuleDfocuseson decimals, percentages,ratiosandproportionsoperations Topics includewholenumbers,mixedfractions, CPE 095MathFundamentalsModuleD(1) based workonyourowntypecourse. with decimals.Institutionalcreditonly.Thisisacomputer- with themetricsystem.ModuleCfocusesonoperations decimals, percentages,ratiosandproportionsoperations Topics includewholenumbers,mixedfractions, CPE 094MathFundamentalsModuleC(1) based workonyourowntypecourse. with fractions.Institutionalcreditonly.Thisisacomputer- with themetricsystem.ModuleBfocusesonoperations decimals, percentages,ratiosandproportionsoperations Topics includewholenumbers,mixedfractions, CPE 093MathFundamentalsModuleB(1) computer-based workonyourowntypecourse. with wholenumbers.Institutionalcreditonly.Thisisa with themetricsystem.ModuleAfocusesonoperations decimals, percentages,ratiosandproportionsoperations Topics includewholenumbers,mixedfractions, CPE 092MathFundamentalsModuleA(1) standard Prerequisite(s): MathplacementtestscorebelowtheCSCC system. Institutionalcreditonly. decimals, percentages,ratiosandproportionsthemetric Topics includewholenumbers,mixedfractions, CPE 091MathFundamentals(4) based workonyourowntypecourse. of theessay.Institutionalcreditonly.Thisisacomputer- study. ModuleDfocusesonrhetoricsandtheintroduction the specificwritingneedsforindividualareasofconcentrated abilities andrequirementsofEnglish111112aswell This courseisdesignedtoprepareyouforthewriting CPE 076WritingFundamentalsModuleD(1) type course. credit only.Thisisacomputer-basedworkonyourown ideas, details,andconclusionswillbecovered.Institutional paragraph development.Topicsentences,developmentof study. ModuleCfocusesontheessentialelementsof the specificwritingneedsforindividualareasofconcentrated abilities andrequirementsofEnglish111112aswell This courseisdesignedtoprepareyouforthewriting CPE 075WritingFundamentalsModuleC(1) course. only. Thisisacomputer-basedworkonyourowntype splices, fragment,run-ons,wordiness).Institutionalcredit Course Descriptions 77 CRJ 118 Forensic Photography (3) Photography CRJ 118 Forensic and civil to criminal of photography The application courtroom preparation of including the investigations, presentation. PHO 111 Prerequisite(s): Lab Fee: $25 (3) CRJ 120 Juvenile Procedures system’s parts and subcultures; causative The juvenile justice of, and treatment programs for juvenile factors of, prevention delinquency. 061 or CPE 061 Prerequisite(s): DEV (3) CRJ 123 Patrol Operations of police patrol operations, including A comprehensive study foot patrol, crimes in progress, vehicle patrol techniques, stops and approaches. prowler calls, building searches, and Prerequisite(s): DEV 061 or CPE 061 CRJ 125 Community Policing (3) youth focused Principles of community policing including reorientation activities, community based crime prevention, and decentralizing of patrol, police/public accountability, police decision making. Prerequisite(s): DEV 061 or CPE 061 CRJ 201 Police Administration (3) including personnel Examination of administrative design, and utilization selection, training, advancement, discipline, of resources. Prerequisite(s): DEV 061 or CPE 061 CRJ 216 Community Relations (3) problems The development of skills to resolve communication between citizens and the police. Prerequisite(s): DEV 061 or CPE 061 CRJ 221 Forensic Science I (5) The search for, recognition of, and preservation of physical evidence found at crime scenes. Prerequisite(s): DEV 061 or CPE 061 Lab Fee: $15 CRJ 223 Forensic Science II (5) Familiarization with selected laboratory techniques commonly used by law enforcement agencies. Prerequisite(s): CRJ 221 Lab Fee: $15 CRJ 226 Interview and Interrogation (3) Examines the dynamics of the art of interviewing and interrogation of witnesses, victims, and suspects. Prerequisite(s): DEV 061 or CPE 061 CRJ 228 Criminal Investigation (3) Reconstruction of the sequences of a criminal act, including searching, preserving, and evaluating physical evidence. Prerequisite(s): DEV 061 or CPE 061 CRJ 100 Intro to Criminal Justice (4) Overview of the criminal justice system’s history, development and evolution including subsystems of police, courts and corrections. Prerequisite(s): DEV 061 or CPE 061 CRJ 112 Traffic Management (3) The principles of traffic control, accident reconstruction, and enforcement of the law. Prerequisite(s): DEV 061 or CPE 061 CRJ 116 Systems Approach to Computer Technology (3) The management of police departments through computer applications, using data base, electronic spreadsheet, and other commercial software. Prerequisite(s): DEV 061 or CPE 061 Lab Fee: $15 (CRJ) Criminal Justice CPE 096 Math Fundamentals Module E (1) Fundamentals CPE 096 Math fractions, mixed numbers, whole numbers, Topics include operations and proportions and percentages, ratios decimals, ratios and E focuses on metric system. Module with the a computer- only. This is Institutional credit proportions. own type course. based work on your Module F (1) CPE 097 Math Fundamentals numbers, mixed numbers, fractions, Topics include whole ratios and proportions and operations decimals, percentages, Module F focuses on percentages. with the metric system. on only. This is a computer-based work Institutional credit your own type course. Algebra I (4) CPE 101 Introductory basic algebra including operations with An introduction to (with applications), integers, solving linear and literal equations Institutional operations with polynomials and factoring. credit only. Prerequisite(s): Algebra standard or Math placement test score below the CSCC Fundamentals DEV 091 or CPE 091 CPE 102 Introductory Algebra II (4) equations containing Topics include rational expressions, graphs of points rational expressions (with applications), variables. Institutional and lines, slope and linear systems in two credit only. test score below the Prerequisite(s): Algebra placement 101 CSCC standard or DEV 101 or CPE CPE 103 Introductory Algebra III (4) with applications; Selected topics from plane geometry scientific notation; positive, negative, and fractional exponents; with radicals; quadratic simplifying, rationalizing and operations to functions and equations with applications; introduction graphing. Institutional credit only. Prerequisite(s): Algebra placement test score below the CSCC standard or DEV 102 or CPE 102 78 Course Descriptions Lab Fee:$480 Corequisite(s): CRJ287 Training Council.Commanderpermissionrequired. by theAttorneyGeneral’sOfficeandOhioPeaceOfficer’s requirements forpeaceofficertrainingcertificationasrequired Law enforcementskillsandtechniquestofulfillpartial CRJ 289BasicLawEnforcementII(8) Lab Fee:$480 Corequisite(s): CRJ289 Training Council.Commanderpermissionrequired. by theAttorneyGeneral’sOfficeandOhioPeaceOfficer’s requirements forpeaceofficertrainingcertificationasrequired Law enforcementskillsandtechniquestofulfillpartial CRJ 287BasicLawEnforcementI(8) 222, CRJ226,228,231 CRJ120, CRJ123,125,201,216,221, Prerequisite(s): CRJ100,112,116,118, justice process. purpose ofincreasingstudentunderstandingthecriminal Supervised workexperienceincriminaljusticeagenciesfor CRJ 280Practicum(3) Prerequisite(s): DEV061orCPE shelters, detoxificationcentersandfoodpantries. resources areavailabletopoliceofficerssuchashomeless of practicuminarelatedfield.Thestudentwilllearnwhat participate intwohoursofseminardiscussionand8hour A servicelearningclasswherethestudentwillweekly CRJ 250CommunityResources(3) Prerequisite(s): DEV061orCPE and lesserincludedoffenses. The explanationofOhio’sstatutorycode;elementsoffenses CRJ 232OhioCriminalCode(3) Prerequisite(s): DEV061orCPE defense, andprosecutorialprocesses. Overview ofthecriminalprocedures,law,common CRJ 231CriminalLaw(3) Prerequisite(s): DEV061orCPE criminal justiceprocess. Exploration ofjobstresses;thesocialvalueandethics CRJ 230SocialJustice(3) Lab Fee:$15 level equivalenttoITS080 Prerequisite(s): Dev101or CPE 101,computerknowledge to object-orientedprogramming. programming logic,anddatavalidationtechniques.Introduction of variables,constants,looping,strings,flowchartingbasics, Fundamental programmingconstructsandconcepts.Study CSD 104ProgrammingFundamentals(5) (CSD) ComputerSoftwareDevelopment Lab Fee:$10 Prerequisite(s): CSD150orinstructorpermission databases withMSSQLServer7.0. production/user interfaces.Designingandimplementing topics regardingdatabasecreation/manipulation/report programming databasesusingtransact-SQL.Basicandadvanced databases utilizingMSSQLServer).Databasestructure; Database designtheory(specificallyback-endrelational CSD 160DatabaseDesign(5) Lab Fee:$10 permission Prerequisite(s): DEV101orCPE101,CSD140instructor and maintaindatabase,troubleshootproblems. and maintaindata,configuremanagesecurity,monitor Install andconfigureaMSSQLServerDatabase.Manage CSD 150DatabaseAdministration(5) Lab Fee:$15 080 to ITS Prerequisite(s): Computerknowledgelevelequivalent (ER) diagrams. Database modelingandhowORMrelatestoEntityRelationship Object rolemodeling(ORM)techniquesandORMtools. Knowledge andskillsneededtomodelbusinessrequirements. CSD 130DatabaseModeling(3) Lab Fee:$15 Corequisite(s): CSD114;130 Prerequisite(s): DEV061orCPE and the.NETframework. and webservices.IntegrationofMSADO.NET,SQLserver, Knowledge andskillsneededtobuilddata-centricapplications CSD 118ProgrammingwithADO.NET(3) Lab Fee:$20 Prerequisite(s): CSD114 ASP.NET WebApplication. dynamic contenttoaWebsite.Focusesoncreatingan Visual Studio.NETandtheMicrosoft.NETplatformtodeliver Microsoft ASP.NETandVisualBasic.NET.Useof Fundamentals ofWebapplicationsiteimplementationusing CSD 116WebServicesApplications(5) Lab Fee:$20 Prerequisite(s): CSD104,ITS107,108 enhancements. Basic applicationtotakeadvantageofthelanguage’s goals ofthe.NETarchitecture.ExtendtraditionalVisual based applicationsusingVisualBasic.NET.Utilizeframework Knowledge andskillsneededtodevelopMicrosoft.NET- CSD 114VisualBasicForWebServices(5) Course Descriptions 79 (DAN) Dance Dance (1) DAN 100 Beginning for students with no previous dance Basic movement class exercises, movement combinations experience. Placement and movements common to ballet to improve flexibility, and modern dance. DAN 111 Ballet I (3) ballet for beginning Basic fundamentals and theory of classical and traveling students. Barre work, center combinations, sequences. DAN 112 Ballet II (3) techniques learned in Ability to apply concepts and refine and concepts. Ballet I. More advanced ballet techniques Includes barre work, Knowledge of 20th century ballet. center combinations, and traveling sequences. Prerequisite(s): DAN 111 DAN 113 Ballet III (3) Ballet I and Ballet Continuation of ballet fundamentals from between movement II. Increased awareness of the relationship sequences each and music. Barre, center floor, traveling class. Prerequisite(s): DAN 111, DAN 112 DAN 130 Jazz Dance I (3) Warm-up, simple Basic fundamentals of jazz technique. jazz style exercises, isolations, floor movements, movement dynamics, basic dance fundamentals, and vocabulary in the jazz idiom. DAN 131 Jazz Dance II (3) Intermediate level of jazz dance techniques. Includes combinations, isolations, jumps, leaps and turns. Work on styles, speed and balance. Prerequisite(s): DAN 130 DAN 132 Jazz Dance III (3) Advanced level jazz technique. Advanced movement sequences. Continued study of jazz artists and choreography. Prerequisite(s): DAN 131 DAN 135 Tap Dance I (3) Basic fundamentals of tap technique. Basic steps, rhythm and combinations. CSD 270 Creating and Publishing Web Sites (4) Creating and Publishing CSD 270 of different using a collection editing web pages Creating and (Cascading JavaScript, CSS such as HTML, XML, technologies Standard Object Model). and DOM (Document Style Sheets), of and actual publishing language concepts programming of an e-commerce site. web pages. Creation 116, CSD 208 Prerequisite(s): CSD Lab Fee: $20 CSD 208 Programming XML Web Services (3) Programming XML Web CSD 208 Services. to develop XML Web and skills needed Knowledge Markup consume Extensible locate, and Build, deploy, Studio, Focus on MS Visual (XML) Web Services. Language Integration Discovery, and Universal Description, MS ASP, and (UDDI). 118 Prerequisite(s): CSD 216 Corequisite(s): CSD Lab Fee: $20 Applications for Windows (3) CSD 210 Programming to build MS Forms applications. Provides skills required threading and asynchronous programming Topics include: GDI, web access, and deployment issues. issues, simple remoting, stressed. Use of the .NET Framework 118 Prerequisite(s): CSD Lab Fee: $15 CSD 216 C Concepts I (5) C# applications for Knowledge and skills needed to develop on C# program the Microsoft .NET Platform. Focuses details. structure, language, syntax, and implementation language concepts. Object-oriented and type-safe programming Permission Prerequisite(s): CSD 104 or Instructor Lab Fee: $20 CSD 217 C Concepts II (5) applications. Knowledge and skills needed to build Windows Topics to Utilization of the Microsoft.NET Framework. simple remoting, include Windows Forms, GDI+, threading, etc. Security and deployment issues. Prerequisite(s): CSD 216 Lab Fee: $20 CSD 220 Systems Analysis (4) information Integration of principles from management identify managerial systems theory and data processing to information needs. Development of systems to provide that information. Topics include: information gathering tools and techniques, analysis tools and techniques, and project management tools and techniques. A structured approach to development of information systems. Prerequisite(s): CSD 104 or Permission of Instructor Lab Fee: $10 CSD 222 Systems Design (4) Design of computer-based information systems. Requirements, methodology, and technical skills related to system specification, system design, development and documentation. Prerequisite(s): CSD 220 Lab Fee: $10 CSD 240 Component Object Model Development (5) Knowledge and skills needed to build scalable, distributed applications. Use of MS.NET Enterprise Services and the MS. NET Framework Prerequisite(s): CSD 118 Corequisite(s): CSD 217 Lab Fee: $20 80 Course Descriptions Lab Fee$50 historical stylesandmovementqualities. Basic choreographicfactorsusingasingledancer.Studyof DAN 150CompositionI(2) transference, simplemovementsandmovementcombinations. Movement principlesforactors.Bodyalignment,weight DAN 140Dance&MovementforActors(3) Prerequisite(s): DAN136 rhythms andcombinations. Advanced fundamentalsoftaptechnique,includingsteps, DAN 137TapDanceIII(3) Prerequisite(s): DAN135 Further workinbasicsteps,rhythmsandcombinations. Continued fundamentalsofthetaptechniqueandvocabulary. DAN 136TapDanceII(3) Lab Fee:$15 Prerequisite(s): DFT214,ENG 223 manuals. and specificationsforthepreparation ofassemblyandrepair program fortheadditionofnotes, assembly/repairinstructions assembly drawings.Drawingsmergedintoadesktoppublishing techniques usedtoconstructpart,exploded,andsectioned construction. Isometric,onepointandtwoperspective Graphic communicationwithcomputermethodsofdrawing DFT 203TechnicalPublication(4) Lab Fee:$15 Prerequisite(s): DFT102,211, ENT 101 shadows andperspectives. intersections ofsurfaces,anglesbetweenplanes,shades/ true lengthsoflines,shapessurfacesandplanes, space withpracticalapplicationstolocateanddetermine representations ofpoints,linesandplanesinthree-dimensional Use ofaCADsystemtocreatetwodimensionalgraphic DFT 103DescriptiveGeometry(4) Lab Fee:$10 Prerequisite(s): DFT101ortwoyearshighschooldrafting 14.100. work drawnanddimensionedinaccordancewithASMEY and perspectiveviews,fundamentalsofdesign.All developed views,pictorialdrawingsincludingisometric Auxiliary views,sections,fasteners,weldingsymbols,riveting, DFT 102DraftingII(3) Lab Fee:$10 Prerequisite(s): DEV061orCPE construction, sketchingandorthographicdrawing. Instruments andtheiruses,lettering,dimensioning,geometrical DFT 101DraftingI(3) (DFT) Drafting Education) (DEV) Developmental(See[CPE]CollegePreparatory Prerequisite(s): DFT212 similar parts. steps, makeglobaldrawingchangesandsimplifydraftingof using AutoLISPtoeliminateexcessivenumbersofdrafting automate thedraftinganddesignprocess.Increasingproductivity microcomputer systemstowriteAutoLISPprograms The useofWindowsversionAutoCADsoftwarewith DFT 215AutoLISP(3) Lab Fee:$15 Prerequisite(s): DFT212 modeling. creating orthographicviewsfromsolidmodels,andparmetric Generating 2Dand3Delements,integrating2D/3D drafting andthreedimensionalsolidmodelassemblies. CATIA asapowerfultoolfordesign.Two-dimensional DFT 214SolidModeling(4) Lab Fee:$15 Prerequisite(s): DFT 102, DFT 211 three-dimensional wireframedrawingsandcustommenus. software withmicrocomputersystemsasappliedtolibraries, Continuing theuseofWindowsversionAutoCAD DFT 212Computer-AidedDesignII(4) Lab Fee:$15 ENT 121 Prerequisite(s): DFT101ortwoyearshighschooldrafting, Drawings plottedfull-sizeandatscaleasrequired. and fullydimensionthemaccordingtoANSIstandards. Windows andAutoCADcommandstoproducedrawings to constructtwo-dimensionalmechanicaldrawings.Useof Microcomputer systemwithWindowsandAutoCADsoftware DFT 211Computer-AidedDesignI(4) Portfolio Program experiential credit.ApprovalofCoordinatorPriorLearning This courseisrequiredifseekingmorethan4hours of of learningexperiences,anddevelopmentaportfolio. writing agoalspaper,learningstatements,documentation experiential learning,developmentofachronologicalrecord, prior learningexperiences.Topicsincludeanoverview of The developmentofaportfoliotobeassessedforcredit for EBE 110PriorLearningPortfolioDevelopment(3) Lab Fee:$5 Prerequisite(s): DEV061orCPE professional image;follow-upletter. research organization;interviewingskills,discussionof Life, careerandeducationalgoals;resumecoverletter; EBE 100EmployabilitySkills(2) (EBE) Experienced-BasedEducation Course Descriptions 81 (ECE) Early Childhood Education (ECE) Early (3) Childhood Education to Early ECE 100 Introduction of early development to the historical An introduction physical of programs, the education, types childhood of and the development educational theory, environment, the child. 061 or CPE 061 Prerequisite(s): DEV Lab Fee: $30 Young Children (2) ECE 106 Observing in the behaviors of young children Observing and recording on Develop objectives based early childhood settings. needs using a variety of observation observed individual required. tools. Center observation 100 Prerequisite(s): ECE Lab Fee: $25 ECE 110 Infant/Toddler Education (3) appropriate Infant and toddler developmental milestones, educational theory environment for stimulation and learning, health and safety concerning the first two years of life, toddlers. aspects of group care for infants and Prerequisite(s): ECE 100 Lab Fee: $25 (4) ECE 112 Resources in Early Childhood Education becoming aware Making teaching materials and audiovisuals; as free or inexpensive of early childhood technology as well and use of materials. material. Examination of cost, storage, organizations; Exploring community and professional trips. communication with parents and field Prerequisite(s): ECE 100 Lab Fee: $35 ECE 114 Art, Music and the Child (3) Resources Creativity of the child in art, music, movement. for developing and implementing curriculum. Prerequisite(s): DEV 061 or CPE 061 Lab Fee: $35 ECE 120 Language Development and the Child (3) Communication of the child, developmental stages, language disabilities, language screening, curriculum development for the typical/atypical child, and literature selection/evaluation eight years of age. for children from birth to Prerequisite(s): ECE 100, ECE 110 Lab Fee: $25 ECE 210 Children’s Literature (3) This course is a comprehensive study of children’s literature and how to use it effectively with young children from birth to age eight based on NAEYC’s developmentally appropriate practice of literacy experiences. This course is designed to expose students to many titles of award winning children’s literature and teach basic book handling skills. Prerequisite(s): ECE 100 Lab Fee: $25 EBE 282 Co-Op Education I (2) EBE 282 Co-Op familiarity the world of work, studies to Relating academic and of the principles career, application with a particular learning establishing in classroom experiences, theories learned learning reports. Workplace and preparing related outcomes, documented hours. of a minimum of 200 100 and approved co-op placement Prerequisite(s): EBE I (3) EBE 283 Co-Op Education studies to the world of work, familiarity Relating academic and application of the principles with a particular career, experiences, establishing learning theories learned in classroom related reports. Workplace learning outcomes, and preparing documented hours. of a minimum of 300 100 and approved co-op placement Prerequisite(s): EBE EBE 284 Co-Op Education I (4) of work, familiarity Relating academic studies to the world of the principles and with a particular career, application establishing learning theories learned in classroom experiences, Workplace learning outcomes, and preparing related reports. of a minimum of 400 documented hours. co-op placement Prerequisite(s): EBE 100 and approved EBE 287 Co-Op Seminar I (2) relating to classroom Discussion of workplace experiences theory and practice to the work environment. Prerequisite(s): EBE 100 Corequisite(s): EBE 282 EBE 292 Co-Op Education II (2) In addition to Continuation of valuable work experience. is required based requirements of EBE 282, a special project of a minimum of on the technology. Workplace learning 200 documented hours. or EBE 284; and Prerequisite(s): EBE 282 or EBE 283 approved co-op placement EBE 293 Co-Op Education II (3) Continuation of valuable work experience. In addition to requirements of EBE 283, a special project is required based on the technology. Workplace learning of a minimum of 300 documented hours. Prerequisite(s): EBE 282 or EBE 283 or EBE 284; and approved co-op placement EBE 294 Co-Op Education II (4) Continuation of valuable work experience. In addition to requirements of EBE284, a special project is required based on the technology. Workplace learning of a minimum of 400 documented hours. Prerequisite(s): EBE 282 or EBE 283 or EBE 284; and approved co-op placement EBE 297 Co-Op Seminar II (2) Discussion of workplace experiences relating classroom theory and practice to the work environment. Prerequisite(s): EBE 287 Corequisite(s): EBE 292 82 Course Descriptions Lab Fee:$25 Prerequisite(s): ECE100, 110 the earlyliteracyoutcomes of youngchildren. or futureearlychildhoodteachers andcaregiverstoenhance a developmentallyappropriate approach,andpreparecurrent age 6astrongfoundationinearly readingandwritingwithin principles andpracticesforprovidingchildrenbirththrough In thiscoursethestudentwilldiscoverresearch-based ECE 222EarlyLiteracyDevelopment-SessionC(3) Lab Fee:$25 Prerequisite(s): ECE100,110 the earlyliteracyoutcomesofyoungchildren. or futureearlychildhoodteachersandcaregiverstoenhance a developmentallyappropriateapproach,andpreparecurrent age 6astrongfoundationinearlyreadingandwritingwithin principles andpracticesforprovidingchildrenbirththrough In thiscoursethestudentwilldiscoverresearch-based ECE 221EarlyLiteracyDevelopment-SessionB(3) Lab Fee:$25 Prerequisite(s): ECE100,110 the earlyliteracyoutcomesofyoungchildren. or futureearlychildhoodteachersandcaregiverstoenhance a developmentallyappropriateapproach,andpreparecurrent age 6astrongfoundationinearlyreadingandwritingwithin principles andpracticesforprovidingchildrenbirththrough In thiscoursethestudentwilldiscoverresearch-based ECE 220EarlyLiteracyDevelopment-SessionA(3) Lab Fee:$25 Prerequisite(s): ECE100,110 assistance; andlicensingregulations. family needsandconcerns;community,statefederal curriculum fortheindividualchildwithspecialneeds; Early childhoodeducationandthespecialneedschild; ECE 217SpecialNeedsChild(4) Lab Fee:$25 Prerequisite(s): ECE100 skills. laboratory activitiestostimulatebasicmathandscience Math andsciencecurriculumactivities,observations,providing ECE 215Math/ScienceActivities(3) Lab Fee:$25 Prerequisite(s): DEV061orCPE nutrition, curriculum,andparentcommunication. maintaining asafe,healthyenvironment;childhooddiseases, Role oftheteacherinpreventingaccidents;providingand ECE 213Health,SafetyandNutrition(3) Lab Fee:$25 Prerequisite(s): ECE100 age child. as apartofthecurriculumforpre-kindergarten/school- enhancing movementintheclassroom,andphysicaleducation perceptual motorabilities,physicaltheory,activities Motor developmentoftheyoungchildwithemphasison ECE 211SensoryMotorSkills(3) child; classroommanagement andcommunicationskills. environment thatpromotesdiscovery andself-esteemofthe and developmentallyappropriate curriculum;creatingan ECE facultymember;developing andevaluatingageappropriate while undertheguidanceofcooperatingteacherand the assessing learningneeds;takingtheroleofleadteacher values ofchilddevelopment,educationtheyoungchild; Childhood Educationprogram;knowledge,skills,attitudes, Supervised experiencesinapprovedchildcarecenters/Early ECE 272PracticumII(2) Lab Fee:$20 Corequisite(s): ECE291 Prerequisite(s): ECE112,114120,223 theory intheclassroom. small groups,becomingawareofroutinesandimplementing with appropriateactivitiesindividualchildrenandin child carecenter/EarlyChildhoodEducationprogram,assisting Supervised experiencesandobservationinanapproved ECE 271PracticumI(2) Lab Fee:$25 Prerequisite(s): ECE100,110 group. developmentally appropriatefortheearlychildhoodage An approachtodisciplinethatispositive,preventive,and ECE 250BehaviorManagementofChildren(3) Lab Fee:$25 Prerequisite(s): ECE100,225 education program. other skillsnecessarytomanageaqualityearlychildhood Ohio licensingregulations,enrollmentmanagementand scheduling, healthandsafety,managementtechniques, community assessmentneeds,facilityequipment,staffing, Guidelines forfinancingandbudgeting,boardmembers, ECE 230OrganizationalManagement(3) Lab Fee:$25 Prerequisite(s): DEV061orCPE the futureofearlychildhoodeducation. teacher, administrator,includinglegalaspects,ethics,and Issues, educationalprogramsconcerningthechild,parent, ECE 225Professional,Legal,EthicalIssues(2) Lab Fee:$25 Prerequisite(s): ECE110,PSY221 center before-schoolandafter-schoolsummerprogram. elementary schoolchildrenwhomayattendthechildcare Planning andimplementingschool-agecurriculumfor ECE 224School-AgeCurriculum(3) Lab Fee:$25 Prerequisite(s): ECE100,110 and evaluation,classroommanagementteachingtechniques. philosophy, goals,objectives,themes,lessonplanning,screening Planning andimplementingcurriculumwithemphasison ECE 223PreschoolCurriculum(3) Course Descriptions 83 (EMS) Emergency Medical Services EMS 101 Paramedic Theory/Practice I (7) services advanced life Introduction to emergency medical and VIII of the EMT- support following Division I, II, III, V, curricula. Includes Paramedic national standard training of roles and pre-hospital environment, an overview aspects, therapeutic responsibilities, EMS systems, medical/legal incident response, communications, rescue operations, major advanced patient stress management in emergency services, IV therapy and assessment, advanced airway management, and introduction shock resuscitation, emergency pharmacology, practical skills to cardiac emergencies. Includes college laboratory. BIO 102, Prerequisite(s): Ohio EMT Basic Certification, BIO 105 Corequisite(s): EMS 112 Lab Fee: $65 EMS 102 Paramedic Theory/Practice II (7) Applies Paramedic Theory/Practice I. Integrates Division V, of the EMT-Paramedic national standard training curricula. Division V (Medical): Cardiology, Neurology, Endocrinology, Allergies & Anaphylaxis, Gastroenterology, Urology, Toxicology, Environmental Conditions, Infectious and Communicable Diseases, Behavioral & Psychiatric Disorders, Gynecology and Obstetrics, Pediatrics, and Geriatrics. Includes college practical skills laboratory. Prerequisite(s): EMS 101, EMS 112 Corequisite(s): EMS 114, EMS 120 Lab Fee: $65 EMS 105 Paramedic Theory/Practice III (6) Applies Paramedic Theory/Practice I and Paramedic Theory/ Practice II and integrates application of theory in a case study format, including case scenario presentations and role play situations, emphasizing critical thinking and decision making. Gives the student the ability to apply knowledge elective for students whose program does not require ECO program does not students whose elective for 222.) 221 and ECO or CPE 071 061 and DEV 071 DEV 061 or CPE Prerequisite(s): ENG 111 Corequisite(s): of Macroeconomics (3) ECO 221 Principles from a macro perspective including Fundamentals of economics (GDP), monetary and fiscal policies, gross domestic product trends and cycles. 111 Prerequisite(s): ENG 112 Corequisite(s): ENG of Microeconomics (3) ECO 222 Principles from a micro perspective including Fundamentals of economics behavior, supply and demand, price principles of consumer competition and resource allocations and wage determination, within individual markets. Prerequisite(s): ENG 111 Corequisite(s): ENG 112 (ECO) Economics ECO 110 General Economics (3) Social/political analysis of contemporary economic issues, including population, inflation, unemployment, energy, and other policy issues. (Serves as General Education Prerequisite(s): ECE 112, ECE 114, ECE 120, PSY 221 114, ECE 120, ECE 112, ECE Prerequisite(s): ECE 292 Corequisite(s): $20 Lab Fee: in Early Childhood and Mentoring ECE 275 Leadership Programs (2) of pre- and in-service teachers Leadership and mentoring adult development, developmentally using principles of and effective communication. appropriate practice, 100 Prerequisite(s): ECE Lab Fee: $25 Practicum-Administration (2) ECE 283 Child Care care administrator in a licensed child Job shadowing a child Education program. Observing care center/Early Childhood duties including: bookkeeping and implementing administrative and inventory, procedures, interviewing parents, supplies duties performed curriculum, staffing patterns, and other day-to-day operations by the administrator while supervising the of a child care center. Prerequisite(s): ECE 225, ECE 230 Corequisite(s): ECE 293 Lab Fee: $25 ECE 291 Child Care Seminar I (2) approved child care Analysis of experiences gained in an reviewing theory, center/Early Childhood Education program, management, lesson teaching skills, team teaching, classroom planning and evaluation. Prerequisite(s): PSY 221 Corequisite(s): ECE 271 Lab Fee: $25 ECE 292 Child Care Seminar II (2) the lead teacher’s Analysis of experiences gained while taking childhood education role in a licensed child care center/early teaching techniques, program, the typical/atypical child, behavior management, lesson planning, implementation followed by evaluation, parent communication and staff relationships in the workplace. Prerequisite(s): ECE 271, ECE 291 Corequisite(s): ECE 272 Lab Fee: $25 ECE 293 Child Care Seminar- Administration (2) Review experiences gained while job shadowing a child care administrator in a licensed child care center/Early Childhood Education program, review and complete exercises assigned from textbook. Prerequisite(s): ECE 225, ECE 230, ECE 275 Corequisite(s): ECE 283 84 Course Descriptions Prerequisite(s): EMS101, 112 a participantrolewiththeAdvanced LifeSupportteam. run onEMScalls,progressingfromanobservationrole to of theparamedic,andgivingstudentopportunity to team, allowingthestudenttoobservedailyresponsibilities Beginning levelofambulanceexperiencewithaparamedic EMS 120ALSFieldObservationI(1) Corequisite(s): EMS105 Prerequisite(s): EMS102,114,120 requirements. through morespecializedfacilitiescompletinghospitalclinical medical emergenciesandbehavioralrotating support, pre-hospitaltraumaskills,assessmentandmanagement in theoperatingroom,cardiacskills,advancedlife therapy team,respiratorytherapy,pediatrics,andintubation the collegelaboratory.Includesemergencydepartment,IV hospital settingobservingandpracticingskillsevaluatedin Advanced phaseofthehospitalclinicalpracticein EMS 116HospitalPracticeIII(2) Lab fee:$10 Corequisite(s): EMS102 Prerequisite(s): EMS101,112 support, andpre-hospitaltraumaskills. the operatingroom,cardiacskills,advancedlife therapy team,respiratorytherapy,pediatrics,intubationin the collegelaboratory.Includesemergencydepartment,IV hospital settingobservingandpracticingskillsevaluatedin Intermediate phaseofthehospitalclinicalpracticein EMS 114HospitalPracticeII(2) Liability fee:$62 Corequisite(s): EMS101 Prerequisite(s): BIO102,105,OhioEMTBasicCertification in theoperatingroom. therapy team,respiratorytherapy,pediatrics,andintubation college laboratory.Includesemergencydepartment,IV setting observingandpracticingskillsevaluatedinthe Beginning ofthehospitalclinicalpracticein EMS 112HospitalPracticeI(1) Lab Fee:$10 Prerequisite(s): BIO102,121, or permissionofinstructor measures. recognition ofhealthemergencies;demonstrationassistive Consideration ofselectedhealthconditionsandissues; EMS 110HealthandEmergencies(3) Lab Fee:$40 Corequisite(s): EMS116 Prerequisite(s): EMS102,114,120 and practicalskillsevaluationinacollegelaboratorysetting. of theEMT-Paramedicnationalstandardtrainingcurriculum situations. IncludesanoverviewofdivisionsIthroughVI handling lifethreateningandnon-lifeemergency P Certification Prerequisite(s): OhioEMSBasic CertificationorOhioEMT- base. Casestudiesarepresented. criminal andcivillawwithanemphasistoexpandknowledge Legal aspectsofbasicandadvancedpre-hospitalcareincluding EMS 250LegalInsights(2) Operation Certificate Prerequisite(s): EMSCertificationandHazardousMaterial planning. incident command,majorresponse,anddisaster natural disasters. Incorporates aworking knowledgeof to thepreplanning,reactingandfollowupmanmade and responses, Implementationofpubliceducationasitrelates Applies EMStheoriesandpracticesinplanningfordisaster EMS 240HazardousMaterial/DisasterManagement(3) permission Prerequisite(s): OhioEMT-PCertificationorinstructor other facetsofEmergencyMedicalServicesSystems. and evaluatingpersonnel,equipment,budget,staffing Development ofskillsformanaging,coordinating,implementing EMS 230Supervision(3) instructor permission Prerequisite(s): EMS105orOhioEMT-PCertification an emphasisonpracticalapplicationinalaboratorysetting. health careprofessionalstressingadvancedtechniqueswith Theoretical basisandmethodsofpatientassessmentforthe EMS 225AdvancedPatientAssessment(4) or instructorpermission Prerequisite(s): EMS105orcurrentOhioEMT-Pcertification and forillorinjuredpatients. contraindications withanemphasisonmedicationsusedby routes ofadministration,dosages,sideeffectsand General classificationofdrugs,indication,therapeuticeffects, EMS 220Pharmacology(3) Lab Fee:$15 Prerequisite(s): DEV061orCPE guidelines. resuscitation inaccordancewiththeAmericanHeartAssociation methods incommunityandprofessionalcardiopulmonary infants, children,andadults.Instructiontreatment Introduction torespiratoryandcirculatoryemergencyin EMS 171BasicLifeSupport:CPR(1) Corequisite(s): EMS105,116 Prerequisite(s): EMS102,114,120 team. participant/leadership rolewiththeAdvancedLifeSupport run onEMScallsprogressingfromanobservationroletoa of theparamedic,andgivingstudentopportunityto team, allowingthestudenttoobservedailyresponsibilities Continuation ofambulanceexperiencewithaparamedic EMS 122ALSFieldObservationII(1) Course Descriptions 85 on the importance of factual accuracy, completeness, appropriate completeness, of factual accuracy, on the importance and writing style. proper grammar, tone, clarity, OAD 105 ENG 111 or Prerequisite(s): (3) Technical Report Writing ENG 223 encountered on the job, including Technical communications technical definitions, descriptions letters of application/resumes, proposals, progress reports, of mechanisms, instructions, complaint letters, claim letters, memos, oral presentations, as newsletters, web pages, Internet, inquiry letters, E-mail, behavior, attitudes, values, and social well as research on culture in terms of how these variables system of another preferences and expectations. influence on-job communication 111 and ITS 12W or basic word Prerequisite(s): ENG skills. processing and keyboarding 112 Corequisite(s): ENG ENG 225 Creative Writing (3) major literary genres: A practical introduction to the three topics include the fiction, poetry and drama. Discussion projects include basic elements of the three forms. Writing fiction, and a one-act a collection of poems, short and long script, screen play or play. Prerequisite(s): ENG 111 Corequisite(s): ENG 112 ENG 230 Great Books: Literature (3) works and periods of Chronological selection of the major and progressing world literature beginning with the ancients through modern times. Writing intensive. Prerequisite(s): ENG 111 Corequisite(s): ENG 112 ENG 241 Poetry (3) of world poetry, Both traditional and contemporary forms free verse; experimental including rhyme and meter; blank verse; explication and forms; figurative language and allusion; interpretation. Prerequisite(s): ENG 111 Corequisite(s): ENG 112 ENG 243 Fiction (3) Critical reading, discussion, and analysis of short stories and novels. Prerequisite(s): ENG 111 Corequisite(s): ENG 112 ENG 245 Drama (3) Study and analysis of plays from different historical periods. Prerequisite(s): ENG 111 Corequisite(s): ENG 112 ENG 250 American Literature (3) Themes, ideas and periods in American literature from its beginning through modern times including selections from Twain, Hawthorne, Poe, Thereau, Whitman, Dickson, Eliot, Frost, Wright, and Morrison. Prerequisite(s): ENG 111 Corequisite(s): ENG 112 ENG 111 English I (4) modes of writing; The process of writing personal essays; intensive. language issues; and library skills. Writing or DEV 071 or CPE Prerequisite(s): DEV 061 or CPE 061 071 ENG 112 English II (4) research skills, and Critical thinking, persuasive writing, literary analysis. Writing intensive. Prerequisite(s): ENG 111 ENG 130 Introduction to Literature (3) Critical readings, discussion, and analysis of poetry, short story, and drama. Prerequisite(s): DEV 061 or CPE 061 and DEV 071 or CPE 071 Corequisite(s): ENG 111 ENG 135 Business Report Writing (4) Business report writing including periodic, situational, informational, compliance, and feasibility reports. Particular emphasis on critical thinking and writing a proposal, a work plan, progress reports, and a long analytical research report. Oral presentation of research report. Will not necessarily transfer as the equivalent of ENG 112. Prerequisite(s): ENG 111 ENG 221 Business Communications (3) Developing skill and sensitivity in preparing business documents, especially letters and memorandums, along with techniques for preparing effective resumes and application letters. Emphasis (ENG) English EMS 280 Advanced Rescue (4) EMS 280 when caring techniques used and advanced Safety factors and in various extraordinary exposed to injury for victims practical emphasized through situations. Skills are hazardous equipment. gear and various using protective application EMS Basic Certification Prerequisite(s): Ohio Lab Fee: $50 Theory/RNs (6) EMS 288 Paramedic Curriculum six divisions including National Standard Paramedic preparatory, trauma, burns, medical pre-hospital environment, neonatal and behavioral emergencies emergencies, OBG/GYN experience in the care of critically for the registered nurse An emphasis is placed on practical ill or injured patients. laboratory, hospital clinical setting knowledge in the college Prerequisite: RN licensure, ACLS and field internship. by accrediting provider and entrance requirements mandated EMS 101, EMS 102, agency. This course will substitute for experience for their EMS 105. RNs are given credit for past the U.S. Department nursing education and experience toward Paramedic Training of Transportation National Standard curriculum. two PALS, min. Prerequisite(s): RN, ACLS, PHTLS, BTLS, Certification, years critical care, TNCC, Ohio EMT-Basic EMS 102, EMS 105 this course will substitute for EMS 101, Lab Fee: $65 Liability Insurance: $62 86 Course Descriptions Prerequisite(s): ENG112 of conveyingitsmeaningtothereader. is tounderstandwhataworkofliteraturemeansandtheart application ofliterarytheoryandcriticalapproaches.Goal of relationshipspresentedintheliterature.Discussionand poems, dramaandnovels.Eachofferingfocusesonavariety Critical reading,analysisanddiscussionofshortstories, ENG 292RelationshipsinLiterature(3) Corequisite(s): ENG112 Prerequisite(s): ENG111 British literaturefrom1700tothepresenttime. Survey ofthemajorworks,themes,ideas,andperiods ENG 262BritishLiterature1700-Present(3) Corequisite(s): ENG112 Prerequisite(s): ENG111 from 700to1700. Survey ofthemajorworksandperiodsBritishliterature ENG 261BritishLiteratureto1700(3) Lab Fee:$15 Prerequisite(s): ENT101,MTH 140 regulators utilizinglaboratory experiments anddemonstrations. single andthree-phaseelectric circuits;transformersand and motors;batteries;magnetism; electromagneticinduction; courses. Directandalternatingcurrentcircuits,generators Self-paced capstoneclasscombiningINT150and155 ENT 205CircuitsandMachines(4) Lab Fee:$10 Prerequisite(s): DEV091orCPE and sharetechnicalinformation. manage information.UsetheInternetandE-mailtoobtain and databasesoftwaretopreparetechnicalreports and Window programs.Theuseofwordprocessing,spreadsheet, Computer usesintechnology.applicationsof ENT 121ComputerBasicsforAppliedTechnology(3) Lab Fee:$10 CPE 102 Corequisite(s): DEV102or Prerequisite(s): DEV061orCPE materials. concrete, wood,andelectromagneticsemi-conductor alloys. Non-metallicmaterialssuchasglass,ceramics, non-ferrous (aluminum,copper,nickel,etc.)materialsand Structural andmechanicalpropertiesofferrous(iron) ENT 111EngineeringMaterials(3) CPE 102 Corequisite(s): DEV102or Prerequisite(s): DEV061orCPE and vectors.Useofscientificcalculators. significant figures,simpletrigonometry,logarithms Engineering Technologyasaprofession.Dimensions,units, ENT 101EngineeringMethods(3) (ENT) EngineeringTechnologies Lab Fee:$20 Prerequisite(s): ENT261 rigid bodyandmechanicalvibration. work-energy, impulse,andmomentumofparticles Mechanics I.Kinematicsofparticlesandrigidbodies,acceleration, Calculus-based transfercourse.ContinuationofEngineering ENT 262EngineeringMechanicsII(5) Lab Fee:$20 Prerequisite(s): MTH240,PHY250 of mass,friction,andmomentinertia. of trussesandstructures,centroids,centergravity, equilibrium ofparticles,rigidbodies,analysis moment systems,resultant,components,freebodydiagrams, Calculus-based transfercourse.Vectorialtreatmentofforce/ ENT 261EngineeringMechanicsI(5) Prerequisite(s): ENT211orMET Circle Method. beams, combinedloading,compressionmembersandMohr’s moments ofinertia,torsion,stressesanddeflectionsin Equilibrium, stressandstrain,reviewofcentroids ENT 213StrengthofMaterials(4) Lab Fee:$20 Prerequisite(s): DFT214,ENT111,121,MET211 bodies atrest,trussesandframes. problems. Emphasisonanalysisofforcesactingelastic Modeling softwareapplicationsoffiniteelementthermal ENT 212FiniteElementModeling(4) Prerequisite(s): ENT101,MTH121,140,PHY111 trusses andframes,friction,momentsofinertia,applications. moments, centroids,equilibriumconditions,analysisof The forceanalysisofrigidbodiesatrest:vectors,forces, ENT 211Statics(3) Lab Fee:$10 Prerequisite(s): ENT101,MTH121 individual effectsandregressionanalysis. components ofvariance,crossedandnestedexperiments, and internalestimatesforthemean,inferences about variance, applications, variability,thenormalcurve,hypothesistesting Statistics withemphasisonengineeringandtechnical ENT 210EngineeringStatistics(3) Prerequisite(s): FRN111 writing. French language;practice in conversation,reading,and Study oftheFrenchculture, vocabularyandstructureofthe FRN 112FrenchII(4) Corequisite(s): ENG111 Prerequisite(s): DEV061orCPEand071 writing. French language;practiceinconversation,reading, and Study oftheFrenchculture,vocabularyandstructure the FRN 111FrenchI(4) (FRN) French Course Descriptions 87 (GPH) Graphic Design (4) GPH 100 Introduction to Graphic Design tool. Introduction Introduction to the Macintosh (Mac) as a layout Photoshop. Survey to QuarkXpress, Adobe Illustrator, Adobe of graphic design as a profession. Prerequisite(s): DEV 061 or CPE 061 Lab Fee: $20 GPH 105 Design Fundamentals (3) Study of five design principles: line, shape, value, texture, and color. Two-dimensional designs using media and tools/ materials of the graphic designer. Study of elements and principles of design to create color action and color relatedness. Prerequisite(s): DEV 061 or CPE 061 Lab Fee: $20 GPH 110 Digital Illustration (3) Use of Adobe Illustrator for technical illustration. Special emphasis placed on its use to generate professional quality technical drawings and information graphics. Prerequisite(s): GPH 100, GPH 105 Lab Fee: $20 GPH 112 Digital Typography I (3) The study of type characteristics. Practical application of basic typographic principles within the design process. Use of QuarkXPress. Prerequisite(s): GPH 100, GPH 105 Lab Fee: $20 GLG 113 Geology III (4) GLG 113 purposes processes with the of geologic The interaction of resources, use and misuse humans. Includes posed by waste, difficulties, environments, engineering hazardous on health. and effects 061 or CPE 061 Prerequisite(s): DEV Lab Fee: $40 Geology (4) GLG 114 Ohio Field geology course specializing in Ohio An introductory field and historical geological formations, geology. Physical to the karst and glacial features, field general exposure and the general importance of both mapping experience, economic geology. environmental and 111 or GLG 113 or with special permission Prerequisite(s): GLG from the instructor Lab Fee: $40 (5) GLG 201 Geology and Biology of the Bahamas Field Station on San Course is taught at the Bahamian Bahamas; with Karst Salvador, the outer most island in the Calcareous algae, topography, Foraminfera identification, current day ocean stromatolites, fossil identification, and experience Bahamian shore environments. Students will cultural events, both past and present. or GLG 111 or with Prerequisite(s): BIO 111, GLG 110 special permission from instructor. (GLG) Geology GLG 110 Earth Science (4) Concepts developed An introduction to the earth sciences. and Meteorology. in Astronomy, Geology, Oceanography identification, Laboratory experience in rock and mineral and problems in weather map reading and interpretation, oceanography and astronomy. Prerequisite(s): DEV 061 or CPE 061 Lab Fee: $40 GLG 111 Geology I (4) Study of the materials of which the world is composed; examination of ongoing surface processes, such as the movement of water and ice, formation of the land shape about us, and the chemical and mechanical breakdown of earth materials; processes leading to mountain building, alteration of deep and near surface rocks and earthquakes. Prerequisite(s): DEV 061 or CPE 061 Lab Fee: $40 GLG 112 Geology II (4) Study of earth in space; physical evolution of oceans, atmosphere, and continents; origins of life and evolution; physical and biological development of North American continent. Prerequisite(s): DEV 061 or CPE 061 Lab Fee: $40 (GER) German GER 111 German I (4) the German language; Study of the vocabulary and structure of German culture. practice in conversation, reading, writing. DEV 071 or CPE 071 Prerequisite(s): DEV 061 or CPE 061 and Corequisite(s): ENG 111 (GEO) Geography Geography (3) GEO 110 World Human the in human interaction with Major cultural elements a spatial analysis of population, environment, including religion, health care, ethnicity, rural landscape, language, economic resources and development, and urban settlements, problems. food supply, and environmental 01 061 or CPE 061 and DEV 071 or CPE Prerequisite(s): DEV 111 Corequisite(s): ENG (3) GEO 220 World Regional Geography developments from Cultural, social, economic, and political world regions, such the geographic perspective of specific Middle East. as Africa, Asia, Latin America, and the DEV 071 or CPE 071 Prerequisite(s): DEV 061 or CPE 061 and Corequisite(s): ENG 111 FRN 113 French III (4) FRN 113 of the vocabulary and structure French culture, Study of the and in conversation, reading, practice French language; writing. FRN 112 Prerequisite(s): 88 Course Descriptions and designusingavarietyof basiclayoutformatsinblack The secondofthreecourses designedtointroducelayout GPH 212ComputerLayoutII (3) Lab Fee:$20 Prerequisite(s): GPH114,201 Adobe Photoshop. refined comprehensives.Software:QuarkXPress and problem solvingthroughuseofthumbnailsandcomputer layout formatsinblackandwhiteand/orcolor.Creative Introduction tolayoutanddesignusingavarietyofbasic GPH 211ComputerLayoutI(3) Lab Fee:$20 Prerequisite(s): GPH203,212 and meetingdeadlinesemphasized. and color.Problem-solvingtechniques.Attentiontodetail advertising campaigns.Principlesofdesign,typography of techniques.Creativetechniquesandstrategiesforeffective a widevarietyofmedia.Singleaddesignsusing Traditional andprogressiveadvertisingproceduresusedin GPH 205AdvertisingLayout(3) Lab Fee:$20 Prerequisite(s): GPH202 imagery. AdobePhotoshoputilized. to workingwithselections,layers,type,andcomposite Advanced imageeditingfromscanningandretouching GPH 203ElectronicImageryIII(3) Lab Fee:$20 Prerequisite(s): ART 113,GPH201,114 imagery. AdobePhotoshopused. to workingwithselections,layers,typeandcomposite Intermediate imageeditingfromscanningandretouching GPH 202ElectronicImageryII(3) Lab Fee:$20 Prerequisite(s): ART112,GPH110,112 imagery. AdobePhotoshoputilized. to workingwithselections,layers,typeandcomposite Basics ofimageeditingfromscanningandretouchingimages GPH 201ElectronicImageryI(3) Lab Fee:$20 Prerequisite(s): GPH114,201,ART113 Adobe Illustrator symbols forthecreationofidentificationsystems.Software: The applicationandstudyoftype,logo/trademark, GPH 120Logo,Symbol,CorporateID(3) Lab Fee:$20 Prerequisite(s): GPH112 principles withinthedesignprocess. practical applicationofbasicandintermediatetypographic Continued studyoftypecharacteristics.Emphasisonthe GPH 114DigitalTypographyII(3) Prerequisite(s): GPH251 outcomes, andpreparingrelatedreports. theories learnedinclassroomexperiences,establishinglearning with aparticularcareer,applicationoftheprinciples and Relating academicstudiestotheworldofwork,familiarity GPH 285GraphicDesignInternship(3) Lab Fee:$20 Corequisite(s): GPH205 Prerequisite(s): GPH251 Adobe Photoshop,Illustrator. piece, digitalportfolio,artshow). Software: QuarkXPress, seeking employment(free-lancework,selfpromotional designers. Methodsofself-promotionforthepurpose required topresentportfoliosapanelofprofessional work withintheGraphicDesigncurriculum.Studentsare Further refinementofindividualportfoliosfromcourse GPH 252ProfessionalDevelopmentII(3) Lab Fee:$20 Corequisite(s): GPH212 Prerequisite(s): GPH211 QuarkXPress, AdobePhotoshop,Illustrator. of seekingemploymentandfree-lanceworkincluded.Software: Design curriculum.Methodsofself-promotionforthepurpose individual portfoliofromcourseworkwithintheGraphic professional image;follow-upletter.Developmentofan research organization;interviewingskills,discussionof Life, careerandeducationalgoals;resumecoverletter; GPH 251ProfessionalDevelopmentI(3) Lab Fee:$20 Prerequisite(s): GPH203,212 web pagedesign. Macromedia Dreamweaverwithemphasisonaestheticsof Study ofwebpagedesign.BasicHTMLcodinganduse GPH 230IntroductiontoWebDesign(3) Prerequisite(s): ART113 formation graphics. Illustrator toproduceprofessionalqualitydrawingsandin from roughs.SpecialemphasisplacedonusingAdobe illustrative conceptsusingthumbnails.Refiningideasgenerated Course indevelopingillustrations.Explorationofinitial GPH 220IllustrationTechniques(3) Lab Fee:$20 Prerequisite(s): GPH211 Software: QuarkXPress,AdobePhotoshop. the useofthumbnailsandcomputerrefinedcomprehensives. and whiteand/orcolor.Creativeproblemsolvingthrough theistic religionandscience;naturalism andsupernaturalism; theistic religionandscience; thefunctionsoflanguagein topics willincludesomeof the following:waysofrelating theistic religionasdisciplines andwaysofknowing.Specific To exploretherelationandinteraction betweenscienceand HON 291ScienceandReligion (4) (HON) Honors Course Descriptions 89 (HUM) Humanities Seminar (3) HUM 299 Capstone to the study of human nature: Interdisciplinary approach and critical thinking skills to address using readings, writing, from at least two disciplines including and evaluate readings sociology, psychology, mathematics, the natural sciences, theatre, religion, and philosophy; course literature, history, content will vary. of 60 credit hours earned including Prerequisite(s): A minimum ENG 112 (INT) Industrial Technology (3) INT 100 Mechanical Skills/Precision Measurement to maintain, Use of tools and precision measuring equipment (bearings, couplings, install and align mechanical equipment Lubrication flexible drives, gearing and gear reducers). press, dial indicators techniques, hand tools, drill press, shop and gage blocks. Prerequisite(s): DEV 061 or CPE 061 Lab Fee: $10 INT 101 Metrology I (2) measurement The application and use of basic and precision dial indicators, tools including scales, calipers, micrometers, in metrology. An and others. The use of computer interfaces including control introduction to statistical process control and Pareto diagrams. charts, cause and effect diagrams, and tolerancing. Beginning concepts in geometric dimensioning Prerequisite(s): DEV 061 or CPE 061 Lab Fee: $15 INT 105 Blueprint Reading & Schematics (3) Instruction in part visualization from drawings, location of key features, drawing dimensioning methods, geometric dimensioning and tolerancing symbols, electrical, pneumatic and hydraulic schematic symbols, and interpretation of drawing specifications. Prerequisite(s): DEV 061 or CPE 061 Lab Fee: $10 INT 115 Industrial Calculations (3) Application of mathematical concepts to the design, and maintenance of products and processes. Basic concepts in measurement and geometry. Presenting and analyzing data using charts, graphs, algebraic equations, vector diagrams, statistical calculations, and trigonometric relationships. Prerequisite(s): DEV 091 or CPE 091 INT 120 Fluid Power I (4) Components and principles utilized in basic industrial hydraulic and pneumatic circuits. Schematics for fluid systems, component Organized around topics and themes, not necessarily taught themes, not necessarily around topics and Organized order. in chronological History college-level American ENG 111 and Prerequisite(s): course recommended ENG 112 Corequisite(s): (HST) History To the 14th Century (3) HST 111 Western Civilization society from earliest times to the 14th History of western of economic, and cultural aspects century. Social, political, eras. the ancient and medieval 061 or CPE 061 and DEV 071 or CPE 071 Prerequisite(s): DEV 111 Corequisite(s): ENG from the 14th through 18th HST 112 Western Civilization Centuries (3) society from the end of medieval times History of western period. Renaissance, to the end of the French Revolutionary French Revolution, Reformation, the Enlightenment, the and the Napoleonic era. DEV 071 or CPE 071 Prerequisite(s): DEV 061 or CPE 061 and Corequisite(s): ENG 111 Century to the HST 113 Western Civilization from 19th Present (3) to the present. Social, History of western society from 1815 of the 19th-21st political, economic and cultural aspects New Industrialism, century. Nationalism, Revolution, the and 20th-century Socialism, Colonialism, Imperialism, developments. DEV 071 or CPE 071 Prerequisite(s): DEV 061 or CPE 061 and Corequisite(s): ENG 111 HST 121 American History to 1810 (3) to the Jeffersonian American history from before colonization and economic period including political, social, cultural history. DEV 071 or CPE 071 Prerequisite(s): DEV 061 or CPE 061 and Corequisite(s): ENG 111 HST 122 American History 1810-1900 (3) American history from the Jeffersonian period to the beginning of the 20th century including social, political, and economic development in the United States. Prerequisite(s): DEV 061 or CPE 061 and DEV 071 or CPE 071 Corequisite(s): ENG 111 HST 123 American History 1900-Present (3) American history of the United States in the 20th and 21st century. Political, social, cultural and economic history, concluding with a review of current events. Prerequisite(s): DEV 061 or CPE 061 and DEV 071 or CPE 071 Corequisite(s): ENG 111 HST 220 Topics in African-American History and Culture (3) Examination of the people and events that have helped shape the story of blacks in America from 1619 to present. falsificationism; miracles, cosmology and creation; and creation and creation; miracles, cosmology falsificationism; and evolution. 111 GPA of 3.0 and ENG A minimum Prerequisite(s): ENG 112 Corequisite(s): 90 Course Descriptions Prerequisite(s): INT150 analog todigitalandconverters. oscillators andmultivibrators,logicgates,encoders,decoders, circuits includingoperationalamplifiers,powersupplies, Introduction tosemiconductors,analoganddigitalintegrated INT 175FoundationsofDigitalControl(4) Lab Fee:$15 Prerequisite(s): DEV061orCPE gearing, gearreducers,V-belts,brakesandclutchassemblies. bearings, couplings,flexibledrives,valves,centrifugalpumps, mechanical powertransmissionequipment.Lubrication, Operating principles,troubleshootingandmaintenanceof INT 170MechanicalMaintenance(4) Lab Fee:$15 or highermathplacement Prerequisite(s): INT150,DEV091,102orCPE102, effects onmotorperformance. specific applications.Speed,torqueandpowertheir Basic motorcontrolconceptsandselectionofmotorsfor including theirperformancecharacteristicsandapplication. The varioustypesofdirectandalternatingcurrentmotors INT 155MotorsandMotorControls(4) Lab Fee:$15 Prerequisite(s): DEV061orCPE061,101 electrical wiringtechniquesandsysteminstallation. circuits, andtheuseofcircuitstocontrolmechanicalprocesses, Series andparallelcircuits.Basiclogiccircuits,control circuits. Calculationsinvolvedintroubleshooting direct currentcircuits.Useoftestequipmentforelectrical Components andoperationofcommonalternating INT 150ElectricalSystems(4) Prerequisite(s): DEV061orCPE and requirements. An introductiontoindustrialregulatorysafetyterminology INT 140IndustrialSafety(2) Lab Fee:$20 Prerequisite(s): INT120 vacuum systems. electronic sensorstofluidpowersystems.Principlesof using electricalandpneumaticdevices.Applicationof other components.Controlofadvancedhydrauliccircuits of circuitsutilizingcylinders,valves,hydraulicmotorsand Application ofhydraulicsystems.Connectionandoperation INT 125FluidPowerII(4) Lab Fee:$15 Prerequisite(s): DEV061orCPE for thedesignandtroubleshootingofsystems. operation, troubleshootingtechniquesandbasiccalculations Lab Fee:$20 Prerequisite(s): INT155 using circuitbreakers,fuses andgroundfaultinterrupters. voltage regulationandDCpowersupplies.Circuitprotection Transformers, ACpowerdistribution,factorcorrection, INT 260ElectricalDistribution(4) Lab Fee:$15 Prerequisite(s): INT250 machine, andinter-machinelevels. common testingequipment.Problemsatthecomponent, electrical controls,circuitryandsensorsusing Maintenance andtroubleshootingofmotors,solenoids, INT 255ElectricalTroubleshooting(4) Lab Fee:$20 Prerequisite(s): INT250 components. Automatic GuidedVehicles.Computerintegrationofmechanical Automatic Storage/RetrievalSystemandinvestigationof robots, ComputerNumericalControl(CNC)tools,conveyors, logic andflexibleautomationusingPIDAnalogControllers, Fixed automationusingtransferlinescontrolledbyrelay INT 252AutomatedSystems(4) Lab Fee:$10 Prerequisite(s): INT150orpermission a hand-heldprogrammerintroubleshootingPLC’s. PLC’s intoavarietyofprocessapplications.Utilization Controllers (PLC’s).Interfacingwithsensors,applicationof industrial/commercial processes.ProgrammableLogic Programming, connecting,andtestingPLC’sforcontrolof INT 250ProgrammableLogicControllers(3) Lab Fee:$15 Prerequisite(s): INT212 Closed loopcontrol. output transducers.Feedbacksystemsandservomechanisms. for controlofindustrialmachinesandprocesses.Input Fundamentals andspecificapplicationsofelectroniccomponents INT 225IndustrialElectronics(3) Lab Fee:$10 Prerequisite(s): INT101 index. Introductiontoacceptancesampling. both variablesandattributes.Processcapability industry. Controlchartdevelopmentandutilizationfor computers forQC.Qualityimprovementtechniques Philosophy, history,statisticalbasisofSPCanduse INT 215StatisticalProcessControl(3) Lab Fee:$15 Prerequisite(s): INT175or high schoolelectronics Troubleshooting atthecomponentlevel. Signatures, basictestingusingHUNTRON2000Scope. Survey ofelectroniccomponentsandsystems-operation. INT 212ElectronicSystems(4) Course Descriptions 91 ITS 108 XML Web Services (3) ITS 108 XML of programming techniques of the structure and Overview Distributed vision. of XML in the Microsoft.NET XML. Role fundamentals. computing standards-based to knowledge level equivalent Computer Prerequisite(s): or CPE 061 ITS 080, DEV 061 Lab Fee: $15 to SQL (3) ITS 109 Introduction required to write basic transact - SQL Knowledge and skills and physical data base design. Data queries. Use of logical Associations between tables. integrity concepts. 061 or CPE 061 and Dev 091 or CPE Prerequisite(s): DEV level equivalent to ITS 080 091; Computer knowledge Lab Fee: $15 ITS 12A Windows Concepts (2) a graphical operating Familiarization with the mouse and aspects of MicroSoft environment. Topics include all major keyboard and Windows. Knowledge of a personal computer basic DOS commands strongly recommended. level equivalent to Prerequisite(s): Computer knowledge ITS 080, DEV 061 or CPE 061. ITS 12D Beginning Database (1) updating, and Basic database manipulation (e.g. creating, Keyboarding generating reports) via packaged software. who have little or no skill strongly recommended. (Students longer in completing keyboarding skills will likely take much the assigned tasks. level equivalent to Prerequisite(s): Computer knowledge ITS 080, DEV 061 or CPE 061. (1) ITS 12P Beginning Presentation Graphics via the use Techniques of visual presentation development of a presentation software package. level equivalent to Prerequisite(s): Computer knowledge ITS 080, DEV 061 or CPE 061. ITS 12S Beginning Spreadsheet (1) Basic creation and manipulation of data within an electronic spreadsheet including planning and creating workbooks, using formulas and functions, creating charts, and formatting spreadsheet objects. Students with minimal computer skills will take longer in completing the assigned tasks and may want to consider taking ITS 080, Computer Fundamentals. Prerequisite(s): Computer knowledge level equivalent to ITS 080, DEV 061 or CPE 061. ITS 12W Beginning Word Processing (1) Basic creation and editing of documents using packaged word processing software. Keyboarding skills strongly recommended. Students who have never worked on a keyboard and have little or no keyboarding skills will likely take much longer in completing the assigned tasks. ITS 102, which teaches keyboarding skills and beginning word processing skill, may be substituted for ITS 12W. Prerequisite(s): Computer knowledge level equivalent to ITS 080, DEV 061 or CPE 061. (ITS) Information Technology Systems ITS 080 Computer FUNdamentals (1) operating systems, Fundamental concepts of computers, word processing, and network usage. Experience with basic Preparatory spreadsheet, database, and graphic programs. background. course for students with little or no computer unsatisfactory) basis. Graded on an S or U (satisfactory or (4) ITS 101 Using the Internet/Web Development WWW using various Creating and editing pages for the software packages including Dreamweaver. to equivalent Computer knowledge level Prerequisite(s): ITS 080, keyboarding skills (3) ITS 102 Keyboarding/Word Processing keyboarding skills. Development of techniques for proper packaged word Creating and editing documents using for students processing software. Strongly recommended who have few or no keyboarding skills. Can be used as a substitute for ITS 12W. Prerequisite(s): DEV 061 or CPE 061 ITS 103 Information Technology Basics (3) A brief overview of Windows or current GUI, basic but essential word processing concepts, electronic mail, WWW research techniques, OhioLINK. Students with little or no keyboarding experience should expect to take longer to complete assignments. Prerequisite(s): Computer knowledge level equivalent to ITS 080, DEV 061 or CPE 061. ITS 107 HTML Fundamentals (3) Knowledge and skills necessary to develop web applications. Utilization of HTML. Development of dynamic web sites. Creation of interactive web pages. Computer knowledge level equivalent to Prerequisite(s): ITS 080, DEV 061 or CPE 061. INT 270 Industrial Machine Maintenance (4) Machine Maintenance INT 270 Industrial courses to in previous DLL all skills acquired Utilizing and capstone class machines and maintain troubleshoot maintenance documentation and Manufacturer’s system levels. and predictive maintenance. to planned logs. Introduction and efficient sequence for failure Troubleshooting charts analysis. 155, INT 170, INT 255 Prerequisite(s): INT Lab Fee: $20 Projects (4) INT 280 Industrial Technology which students will apply the skills A capstone class in courses to design, fabricate, install, acquired in the DLL an assigned project of a scale and type document and debug and by local plants engineering normally done in-house maintenance personnel. Prerequisite(s): ENG 223, INT 255 Lab Fee: $20 92 Course Descriptions ITS 080,DEV061orCPE Prerequisite(s): Computerknowledgelevelequivalentto Office Specialist(MOS)Projectcertificationobjectives. software. CoversCompTIA’sITProject+andMicrosoft and procurementmanagement.UseofMicrosoftProject time, cost,quality,humanresource,communications,risk, projects. Coveredtopicsinclude:projectintegration;scope, to successfullymanagebusinessandsystemdevelopment Develops business,interpersonal,andtechnicalskillsrequired ITS 200ProjectManagement(5) Prerequisite(s): ITS12Wor102,103 between applications. procedures likemail-mergeandmacros;exchangingdata Formatting issues,intermediateandadvanced;automating ITS 14WIntermediateWordProcessing(2) Prerequisite(s): ITS12Sorinstructorpermission database functions,andformulas). packaged software(i.e.,managingfilesandmemory,graphing, Intermediate spreadsheetmanipulationtechniquesusing ITS 14SIntermediateSpreadsheet(2) Prerequisite(s): ITS12Porinstructorpermission Delivery ofpresentations. and expertlevelpresentations.Customizing Techniques foraddingvisualandaudioelementstointermediate ITS 14PIntermediatePresentationGraphics(2) Prerequisite(s): ITS12Dorinstructorpermission reports, indexing,searching,programming,etc.) software (i.e.,arithmetical/statisticalmanipulations,labels, Intermediate databasemanipulationtechniquesusingpackaged ITS 14DIntermediateDatabase(2) Prerequisite(s): ITS12A and systemmaintenance,GUIaccessories. customizing thesystem,installinghardware/software,file Using troubleshootingtools,workingwithDOSapplications, ITS 14AIntermediateWindowsConcepts(2) Corequisite(s): LPN108, 130,LPN160,NUR114 111, PSY221 Prerequisite(s): BIO102, 105,ENG111,ITS12W,PSY tests, treatmentandprinciples ofnursingcare. common disease/conditionsofeachbodysystem,diagnostic Basic principlesofmicrobiology,signsandsymptoms of LPN 125IntroductiontoDiseaseProcesses(4) Corequisite(s): LPN125,130,NUR114 111, PSY221 Prerequisite(s): BIO102,105,ENG111,ITS12W,PSY disorders. dietary treatmentofcommondiseaseconditionsandhealth An introductiontothebasicprinciplesofnutritionand LPN 108BasicNutritionandDietTherapy(2) (LPN) PracticalNursing different stagesofmaternity careduringatimeofphysical complications. Itincludeshelpingawomanthrough the the newbornwillbetaughtwithanemphasisonpreventing changes ofpregnancy,labor&delivery,postpartum, and growth anddevelopmentwillbediscussed.Thenormal and physiology,themalereproductivesystem,fetal to thechildbearingfemalewillbepresented.Femaleanatomy A holisticapproachtowomen’shealthcareanditsrelationship LPN 181Women’sHealthandObstetricNursing(2) Lab Fee:$100 Corequisite(s): LPN145,181,185 NUR 114 Prerequisite(s): LPN108,125,130,160, use ofthenursingprocess. of health,applicationmedicalandsurgicalasepsisthe Role ofthepracticalnurseinmaintenanceandpromotion LPN 164FundamentalsofNursingII(6) Liability Insurance:$20 Lab Fee:$100 Corequisite(s): LPN108,125,LPN,130,NUR114. ENG 111,ITS12W,PSY221 Prerequisite(s): BIO102, MST 181orequivalent,BIO105, lab andhealthcarefacilitysettings. basic assessmenttechniques,ethical/legalissues.College health, applicationofnursing,biological,andsocialsciences, Role ofthenurseinmaintenanceandpromotion LPN 160FundamentalsofNursingI(6) Corequisite(s): LPN164,181,185 Prerequisite(s): LPN108,125,160,NUR114 rather thanrotememorization. and nursingpractice.Emphasisonconceptuallearning patients, andtherelationshipbetweenpharmacologicknowledge their prototypedrugs,theindividualityandvariabilityof therapeutic implicationsofthemajordrugclassesincluding area includeprinciplesofpharmacology,functions,and Basic, essentialknowledgeofpharmacology.Majorcontent LPN 145Pharmacology(3) Corequisite(s): LPN191,195 LPN 185 Prerequisite(s): LPN130,145,164,181, nurses. Identifies careerconcernsandopportunitiesforpractical LPN 133NursingTrendsII(2) Corequisite(s): LPN108,125,160,NUR114 111, PSY221 Prerequisite(s): BIO102,105,ENG111,ITS12W,PSY organizations. Historical perspectivesonpracticalnursesandnursing Ethical andlegaldimensionsofpracticalnursingpractice. LPN 130NursingTrendsI(2) Course Descriptions 93 (MLT) Medical Laboratory Technology (2) MLT 101 Medical Laboratory Orientation of the medical History, role and professional responsibilities the medical laboratory. laboratory technician. Organization of Medical terminology. Prerequisite(s): DEV 061 or CPE 061 Corequisite(s): MLT 102 Laboratory (1) MLT 102 Medical Laboratory Orientation Principles of laboratory instrumentation. Use and care of laboratory instruments. Laboratory safety. Prerequisite(s): DEV 061 or CPE 061 Corequisite(s): MLT 101 Lab Fee: $35 MLT 111 Chemistry for Technicians (3) Chemistry of matter and measurement, atoms, molecules and ions, formulas, equations and moles, aqueous solution reactions, atomic structure, ionic and covalent bonding, saturated hydrocarbons, unsaturated hydrocarbons, alcohols, aldehydes, ketones, and carbohydrates. Prerequisite(s): DEV 061 or CPE 061 Corequisite(s): MLT 112 Lab Fee: $20 Liability: $20 Prerequisite(s): DFT 101, or INT 105, or two years of high INT 105, or two DFT 101, or Prerequisite(s): school drafting MAT 110 Corequisite(s): $25 Lab Fee: (4) MAT 112 Metal Fabrication emphasis on angle, bar, plate & sheet Metal Fabrication with and fabrication of projects stock. Pattern development metal brake, iron worker and angle using slip rolls, sheet rolls. 101 or INT 105, or two years of high Prerequisite(s): DFT school drafting Lab Fee: $50 Numerical Control (4) MAT 221 Computer of NC and CNC machining with The theory and practice engineering actual programming applications. Converting simulation to test drawings into programs using computer parts. programs and produce programmed Prerequisite(s): DFT 102, ENT 101 Corequisite(s): MAT 110 (4) MAT 222 Computer-Aided Manufacturing tool changing Application of procedures for CNC automatic concepts for complex on a lathe. NC and CNC programming parts on a computer controlled mill. Prerequisite(s): MAT 221 MAT 100 World Class Manufacturing (3) historical perspectives; World Class Manufacturing concepts and simultaneous and concurrent engineering and Japanese innovations in manufacturing. Prerequisite(s): DEV 091 or CPE 091, INT 105 or DFT 101 or two years of high school drafting MAT 110 Manufacturing Processes (3) Detailed overview of manufacturing processes including machine tool operations, metal forming, welding processes and casting. Prerequisite(s): DFT 101, or INT 105 or two years of high school drafting Corequisite(s): MAT 111 MAT 111 Manufacturing Laboratory (2) Set-up and operation of lathes, mills, drills, band saws, and grinders. Competency-based course requiring completion of several machining projects of increasing complexity. Safety, care, and use of equipment. Use of machinists’ references and inspection instruments. (MAT) Manufacturing Engineering Technology and emotional changes, and providing support for the providing support changes, and and emotional trends in other. Current family, and significant newborn, discussed. health will also be women’s 160, LPN 130, LPN LPN 125, LPN 108, Prerequisite(s): NUR 114 145, LPN 164, LPN 185 Corequisite(s): LPN (5) LPN 185 Pediatric Nursing the to meeting the needs of Family centered approach of of the nursing process, role pediatric client; application care of the infant/child with common the nurse in the diseases/conditions. LPN 125, LPN 130, LPN 160, 108, Prerequisite(s): LPN NUR 114 145, LPN 164, LPN 181 Corequisite(s): LPN LPN 191 Medical-Surgical Nursing I (10) providing nursing Application of the nursing process while medical conditions; care for adult clients with common admission through study and care of the surgical patient from discharge from the hospital. LPN 181, LPN 185 Prerequisite(s): LPN 145, LPN 163, Corequisite(s): LPN 133, LPN 195 Lab Fee: $50 LPN 195 Medical-Surgical Nursing II (4) of all prior nursing Comprehensive review and testing in a long-term classes. Application of the nursing process the nursing care care preceptorship to provide and manage nursing care. of groups of clients requiring skilled LPN 181, LPN 185 Prerequisite(s): LPN 145, LPN 163, Corequisite(s): LPN 133, LPN 191 Lab Fee: $50 94 Course Descriptions of quantitativechemicalanalysis ofbodyfluids,carbohydrates, Principles, procedures,quality assuranceandclinicalsignificance MLT 131ClinicalChemistry(3) Lab Fee:$80 Corequisite(s): MLT125 Prerequisite(s): DEV061orCPE control. thrombocytes; determinationofredbloodcellindices.Quality and principlesofcountingerythrocytes,leukocytes and Manual andautomatedhematologyinstrumentationtechniques MLT 126HematologyILaboratory(3) Corequisite(s): MLT126 Prerequisite(s): DEV061orCPE Quality control. of theblood,differentialmorphologyandstainingtechniques. The origin,formationandpurposeoftheformedelements MLT 125HematologyI(3) Lab Fee:$90 Corequisite(s): MLT123 Prerequisite(s): DEV061orCPE sensitivity testing. microscope, media,inoculation,biochemicalactivitiesand Basic microbiologyconcepts.Identificationofbacteriaby MLT 124MedicalMicrobiologyILaboratory(2) Corequisite(s): MLT124 Prerequisite(s): DEV061orCPE processes. biochemical activitiesandsensitivitytesting.Basicdisease Identification ofbacteriabymicroscope,media,inoculation, MLT 123MedicalMicrobiologyI(3) Lab Fee:$30 Corequisite(s): MLT116 Prerequisite(s): DEV061orCPE practice. Quality assuranceandtotalqualitymanagementforlaboratory Up-to-date practicalinstructioninphlebotomyprocedures. MLT 117PhlebotomyLaboratory(2) Corequisite(s): MLT117 Prerequisite(s): DEV061orCPE phlebotomy. QualityAssuranceandTotalManagement. Comprehensive backgroundinthetheoryandprinciplesof MLT 116Phlebotomy(2) Corequisite(s): MLT111 Prerequisite(s): DEV061orCPE alcohols, aldehydes,ketones,andcarbohydrates. bonding, saturatedhydrocarbons,unsaturated solution reactions,atomicstructure,ionicandcovalent molecules andions,formulas,equationsmoles,aqueous Application ofmatterandmeasurementchemistry,atoms, MLT 112ApplicationsofChemistryforTechnicians(1) Liability Fee:$20 Corequisite(s): MLT212 Prerequisite(s): DEV061orCPE antigens andantibodies. of antigen-antibodyreactions,formationandreactions of Principles andtheoriesoftheproductioncharacteristics MLT 211Immunology(3) Certification Fee:$25 Corequisite(s): MLT181 Prerequisite(s): DEV061orCPE presentation ofcasestudy. I. Guestspeakers;currenttopics;qualitycontrol.Student Weekly reviewofproblemsandprogressinDirectedPractice MLT 191SeminarI(3) Certification Fee:$25 Liability Insurance:$20 Corequisite(s): MLT191 Prerequisite(s): DEV061orCPE staff andcollegefaculty. of principlesandtechniquesundersupervisionclinical Clinical siteassignment;departmentalrotationapplication MLT 181DirectedPracticeI(4) Lab Fee:$65 Corequisite(s): MLT135 Prerequisite(s): DEV061orCPE spinal fluidanalysis. Basic techniquesforamniotic,semen,fecal,synovial,and characteristics andmicroscopicanalysisofurinarysediment. Basic urinalysistechniquesincludingphysicalandchemical MLT 136UrinalysisandBodyFluidsLaboratory(2) Corequisite(s): MLT136 Prerequisite(s): DEV061orCPE Body fluids:amniotic,semen,fecal,synovial,spinal. characteristics andmicroscopicanalysisofurinarysediment. Urinalysis principlesincludingphysicalandchemical MLT 135UrinalysisandBodyFluids(2) Lab Fee:$95 Corequisite(s): MLT131 Prerequisite(s): DEV061orCPE toxic substances. blood gases,pH,enzymes,vitamins,hormonesandexogenous lipids, proteins,electrolytes,endogenoustoxicsubstances, Quantitative chemicalanalysisofbodyfluids,carbohydrates, MLT 132ClinicalChemistryLaboratory(3) Corequisite(s): MLT132 Prerequisite(s): DEV061orCPE toxic substances. blood gases,pH,enzymes,vitamins,hormonesandexogenous lipids, proteins,electrolytes,endogenoustoxicsubstances, Course Descriptions 95 (MTH) Mathematics A (1) MTH 101 Technical Mathematics Applications Technology students An applications course for Engineering in the use of scientific to supplement DEV 102. Instruction include: area & calculators, and other technology. Topics figures, metric/ volume, scientific notation and significant graphing English conversions, geometry applications, applications, and vector forces. Prerequisite(s): DEV 101 or CPE 101 Corequisite(s): DEV 102 or CPE 102 Lab Fee: $10 MTH 105 Mathematics and Today’s World (3) A survey of contemporary mathematical ideas and the application of mathematical tools for solving real world problems to demonstrate the variety of problems that can be modeled and solved by quantitative means. Prerequisite(s): DEV 103 or CPE 103 MTH 106 Business Mathematics (3) Development and application of practical business mathematics principles to include: checking accounts, bank reconciliation, percentages and their applications, simple and compound interest, depreciation, markups and markdowns, trade and cash discounts, sales and property taxes, promissory notes, the discounting process, annuities, insurance, loan amortization, and business statistics. Prerequisite(s): DEV 101 or CPE 101 (MST) Multi-Skilled Healthcare MST 181 Nurse Aide Training (6) requirements for Preparation for long-term care meeting training plus 24 nurse aide training in Ohio. Classroom clinical hours at the end of the course. Prerequisite(s): DEV 061 or CPE 061 Lab Fee: $20 Liability Fee: $20 MLT 281 Directed Practice II (4) Directed Practice II MLT 281 application rotation; assignment; departmental Clinical site of clinical under supervision and techniques of principles college faculty. staff and a degree in leading to All prior coursework Prerequisite(s): Technology Medical Laboratory 291 Corequisite(s): MLT $25 Certification Fee: (3) MLT 291 Seminar II and progress in Directed Practice Weekly review of problems and current topics; quality control; II. Guest speakers; of research project. student presentation in prior coursework leading to a degree Prerequisite(s): All Technology Medical Laboratory 281 Corequisite(s): MLT Lab Fee: $25 Certification Fee: $25 MLT 212 Immunology Laboratory (1) Immunology Laboratory MLT 212 flocculation, precipitation, of agglutination, Techniques and EIA. ELISA, immuno-fluorescence, immuno-diffusion, CPE 061 DEV 061 or Prerequisite(s): MLT 211 Corequisite(s): Lab Fee: $95 II (3) MLT 213 Medical Microbiology in agents associated with disease Identification of microbial viruses and parasites. Specimen man including bacteria, Control. collection. Quality 061 or CPE 061 Prerequisite(s): DEV 214 Corequisite(s): MLT II Laboratory (3) MLT 214 Medical Microbiology of identify, and evaluate the presence Techniques to isolate, clinically significant microorganisms. Prerequisite(s): DEV 061 or CPE 061 Corequisite(s): MLT 213 Lab Fee: $90 MLT 223 Hematology II (3) biochemistry Disorders of blood cells and platelets including Principles and of the red blood cell, anemias, leukemias. procedures of coagulation. Prerequisite(s): DEV 061 or CPE 061 Corequisite(s): MLT 224 MLT 224 Hematology II Laboratory (3) techniques used Manual and automated instrumentation counting of within a hematology department. Differential abnormal cells. Coagulation. Prerequisite(s): DEV 061 or CPE 061 Corequisite(s): MLT 223 Lab Fee: $65 MLT 226 Immunohematology (4) Responsibility of blood bank work, blood collection and processing. Genotypes and phenotypes of ABO and Rh blood group systems. Prerequisite(s): DEV 061 or CPE 061 Corequisite(s): MLT 227 MLT 227 Immuno-hematology Laboratory (4) Typing techniques, principles, procedures; crossmatch and panel screening; atypical antibody identification and quality control. Prerequisite(s): DEV 061 or CPE 061 Corequisite(s): MLT 226 Lab Fee: $95 MLT 270 MLT Review & Update (4) Review and update of: urinalysis, hematology, clinical chemistry, medical microbiology, immunology, immuno-hematology. Prerequisite(s): All coursework leading to an MLT (CLT) degree. 96 Course Descriptions trigonometric functions,solving triangles,lawsofsinesand Familiarizes thestudentwith topics intrigonometry,including MTH 140Trigonometry(3) Prerequisite(s): MTH120or121 permutations, combinations,probability,andvariation. Gauss-Jordan, Cramer’sRule,sequencesandseries, remainder theorem,factormatricesanddeterminants, additional topicsincomplexnumbers,syntheticdivision, Continuation oftheconceptsbeguninMTH121andincludes MTH 122CollegeAlgebraII(3) Prerequisite(s): DEV103or CPE 103 systems ofequationsandinequalities,analyticgeometry. polynomial, andtranscendentalfunctionstheirgraphs; Algebraic expressions;equationsandinequalities;linear, MTH 121CollegeAlgebraI(3) Prerequisite(s): DEV103or CPE 103 more in-classpracticeofimportantskills. in CollegeAlgebraI(MTH121),butthiscoursewillinvolve Note: Topicscoveredareexactlythesameastopics systems ofequationsandinequalities,analyticgeometry. polynomial, andtranscendentalfunctionstheirgraphs; Algebraic expressions;equationsandinequalities;linear, MTH 120CollegeAlgebraIA(5) Prerequisite(s): DEV103orCPE103. graphing calculator. expected value.Useofaspreadsheetprogramand/or Basic probabilityandstatistics,simulation,sampling, analysis andevaluation.Ratesofchangepercentages. disciplines. Datacollection,organization,display,interpretation, reasoning achievedbyexploringrealworlddatafromvarious Discovery offundamentalconceptsandskillsquantitative MTH 110QuantitativeReasoning(4) Lab Fee:$10 Corequisite(s): MTH140 Prerequisite(s): MTH120OR121AND107 coordinates, andtrigonometricidentities. radian measure,trigonometricfunctions,vectors,polar other technology.Topicsinclude:appliedproblemsinvolving to supplementMTH140.Useofthescientificcalculatorand An applicationscourseforEngineeringTechnologystudents MTH 108TechnicalMathematicsApplicationsC(1) Lab Fee:$10 Corequisite(s): MTH120or121 Prerequisite(s): DEV102orCPE102,MTH101 of linearandquadraticfunctions,useconicsections. geometry applications,graphingapplications.Applications notation andsignificantfigures,appliedfunctionalnotation, calculators andothertechnology.Topicsinclude:scientific to supplementMTH121.Instructionintheuseofscientific An applicationscourseforEngineeringTechnologystudents MTH 107TechnicalMathematicsApplicationsB(1) Prerequisite(s): MTH222 transformations, eigenvalues,eigenvectors,vectorspaces. Linear systems,matrices,matrixalgebra,determinants,linear MTH 240LinearAlgebra(3) Prerequisite(s): MTH223 solutions, applicationsofdifferentialequations. solutions, Laplacetransforms,uniquenessandexistence of First orderequations,linearequationsandsystems,series MTH 230DifferentialEquations(5) Prerequisite(s): MTH223 topics. Theorem, Green’sandapplicationsoftheabove functions, partialderivatives,multipleintegrals,Stoke’s Vector valuedfunctions,cylindricalandsphericalcoordinate MTH 224CalculusIV/Multivariate(5) Prerequisite(s): MTH222 conic sections. polar curves,coordinates,vectors,rotationofaxes, power series,TaylorMaclaurinbinomial Improper integrals,L’Hopital’sRule,Taylor’sformula, MTH 223CalculusIII(5) Prerequisite(s): MTH221 of integration. exponential functions,trigonometrictechniques of theintegralspolynomialfunctions,logarithmic definite andindefiniteintegrals,Riemannsums,applications Differentiation oflogarithmicandexponentialfunctions, MTH 222CalculusII(5) Prerequisite(s): MTH122and140 and trigonometricfunctions,applicationsofthederivative. Functions, limits,continuity,differentiationofpolynomial MTH 221CalculusI(5) Prerequisite(s): MTH120or121 and behavioralsciences. appropriate tobiology,medicine,business,economics,social and logarithmicfunctions;maximaminima;applications and logarithmicfunctions;integralsofpolynomial,exponential, Functions; limits;derivativesofpolynomial,exponential, Sciences (5) MTH 220CalculusfortheManagement,LifeandSocial MTH 121 Prerequisite(s): HighschoolgeometryandMTH120or polar coordinates,identities,andtrigonometricequations. cosines, unitcircles,vectors,graphsoftrigonometricfunctions, Prerequisite: DEV061orCPE 061 with listeningexamplesand liveperformances. onward. Chronologicalpresentation ofmaterialsupplemented Survey ofWesternmusic from approximatelyA.D.1500 MUS 130MusicAppreciation (3) (MUS) Music Course Descriptions 97 NTK 202 Cisco Associate II (5) NTK 202 Discussion and theory. of network router concepts Overview and transport-layer protocols, elements, TCP/IP of router setup, with router Hands-on experience flow control. part of a set This course is and monitoring. configuration, material for the CCNA and Network+ of courses that cover certification exams. 201 or instructor permission Prerequisite(s): NTK Lab Fee: $50 III (5) NTK 203 Cisco Associate and routing and switching concepts Advanced network of IPX protocol, LAN segmentation, theory. Discussion and Ethernet, Fast Ethernet, bridges, routers, switches, experience with advanced router virtual LANS. Hands-on of This course is part of a set setup and configuration. and Network+ courses that cover material for the CCNA certification exams. permission Prerequisite(s): NTK 202 or instructor Lab Fee: $50 NTK 221 Information Security I (5) security concepts. Overview of computer/information of security Assessment, development, and implementation security tools and policies. Review of information/network resources. permission Prerequisite(s): NTK 152 or instructor Lab Fee: $50 NTK 222 Information Security II (5) topics, including Advanced discussion of information security technologies, TCP/IP routing protocols, internetworking and others. Hands- cryptology, firewalls, VPNs, encryption, on use/review of computer security software. Prerequisite(s): NTK 221 Lab Fee: $50 NTK 240 Unix/Linux Administration I (5) Discussion of the Unix/Linux file system. Maintenance tasks, customizing the GUI interface, Linux commands. File access permissions, printing commands and utilities. Managing user accounts. Prerequisite(s): NTK 176 Lab Fee: $50 NTK 250 Novell NetWare Administration (5) Hands-on experience with Novell Netware operating system. Fundamental network management tasks, setting up user accounts, managing the network file system, creating login scripts, managing NDS security, setting up and managing print services. This course covers Certified Novell Administrator (CNA) certification requirements. Prerequisite(s): NTK 176 or instructor permission Lab Fee: $50 NTK 251 Advanced Novell NetWare Administration (5) Knowledge and skills needed to configure, design, and administer a complex NetWare network. Advanced Novell (NTK) Network Administration NTK 152 Internet Technologies (5) Internet, Intranet and Introductory technical knowledge of Internet clients, Extranet technologies. Internet basics, business concepts. development, networking, security and File Transfer Protocol Basics of Domain Name Service (DNS), Covers CompTIA’s (FTP), Hypertext Transfer Protocol (HTTP). i-Net+certification requirements. level equivalent to Prerequisite(s): Computer knowledge ITS 080, DEV 061 or CPE 061 Lab Fee: $50 NTK 176 PC/Network Essentials I (6) upgrading, Basic knowledge for properly installing, configuring, hardware. Coverage and troubleshooting microcomputer basic networking, and includes desktop and server systems, that covers A+ and printers. First of a two-course sequence Server+ certification objectives. Prerequisite(s): DEV 061 or CPE 061 Lab Fee: $50 NTK 178 PC/Network Essentials II (6) Intensive introduction to multitasking operating systems and networking operating systems. Coverage includes: operating system upgrades/configuration, installation procedures, security issues, backup procedures, remote access, command line and graphical user interfaces. Second course in a two-course sequence that covers the A+ and Server+ certification objectives. Prerequisite(s): NTK 176 Lab Fee: $50 NTK 201 Cisco Associate I (5) Overview of computer networking concepts, theories, and structures. Discussion of the OSI network model, network addressing, data encapsulation, and TCP/IP network-layer protocols. This course is part of a set of courses that cover material for the CCNA and Network+ certification exams. Prerequisite(s): NTK 152 or instructor permission Lab Fee: $50 MUS 150 Clark State Chorale (1) Clark State Chorale MUS 150 of the study and performance specializing in Mixed choir theatre, periods, musical of a variety of stylistic choral works May performances required. School and public and jazz. up to 6 credit hours. be repeated Lab Fee: $15 (1) MUS 160 Applied Voice of focusing on the fundamentals Private voice instruction literature, interpretation and performance voice production, song skills. Lab Fee: $50 (1) MUS 170 Applied Piano of focusing on the fundamentals Private piano instruction skills. piano performance Lab Fee: $50 98 Course Descriptions resources, networkinfrastructure, remoteaccess,Active Configuring, managing,securing, andtroubleshootingweb NTK 279ManagingaMicrosoft NetworkEnvironment(5) Lab Fee:$50 Prerequisite(s): NTK270orinstructorpermission Course coversMicrosoftcertificationobjectives. access toresources,auditing,authentication,andencryption. a securitysolutionthatmeetsbusinessrequirements.Controlling Analysis ofbusinessrequirementsforsecurityanddesigning NTK 278DesigningMicrosoftSecurity(5) Lab Fee:$50 Corequisite(s): NTK272(maybetakenasaprerequisite) Prerequisite(s): NTK270orinstructorpermission Course coversMicrosoftcertificationrequirements. Connectivity betweenandwithinsystemsdatareplication. directory servicearchitectureusingActiveDirectory. Analysis ofbusinessrequirementsandthedesigna NTK 277DesigningMicrosoftDirectoryServicesInfrastructure(5) Lab Fee:$50 Corequisite(s): NTK272(maybetakenasaprerequisite) Prerequisite(s): NTK270orinstructorpermission Course coversMicrosoftcertificationobjectives. of ActiveDirectory.Backingupandrestoring Installing, configuring,andtroubleshootingthecomponents NTK 276AdministeringMicrosoftDirectoryServices(5) Lab Fee:$50 Prerequisite(s): NTK270orinstructorpermission covers Microsoftcertificationobjectives. IP Routing,andWINSinanetworkinfrastructure.Course troubleshooting DNS,DHCP,RemoteAccess,NetworkProtocols, Installing, managing,monitoring,configuring,and NTK 274AdministeringMicrosoftNetworkInfrastructure(5) Lab Fee:$50 Prerequisite(s): NTK270orinstructorpermission certification objectives. optimizing andtroubleshooting.CoursecoversMicrosoft operating system.Planning,installing,configuring,managing, Hands-on experiencewithserver NTK 272AdministeringMicrosoftServer(5) Lab Fee:$50 Prerequisite(s): NTK176orinstructorpermission Course coversMicrosoftcertificationobjectives. system. Installing,configuring,optimizingandtroubleshooting. Hands-on experiencewiththeXPProfessionaloperating NTK 270AdministeringMicrosoftProfessional(5) Lab Fee:$50 Prerequisite(s): NTK250 certification requirements. and restore.CoversCertifiedNetWareEngineer(CNE) infrastructure. ManageandoptimizeNetwarebackup NetWare skills.BuildaTCP/IPnetwork.anInternet Prerequisite(s): ENG112OR135;ITS200 quarter priortograduation. and writtenpresentation.Courseshouldbetakeninthelast students throughproject-basedactivities.Requiresanoral Assessment ofskillsandcompetenciesNetworkAdministration Overview ofethicsintheinformationtechnologyfield. NTK 288AdvancedNetworkingTopics(5) Lab Fee:$50 Corequisite(s): NTK270(maybetakenasaprerequisite) Prerequisite(s): NTK176 certification objectives. Directory, clientandservercomputers.CoversMicrosoft systems. Examinesethical and legalissuesastheyapply. musculo-skeletal, gastrointestinal, endocrineandcardiovascular with variouscommonhealthproblems affectingtherespiratory, Applies thenursingprocess in caringforthechildandadult NUR 173NursingTransition(8) Lab Fee:$60 Corequisite(s): BIO123 Prerequisite(s): BIO122,NUR171 settings. the applicationofethical/legalissues.Collegeandlaboratory stroke), diabetesmellitus,andrespiratorysystem.Examines common problemsofthecardiovascularsystem(including and diettherapyincaringforthechildadultwith Applies conceptsfromNursingIandII.Integratespharmacology NUR 172NursingIII(8) Lab Fee:$70 Corequisite(s): BIO122 NUR 170 Prerequisite(s): BIO102,121,ITS103,NUR114, laboratory settings. the applicationofethical/legalissues.Collegeandhospital problems affectinggastrointestinalfunctioning.Examines surgery, commonproblemsaffectingmobilityand and diettherapyincaringforthechildadultwith Apply conceptsfromNursingI.IntegratesPharmacology NUR 171NursingII(6) Liability Insurance:$20 Lab Fee:$69 Corequisite(s): BIO102,121,ITS103,NUR114 Prerequisite(s): MST181withinpasttwoyearsorequivalent. process incollegeandhospitallaboratorysettings of health.Introductiontopharmacology.Introducesnursing techniques. Roleofnursinginmaintenanceandpromotion Introduction ofconceptsbasictonursing.Basicassessment NUR 170NursingI(6) Prerequisite(s): DEV 091orCPE091,101CPE101 Systems ofmeasurementandcalculationdrugdosage. NUR 114DosageCalculationsI(1) (NUR) Nursing Course Descriptions 99 (OAD) Office Administration OAD 101 Document Formatting (5) reports, Introduction to formatting business correspondence, with emphasis and tables utilizing word processing software on speed and accuracy. Prerequisite(s): Ability to key the alphabetic and numeric keys by touch using appropriate techniques at a rate of at least 20 WPM, DEV 061 or CPE 061. OAD 102 Document Production (5) Mastery of producing business correspondence, tables, reports, and administrative and employment documents utilizing word processing software. Introduction to desktop publishing. Emphasis on speed and accuracy. Prerequisite(s): OAD 101 OAD 103 Integrated Office Applications (4) Production of business documents utilizing integrated software applications. Prerequisite(s): OAD 102 OAD 105 Business English (4) A basic business English course covering the following: punctuation, sentence structure, capitalization, number usage, and possessives. Prerequisite(s): DEV 061 or CPE 061 and community resources in the prevention and treatment the prevention and resources in and community disorders. emotional and behavioral of common NUR 173, 131, NUR 172 or BIO 123, BIO Prerequisite(s): PSY 230 NUR 274 Corequisite(s): Lab Fee: $13 or only once either in NUR 275 Liability Fee: $20 (charged comes first) NUR 276, whichever (11) NUR 276 Nursing VI presented in Level I (NUR 170, 171, Expands on concepts age Provides care to clients of various 172 or NUR 173). problems affecting hematologic, cellular, groups with common and genitourinary functions. Addresses sensory, neurologic of clients with altered cardiovascular complex nursing care to Utilizes the nursing process and respiratory function. making. Hospital emphasize priority setting and decision and community clinical settings. 172 or NUR 173, Prerequisite(s): BIO 123, BIO 131, NUR PSY 221, Lab Fee: $60 either in NUR 275 or Liability Fee: $20 (charged only once NUR 276, whichever comes first) NUR 280 Nursing Seminar (2) final quarter’s clinical Reflection, analysis, and sharing of the and group learning experiences. Structured individual of critical thinking program review activities. Application problems. skills to solve a variety of nursing care NUR 269 Prerequisite(s): NUR 267, NUR 268, Lab Fee: $45 Role transition from LPN to RN integrated into clinical to RN integrated from LPN Role transition laboratory settings. College and hospital practice. 103, NUR 114 BIO 122, ITS Prerequisite(s): BIO 123 Corequisite(s): $43 Lab Fee: $20 Liability Insurance: (4) NUR 267 Nursing VII nursing process when caring for clients Application of the facility. Emphasis placed on endocrine in the extended care nursing; management concepts; and liver disorders; gerontologic systems; and ethical, legal, and professional health care delivery practice issues. 274, NUR 275, NUR 276 Prerequisite(s): NUR 268, NUR 269 Corequisite(s): NUR NUR 268 Nursing VIII (3) to meet the needs of Application of the nursing process community settings. clients of various ages in acute and and development Emphasizes health promotion and growth care concepts, of the young and middle age adult, emergency and immunologic care of adult clients with gynecologic, breast, cardiac and neurologic disorders, and children with congenital professional practice disorders. Examines ethical, legal, and issues as they apply. NUR 276 Prerequisite(s): NUR 274, NUR 275, Corequisite(s): NUR 267, NUR 269 NUR 269 Nursing IX (6) cardiovascular, Addresses nursing care of clients with complex Examines ethical, neurologic, and multi-system disorders. issues as legal, and professional practice and development process in an acute they apply. Application of the nursing the nursing care care preceptorship to provide and manage care problems. of groups of clients with common health NUR 276 Prerequisite(s): NUR 274, NUR 275, Corequisite(s): NUR 267, NUR 268 NUR 274 Nursing IV (5) Family-centered approach to meeting the needs of mother and newborn; application of the nursing process; the normal physiological changes of pregnancy with emphasis on the prevention of complications and conditions of high-risk newborn; experience in the hospital and community setting. Prerequisite(s): BIO 123, BIO 131, NUR 172 or NUR 173, PSY 221 Corequisite(s): NUR 275 Lab Fee: $15 NUR 275 Nursing V (5) Application of the nursing process in meeting the mental health needs of clients and individuals. Utilization of therapeutic communication techniques, psychiatric treatment modalities 100 Course Descriptions Prerequisite(s): OAD248 x-ray reports,clinicalresumes,consultantetc. Machine transcriptionandproductionofpatients’casehistories, OAD 249AdvancedMedicalMachineTranscription(4) Corequisite(s): BIO102 Prerequisite(s): OAD101,130 medical documents. Introduction tomachinetranscriptionandproduction of OAD 248BasicMedicalMachineTranscription(4) Prerequisite(s): OAD245orinstructorpermission special projects,etc.,ofincreaseddifficulty. of letters,memos,agendas,newsreleases,speeches,minutes, Machine transcriptionandproductionofmailabletranscripts OAD 246AdvancedMachineTranscription(4) Prerequisite(s): OAD101,130;orinstructorpermission speeches, minutes,specialprojects,etc. mailable transcriptsofletters,memos,agendas,newsreleases, Introduction tomachinetranscriptionandproductionof OAD 245MachineTranscription(4) Prerequisite(s): DEV061orCPE communicating withofficeemployees. and design;systemsanalysis;motivating,supervising, Basic conceptsofofficemanagement,organizationstructure, OAD 200AdministrativeOfficeManagement(3) Prerequisite(s): DEV061orCPE well asrecordscontrol,retrieval,andmanagement. alphabetic, geographic,numeric,andsubjectmethodsas Basic principlesandproceduresofrecordsstorage,including OAD 140RecordsManagement(3) Prerequisite(s): OAD130orinstructorpermission meetings andconferences,telephonetechniques. greeting visitors,makingtravelarrangements,planning management, processingmail,schedulingappointments, Basic officeskillsincludingcommunicatingeffectively,time OAD 135OfficeProcedures(4) Prerequisite(s): OAD105orinstructorpermission skills. Mastery ofgrammarandpunctuationconceptsproofreading OAD 130AdvancedGrammar&Proofreading(4) Prerequisite(s): DEV061orCPE spelling rules. Prefixes, suffixes,andtroublesomewordendingsaswell Techniques forusingthedictionaryandlibrarysources. OAD 125Vocabulary/ReferenceUse(2) or OAD256,approvedco-opplacement Prerequisite(s): EBE100,OAD246or249,260 establishing learningoutcomes,andpreparingrelatedreports. principles andtheorieslearnedinclassroomexperiences, familiar withanofficeormedicalcareer,applying Relating academicstudiestotheworldofwork,becoming OAD 285Co-opEducationI(2) Lab Fee:$35 Prerequisite(s): BIO102,105 coding systemsdiscussed. of relatedskillswithaccuracyandcompleteness.Other information. Laboratoryexperienceemphasizingapplication and indexingsystemsinICD-9-CMutilizedcodingmedical Introduction tothenomenclatureandmajorclassification OAD 272ICD-9-CMCoding(5) Lab Fee:$35 Prerequisite(s): BIO102,105 completeness. emphasis onapplicationofrelatedskillswithaccuracyand emphasizing CPT-4coding.Laboratoryexperiencewith Introduction toambulatorycodingandpaymentsystems OAD 270CPT-Coding(5) Corequisite(s): ITS12P 103, OAD135,140 Prerequisite(s): ENG221,ITS12D,12S,101,OAD and otherrelatedadministrativeabilities. making, organizingandplanningwork,meetingdeadlines, variety ofsituationsdemandingjudgment,initiative,decision- project-centered approachexposingthestudenttoawide skills necessarytoperformthedutiesinamodernoffice.A A comprehensivecoursemakinguseofallknowledgeand OAD 260OfficeSimulation(5) Lab Fee:$10 BIO 102 Prerequisite(s): OAD103,135,140,248, microcomputer. the useofamedicalmanagementsoftwarepackageon Development oftechniquesforacquiringadvancedskillsin OAD 256MedicalOfficeManagement(4) additional cost. used inKenpoandAikijitsu. Beltrankinkarateoptionalat control ofhostilesituations.History,philosophyanddiscipline Punching andkickingdrills,takedown,self-discipline and PED 104BeginningKarate(1) and benefits. cool downexercises.Knowledgeofsafefitnesstechniques Warm-up exercises,strengthandflexibility and PED 101StepAerobics(1) (PED) PhysicalEducation Course Descriptions 101 PGR 153 College Survival Skills (3) College Survival Skills PGR 153 A reading, successful student. of becoming a Fundamentals lessen the designed to study skills course writing, and college students. new or returning anxiety of $8 Lab Fee: Speed and Comprehension (3) PGR 154 Reading for both reading speed and comprehension, This course improves of average or above average reading is intended for students variety of methods, including computer- abilities, and uses a aided instruction. 061 or CPE 061 Prerequisite(s): DEV (1) PGR 191 Study Skills to to offer students the opportunity This course is designed in problem solving. The process foster self-confidence skills required includes: a self-assessment of certain personal of need for change, for success in college, a determination facilitate a successful and the development of a goal to outcome. Graded S/U. Lab Fee: $8 PGR 192 Career Directions (1) and exploration of Overview of career choice processes making. Includes: career alternatives and career decision decision making, researching career information, career sharing, and reviewing occupational options, information educational planning. Graded S/U. Lab Fee: $8 PGR 194 Stress Management (1) daily life. Individual Identify stressors and manage stress in techniques stress assessment, cognitive-affective-physical stress in the workplace, for stress management, stress in society, resources. health and stress, and personal and community Graded S/U. PGR 195 Campus Leadership (1) Practical approach to student leadership situations to increase technical skills involved in campus organizations. Graded S/U. PGR 196 Effective Parenting (1) Information and skills to meet the difficult challenges of raising children. Includes: discipline, communication, problem-solving, and encouragement. Graded S/U. PGR 197 Building Positive Personal Relationships (1) Information and skills that help create positive and successful personal relationships, as well as those qualities that make personal relationships endure. Graded S/U. PGR 250 Exploring Our Sexualities (3) Analysis of the impact of social and cultural values and norms on human sexuality. Prerequisite(s): ENG 111 required, ENG 112 recommended Corequisite(s): ENG 112 PGR 150 Personal Growth (3) Designed to provide students with an opportunity to examine themselves—their abilities, attitudes, interests, learning styles, personality traits, and values to improve self-awareness and self-confidence. (PGR) Personal Growth PED 105 Intermediate Karate (1) Karate PED 105 Intermediate trapping techniques, hand level kicks, hand Intermediate Belt martial arts background. Knowledge of and escapes. cost. optional at additional rank in karate determined experience as PED 104 or equivalent Prerequisite(s): by instructor Weight Training (1) PED 117 Beginning of procedures, proper handling Correct weight training principles, composition of an individual equipment, training and dietary effects. total workout program Weight Training (1) PED 118 Intermediate a of free weight training. Setting up Intermediate level Safety and nutrition information. personal program. 117 Prerequisite(s): PED PED 144 Beginning Tennis (1) serving, and Forehand drive, backhand drive, volleying, simple strategies footwork. History, rules, terms, scoring, and the etiquette of tennis. PED 145 Intermediate Tennis (1) shots and serving. Advanced skills in forehand, backhand game, drop and chop Approach shots, net play, backhand tennis etiquette. shots. Advanced rules, strategies, and (1) PED 151 General Physical Conditioning warm-up/ Principles and benefits of physical conditioning, exercises (walking, stretching exercises, aerobic and strength weight training), jogging, rope skipping, stationary biking, flexibility exercises, and cool down exercises. PED 153 Yoga I (1) and relaxation Reducing stress through focused breathing Graded S/U. exercises using meditation techniques. PED 154 Yoga II (1) Using Yoga and meditation techniques to reduce stress. Prerequisite(s): PED 153 Yoga for beginners PED 171 Beginning Golf (1) Driving, putting, chipping and pitching along with fair play. Also includes the history, equipment, rules, terms, scoring, and etiquette of golf. Lab Fee: $12 PED 172 Intermediate Golf (1) Refining basic strokes, practice techniques, the mental side of golf, course management, advanced short game instruction, and bunker play. Additional history and etiquette. Lab Fee: $12 102 Course Descriptions Brahaman, Dao,andtheVoid; groundsforbeliefanddisbelief; include: theconceptsandexistence ofreligiousreality:God, Daoism, Judaism,Christianity, andIslam.Topicsmay religions including:Hinduism,Buddhism,Confucianism, Philosophical analysisofthebasicbeliefsmajorworld PHL 240PhilosophyofWorldReligions(3) Corequisite(s): ENG112 Prerequisite(s): ENG111 biological knowledgeandpractice. how moralvaluesaffect,andareaffectedby,medical and with humansubjectsandethicsofcloning.Discussion of as abortion,patients’rights,euthanasia,andexperimentation the moralproblemsarisingfrommodernmedicalcaresuch Application ofphilosophicalanalysisandethicaltheoriesto PHL 230MedicalEthics(3) Corequisite(s): ENG112 Prerequisite(s): ENG111 affected by,businessinstitutionsandpractices. technology. Discussionofhowmoralvaluesaffect,andare to theenvironment,andmoraldimensionofinformation morality ofadvertising,drugtesting,business’sresponsibility as themoralityofcapitalism,corporateresponsibility, the moralproblemsarisingfromworldofbusinesssuch Application ofphilosophicalanalysisandethicaltheoriesto PHL 220BusinessEthics(3) Corequisite(s): ENG112 Prerequisite(s): ENG111 a methodforapproachingmoralconcerns. racism, sexism,andeconomicexploitationinordertodevelop moral problemssuchascapitalpunishment,abortion,euthanasia, various cultures.Applicationofthesetheoriestocontemporary from variouscultures.Applicationofthesetheories Philosophical analysisofthepredominantethicaltheories PHL 210Ethics(3) Corequisite(s): ENG111 Prerequisite(s): DEV071orCPE and evaluatebasicinductivedeductivearguments. and Venndiagrams.Thestudentlearnstoidentify,analyze, belief, andtruth;formalinformalfallacies;truthtables the elementsofcriticalthinking;natureknowledge, Methods fordetermininggoodreasoning.Topicswillinclude PHL 200PracticalLogic(3) Corequisite(s): ENG111 CPE 071 Prerequisite(s): DEV061orCPE061,and071 of knowledge,andthenaturemoralvalue. concerning thenatureofreality,God,humannature,sources survey ofproblemsfromvariousphilosophicalperspectives Introduction tovariousmethodsofdoingphilosophy.A PHL 110ProblemsinPhilosophy(3) (PHL) Philosophy Corequisite(s): PHO122 Prerequisite(s): PHO124,CRJ 118 business professionals. to performfunctionsofthatbusiness.Supervision by Includes assignmenttophotographicbusinessestablishment PHO 180PhotographyPracticum(3) Prerequisite(s): PHO112,121 made byprocessingandprintingofcolormaterials. portfolio. Allmaterialwillbereviewedandcorrections Selection andpresentationofphotographsforyourpersonal PHO 124PhotographyPortfolio(4) Lab Fee:$25 Prerequisite(s): PHO121 presented asacolorslidepresentation. will beprocessedandscannedintodigitalformat upon 35mmformatphotography.Colornegativematerials A continuationofColorPhotographyI.Emphasisplaced PHO 122ColorPhotographyII(4) Lab Fee:$25 Prerequisite(s): PHO111 and printing. positive films,andthefundamentalsofcolordeveloping An introductorycourseusing35mmcameras,colornegative/ PHO 121ColorPhotographyI(3) Lab Fee:$25 Prerequisite(s): PHO111 darkroom. as atool.Requireduseofmedium-formatcameraand Continuation ofPhotographyI.Emphasisonphotography PHO 112PhotographyII(3) Lab Fee:$25 Prerequisite(s): DEV 061or CPE 061 photography andtheblackwhitedarkroom. An introductorycourseinthefundamentalsof35mm PHO 111PhotographyI(3) (PHO) Photography Corequisite(s): ENG112 Prerequisite(s): ENG111 Hume, Kant,Russell,Sartre,andWittgenstein. written bysuchphilosophersasPlato,Aquinas,Descartes, tradition: ancient/medieval,modern,andcontemporary each ofthethreeperiodsWesternphilosophical Critical investigationofselectedgreatbookschosenfrom PHL 250GreatBooks:Philosophy(3) Corequisite(s): ENG112 Prerequisite(s): ENG111 reincarnation. miracles; theproblemsofevil;resurrection;karma;and science andreligion;revelationfaith;religiouslanguage; Course Descriptions 103 (PLS) Political Science (3) PLS 110 American National Government government, focusing Basic concepts and structure of national rights and liberties, on checks and balances, federalism, civil media, political political parties, elections, interest groups, institutions, and public policy. and DEV 071 or Prerequisite(s): DEV 061 or CPE 061 CPE 071 Corequisite(s): ENG 111 PLS 120 American Issues (3) Exploration of political and social issues in Government. Historical documents reveal the dynamics of living in America. Prerequisite(s): DEV 061 or CPE 061 and DEV 071 or CPE 071 Corequisite(s): ENG 111 PLS 130 Political Issues (3) Nature and uses of political power in contemporary life, focusing on power relationships in public issues, such as crime and violence; poverty; ecology; budget choices; federalism; racism and sexism; urban affairs; defense and arms control; and ideological conflicts. Prerequisite(s): DEV 061 or CPE 061 and DEV 071 or CPE 071 Corequisite(s): ENG 111 PLS 220 Constitutional Law (3) A broad understanding of the American Federal Constitution dealing largely with civil rights, voting rights, and basic freedoms as drawn from the first and fourteenth amendments. Prerequisite(s): ENG 111 Corequisite(s): ENG 112 PHY 250 General Physics I (6) PHY 250 work and kinetics, dynamics, of statics, The fundamentals and fluids. oscillations, gravity, rotation, energy, momentum, phenomena. physical of calculus in interpreting Introduction PHY 111 PHY 110 or Prerequisite(s): 111 and MTH 221 Corequisite(s): ENG Lab Fee: $15 II (5) PHY 251 General Physics Physics I covering electrostatics, Continuation of General magnetism, electromagnetic waves, capacitance, DC circuits, Use of calculus in interpreting physical and AC circuits. phenomena. 250 Prerequisite(s): PHY 222 and ENG 112 Corequisite(s): MTH Lab Fee: $15 PHY 252 General Physics III (5) wave motion, Continuation of General Physics II covering electromagnetic heat, laws of thermodynamics, kinetic theory, and diffraction. waves, geometrical optics, interference, phenomena. Use of calculus in interpreting physical Prerequisite(s): PHY 251 Corequisite(s): MTH 223 Lab Fee: $15 (PHY) Physics Problem Methods and Fundamentals of Scientific PHY 105 Solving (3) length, area appropriate to and use of units Measurement development Unit conversions, mass and density. and volume, from laboratory situations, of mathematical relationships and experimental design, process manipulation of variables method). of science (scientific 101 or CPE 101, DEV 061 or CPE 061, Prerequisite(s): DEV 071 and DEV 071 or CPE 111 Corequisite(s): ENG Lab Fee: $15 of Physics (5) PHY 110 Fundamentals for students with no previous physics Concepts in physics Scientific method, systems of units, or science background. heat, sound, electricity, vectors, mechanics, properties of matter, computer- and light. Laboratory component incorporates assisted data gathering and analysis. DEV 061 or CPE 061, Prerequisite(s): DEV 101 or CPE 101, and DEV 071 or CPE 071 Corequisite(s): ENG 111 Lab Fee: $15 PHY 111 Physics I (4) energy, and power; Mechanics; accelerated motion; work, static equilibrium; conservation of energy and momentum; and strain. mechanical properties of matter, stress, PHY 110. MTH 121, Prerequisite(s): ENT 101, MTH 120 or Corequisite(s): ENG 111 and MTH 140 Lab Fee: $15 PHY 112 Physics II (4) mechanics; elasticity, Fluids, waves, heat, and optics; fluid thermal effects, harmonic motion and waves; temperature, reflection, gas laws, heat transfer, and basic thermodynamics; topics in modern refraction, mirrors, and lenses; selected physics. Prerequisite(s): MTH 140, PHY 111 Corequisite(s): ENG 111 Lab Fee: $15 PHY 113 Physics III (4) Electricity and magnetism; electrostatics, charge, and potential; direct current circuits; Ohm’s law, electromotive forces, series and parallel circuits; capacitance; electromagnetism, magnetic forces, induced currents; alternating currents. MTH 140, PHY 112 Prerequisite(s): Corequisite(s): ENG 111 Lab Fee: $15 PHY 120 Astronomy (4) An introduction to Astronomy; astronomical terminology, origins and composition of our universe and solar system, planetary features, and the quest to find other life forms in our universe. Prerequisite(s): DEV 061 or CPE 061, DEV 071 or CPE 071 Corequisite(s): ENG 111 104 Course Descriptions Corequisite(s): ENG112 Prerequisite(s): ENG111 peace-keeping andcurrentissues. state andnonactors,conflictroots,approachesto Introduction totheinternationalpoliticalsystemincluding PLS 230InternationalPolitics(3) Corequisite(s): ENG111 CPE 071 Prerequisite(s): DEV061 or CPE061andDEV071 awareness andprofessional behavior. interpersonal communication skills,culturaldiversity,disability systems; teaching-learning principles,introductionto of thePTAandprofessionalorganizations;healthdelivery assistant practice.Legalandethicalaccountability;history Introduction totheroleandscopeofphysicaltherapist PTA 110Survey(3) (PTA) PhysicalTherapistAssistant Corequisite(s): ENG112 Prerequisite(s): PSY111 personality, sexual,brain,andchildhooddisorders. the followingdisorders:anxiety,mood,dissociative,eating, of abnormalbehavior.Includessuicide,schizophrenia,and Includes classifications,diagnoses,causes,andtreatments Overview offactsandtheoriespertainingtoabnormalbehavior. PSY 230AbnormalPsychology(3) Prerequisite(s): PSY221 education electiveforstudentsseekingatechnicaldegree. from earlyadulthoodthrougholdage.Thisisnotageneral Biological, intellectual,social,andpersonalitydevelopment PSY 222HumanGrowthandDevelopmentII(3) Corequisite(s): ENG112 Prerequisite(s): PSY111andENG education electiveforstudentsseekingatechnicaldegree. from conceptionthroughadolescence.Thisisnotageneral Biological, intellectual,social,andpersonalitydevelopment PSY 221HumanGrowthandDevelopmentI(3) Corequisite(s): ENG111 Prerequisite(s): PSY111 education electiveforstudentsseekingtechnicaldegrees. social behaviorandabnormalbehavior.Thisisnotageneral states ofconsciousness,motivationandemotion,stress, of psychologycontinued.Includessensationandperception, An introductiontothefundamentalprinciplesandpractices PSY 112PsychologyII(3) Corequisite(s): ENG111 CPE 071 Prerequisite(s): DEV061orCPEand071 intelligence, language,humandevelopmentandpersonality. factors influencingbehavior,learning,memory,thinking, of psychology.Includestheoriesandmethods,biological An introductiontothefundamentalprinciplesandpractices PSY 111PsychologyI(3) (PSY) Psychology Certification Fee:$32 Lab Fee:$10 Corequisite(s): PTA281,291 Prerequisite(s): PTA146,160,241,PSY221,222 and rehabilitation. and rehabilitation;Introductiontoadultneurologicaldisorders Normal motordevelopment;control;pediatricpathologies PTA 260RehabilitationII(6) Lab Fee:$30 Corequisite(s): PSY222 Prerequisite(s): PTA146,160 integrity andsensation;continuationofdocumentation. and iontophoresis;theoriesofpain;assessmentskin diathermy, andultrasound;TENS,MENS,phonophoresis, Sterile techniquesandwoundcare;E-stim,hydrotherapy, PTA 241ProceduresIII(5) Lab Fee:$10 Corequisite(s): BIO123,ENG112,PSY221,andPTA146 Prerequisite(s): BIO122,230,ENG111,andPTA145 behavioral development. disorders; positioning,transfersandgaittraining.Professional Pathology andrehabilitationfororthopedicmusculoskeletal PTA 160RehabilitationI(6) Lab Fee:$25 Corequisite(s): ENG112andPTA160 Prerequisite(s): BIO122,230, ENG 111,andPTA145 development. genitourinary andrespiratorydisorders.Professionalbehavioral endocrine/metabolic integumentary,gastrointestinal, and PTinterventionforcardiopulmonary,lymphatic,immune, Application ofheatandcold,massagetraction.Pathologies PTA 146ProceduresII(5) Lab Fee:$10 Corequisite(s): BIO122,230,PSY111 PTA 120 Prerequisite(s): BIO102,118,121,PTA110, all joints;introductiontotherapeuticexercise;documentation. Continuation ofgoniometryandmanualmuscletestingfor PTA 145ProceduresI(4) Lab Fee:$10 Corequisite(s): BIO118,ENG111,andPTA110 CPE 071 Prerequisite(s): DEV061orCPEand071 professional behavior. manual muscletesting;verbalandwrittencommunication; body mechanics,vitalsigns,infectioncontrol,goniometry, Introduction andpracticeofbasictherapeuticprocedures: PTA 120IntroductiontoPatientManagement(2) Course Descriptions 105 (RES) Real Estate RES 232 Real Estate Principles (4) Basic course in real estate with focus on Ohio regulations, principles, and practices. Introduction to the nature of real property, rights and interests in land and ownership. Guidelines and operations for the real estate professional. RES 235 Real Estate Law (4) An overview of several basic areas of law relating to the real estate profession. Includes law of contracts, agency, and civil rights. Develops a working knowledge of documents including deeds, mortgages, and listing and purchase agreements. (RCC) Realtime Closed Captioning (RCC) Realtime Closed to the Deaf Community (5) RCC 111 Introduction community. Focus on social, cultural, Overview of the D/deaf Employment opportunities, and educational experiences. to the D/deaf community, and majority local services available misconceptions of the D/deaf community. culture’s myths and 061 or CPE 061 Prerequisite(s): DEV RCC 211 Captioning/CART I (3) which will include Introduction to realtime captioning skills, software, building basic Internet research skills, captioning vocabulary building, dictionaries, dictionary management, studio. and using the Clark State broadcasting Prerequisite(s): RTR 112 RCC 212 Captioning/CART II (3) which include in- Advanced realtime captioning skills, functions of the depth Internet research skills, advanced writing dictionaries, captioning software, building and expanding building, and advanced dictionary management, vocabulary studio. expanded use of the Clark State broadcasting Prerequisite(s): RCC 211 RCC 220 Phonology (2) and phonological Introduction to basic phonetic theory basis of the nature of concepts. Focus on the theoretical English language. sounds and how they are used in the Prerequisite(s): DEV 061 or CPE 061 RCC 245 Business Practices (2) General office procedures for maintaining a broadcast captioning or CART office, including options in data storage methods, indexing and filing of data storage materials, office procedures, laws pertaining to the profession, and professional development in both dress and conduct. Prerequisite(s): RCC 211, RTR 201 PTA 293 Seminar III (2) PTA 293 Seminar project demonstrating including Capstone Various projects skills, assistant knowledge, physical therapist entry level and behaviors. 292 PTA 282, PTA Prerequisite(s): 283 Corequisite(s): PTA Certification Fee: $32 PTA 265 PTA Rehabilitation III (6) Rehabilitation III PTA 265 PTA requiring pathologies and neurological Adult orthopedic therapy; introduction to manual treatment concepts; advanced orthotics prosthetics, neurological rehabilitation; advanced seating. and adaptive 260 Prerequisite(s): PTA 282, PTA 292 Corequisite(s): PTA Lab Fee: $10 Certification Fee: $32 and Issues (2) PTA 270 PTA Trends current trends in practice; health care This course will cover communications; contracts; supervisory/ financing; interpersonal ethical issues. management skills; 120 Prerequisite(s): PTA Certification Fee: $32 PTA 281 Directed Practice I (3) for physical therapist Application of knowledge and skills experiences in assistants at a beginning level; supervised selected agencies. Prerequisite(s): PTA 241 Corequisite(s): PTA 260, PTA 291 Liability Insurance $20 Certification Fee: $32 PTA 282 Directed Practice II (3) the physical therapist Application of knowledge and skills for experiences in assistant at a developing level; supervised selected agencies. 291 Prerequisite(s): PTA 260, PTA 281, PTA PTA 292 Corequisite(s): ENG 223, PTA 265, Certification Fee: $32 PTA 283 Directed Practice III (6) therapist assistant Continuation of application of physical developing to entry knowledge and skills progressing from level; supervised experiences in selected agencies. Prerequisite(s): PTA 282, PTA 292, Corequisite(s): PTA 293 Certification Fee: $32 PTA 291 Seminar I (2) Discussion of clinical situations and problem solving; focus on self-evaluation; understanding the work setting and client, coworker behaviors, related to Directed Practice I; select topics. Prerequisite(s): PTA 241 Corequisite(s): PTA 281 Certification Fee: $32 PTA 292 Seminar II (2) Discussion of clinical situations and problem solving; focus on self-evaluation; understanding the work setting and client/coworker behaviors, related to Directed Practice II; select topics. Prerequisite(s): PTA 281, PTA 291 Corequisite(s): PTA 282 Certification Fee: $32 106 Course Descriptions of realestateinbothprimaryandsecondarymarkets. A studyofrealestatefinanceasitpertainstothefinancing RES 245RealEstateFinance(2) properties. Some aspectsofresidentialandcommercialincomeproducing estate. Primaryfocusonsingle-familyresidentialproperty. Appraisal processandfactorsthatinfluencethevalueofreal methods ofcost,salescomparisonandincomecapitalization. of principles.Techniquesrealestateappraisalusingthe Survey courseofrealestateappraisal.Practicalapplication RES 240RealEstateAppraisal(2) of exhibits;researchandreferences; filingandstoringnotes; state courtsystems;professional responsibilities;marking General judicialreportingprocedures involvingfederaland RJR 245OfficeManagement (3) Corequisite(s): RTR151,152,or153 Prerequisite(s): RJR232 the terminalspeedof200WPM. Jury chargepracticeanddictation.Thecoursespeedgoal is RJR 233JuryChargeIII(3) Corequisite(s): RTR151,152,or153 Prerequisite(s): RJR231 speeds rangingfrom120-180WPM. Jury chargepracticeanddictation.Thecourseencompasses RJR 232JuryChargeII(3) Corequisite(s): RTR151,152,or153 Prerequisite(s): RTR102 from 100-160WPM. Jury chargedictation.Thecourseencompassesspeedsranging RJR 231JuryChargeI(3) Corequisite(s): RTR151,152,or153 Prerequisite(s): RJR212 as establishedinthecoursesyllabus. preparation oftranscriptsrequiringapercentageaccuracy voice dictationatthefinishingspeedof225wpm,with Development ofwritingskillsintwo-voiceandmultiple- RJR 213AdvancedTestimonyIII(3) Corequisite(s): RTR151,152,or153 Prerequisite(s): RJR211 140-200 WPM. dictation. Thecourseencompassesspeedsrangingfrom Development ofwritingskillsintwo-voiceandmulti-voice RJR 212AdvancedTestimonyII(3) Corequisite(s): RTR151,152,or153 Prerequisite(s): RTR112 course encompassesspeedsrangingfrom120-180WPM. Development ofwritingskillsintwo-voicedictation.The RJR 211AdvancedTestimonyI(3) (RJR) RealtimeJudicialReporting Corequisite(s): ENG112 Prerequisite(s): ENG111 of LatinAmerica. institutions, economicdevelopment,literature,andthearts An introductiontotheland,people,history,politics,social RST 280RegionalStudiesofLatinAmerica(3) Corequisite(s): ENG112 Prerequisite(s): ENG111 of Africa. institutions, economicdevelopment,literatureandthearts An introductiontotheland,people,history,politics,social RST 270RegionalStudiesofAfrica(3) Corequisite(s): ENG112 Prerequisite(s): ENG111 heritage ofIndia. institutions, literature,andthephilosophicalreligious An introductiontotheland,people,history,politics,social RST 262RegionalStudiesof North India(3) Corequisite(s): ENG112 Prerequisite(s): ENG111 literature, andphilosophical/religiousinstitutionsofChina. An introductiontotheland,history,socialinstitutions,art, RST 260RegionalStudiesofAsia-China(3) (RST) RegionalStudies Prerequisite(s): RJR211 development indressandconduct. record discussions,certifyingquestions;andprofessional administering theoath,voirdire,parentheticals,off-the- billing; reportingtechniquesincludinginterruptingspeakers, Corequisite(s): RTR151, 152,orRTR153 Prerequisite(s): RTR101 speeds rangingfrom80-140 WPM. on newandfamiliarmaterial.Thecourseencompasses Development ofwritingskillsandreadingnoteswithpractice RTR 102BeginningSpeedBuildingII(3) Corequisite(s): RTR152 Prerequisite(s): RTR100 speeds rangingfrom60-120WPM. on newandfamiliarmaterial.Thecourseencompasses Development ofwritingskillsandreadingnoteswithpractice RTR 101BeginningSpeedBuildingI(4) Prerequisite(s): DEV061orCPE with rapidreadback. Minimum speedof60wpmondictationfamiliarmaterial with emphasisonrapidandaccuratereadingofnotes. of aconflict-freerealtimetheory.Intensivepracticedictation Writing, reading,andtranslatingthespokenwordbymeans RTR 100RealtimeTheory(6) (RTR) RealtimeReporting Course Descriptions 107 RTR 153 Realtime Transcription (3) Transcription RTR 153 Realtime courses that tests from all of speed dictation Transcription a 70-minute within on skill-building procedures are based transcript of student for each test. Comparison timeframe reviewing as a tool for copy of test dictation with hard as spelling, and punctuation as well vocabulary, grammar, to analyze speed growth. 061 or CPE 061 Prerequisite(s): DEV Speed Building I (3) RTR 201 Advanced The course encompasses speeds ranging Literary dictation. from 100-150. 102 Prerequisite(s): RTR 151, RTR 152, or RTR 153 Corequisite(s): RTR Speed Building II (3) RTR 202 Advanced speeds ranging Literary dictation. The course encompasses from 120-160WPM. Prerequisite(s): RTR 201 RTR 153 Corequisite(s): RTR 151, RTR 152, or RTR 203 Advanced Speed Building III (3) goal is the terminal Literary dictation. The course speed speed of 180 wpm. Prerequisite(s): RTR 202 RTR 153 Corequisite(s): RTR 151, RTR 152, or RTR 212 Advanced Testimony II (3) and multi-voice Development of writing skills in two-voice speeds ranging from dictation. The course encompasses 140-200 WPM. Prerequisite(s): RJR 211 RTR 153 Corequisite(s): RTR 151, RTR 152, or RTR 231 Jury Charge I (3) speeds ranging Jury charge dictation. The course encompasses from 100-160 WPM. Prerequisite(s): RTR 102 Corequisite(s): RTR 151, RTR 152 or RTR 153 RTR 280 Realtime Reporting Practice (3) Judicial Reporting practice in both the official and freelance areas, with a minimum of 40 writing hours in each. Broadcast captioning/CART practice with a minimum of 40 hours in the broadcast studio and 40 hours in the classroom, or other approved activity. Prerequisite(s): RJR 212, RJR 232, RJR 245, RTR 202; or RCC 212, RCC 245, RTR 202 RTR 110 Survey/Realtime Reporting (1) Reporting RTR 110 Survey/Realtime of realtime in the field of the careers available An overview the and knowledge required, including the skills reporting, reporting. the ethics of realtime organizations, and professional CPE 061 DEV 061 or Prerequisite(s): I (3) RTR 111 Beginning Testimony in writing question-and-answer dictation Development of skill speeds ranging from 80-140 WPM. with emphasis on 101 Prerequisite(s): RTR 151, RTR 152, or RTR 153 Corequisite(s): RTR II (3) RTR 112 Beginning Testimony in writing testimony dictation with Development of skill ranging from 100-160 wpm. emphasis on speeds 111 Prerequisite(s): RTR or RTR 153 Corequisite(s): RTR 151 or RTR 152 RTR 120 Law and Legal Terminology (2) process with emphasis The judicial system and the legislative applied in civil and on legal and Latin terminology as criminal law. Prerequisite(s): DEV 061 or CPE 061 (1) RTR 141 Beginning Computer Assisted Transcription writers and translation Use of the computer, including computer software, to assist in preparing transcripts. Prerequisite(s): RTR 100 Lab Fee: $10 (5) RTR 142 Advanced Computer Assisted Transcription using computer- Advanced principle of transcript production management, assisted translation software. Includes dictionary shortcuts, indexing, file management, include files, editing and litigation support services. Prerequisite(s): RTR 141 Lab Fee: $10 RTR 151 Realtime Transcription (1) Transcription of speed dictation tests from all courses that are based on skill-building procedures within a 70-minute timeframe for each test. Comparison of student transcript with hard copy of test dictation as a tool for reviewing vocabulary, grammar, spelling, and punctuation as well as to analyze speed growth. Prerequisite(s): DEV 061 or CPE 061 RTR 152 Realtime Transcription (2) Transcription of speed dictation tests from all courses that are based on skill-building procedures within a 70-minute timeframe for each test. Comparison of student transcript with hard copy of test dictation as a tool for reviewing vocabulary, grammar, spelling, and punctuation as well as to analyze speed growth. Prerequisite(s): DEV 061 or CPE 061 108 Course Descriptions Prerequisite(s): SPN111 language; practiceinconversation, reading,andwriting. Further studyofthevocabulary andstructureoftheSpanish SPN 112SpanishII(4) Corequisite(s): ENG111 Prerequisite(s): DEV061orCPE061and071 practice inconversation,reading,andwriting. Study ofthevocabularyandstructureSpanishlanguage; SPN 111SpanishI(4) Prerequisite(s): DEV061orCPE first orsecond-yearSpanishcourse. the studenthascompletedSPN111,112,113oranyother cultures. Maynotbetakenforcredittowardgraduationif the beginninglevel,usingknowledgeofSpanish-speaking Understanding andspeakinginconversationalsettingsat SPN 100ConversationalSpanish(3) (SPN) Spanish Corequisite(s): ENG112 Prerequisite(s): ENG111 women. Native Americans,religiousandregionalminorities focusing onasociologicalexaminationofAfro-Americans, Racial, ethnic,andreligiousdiversityintheUnitedStates, SOC 240RacialandCulturalMinorities(3) Corequisite(s): ENG112 Prerequisite(s): SOC110highlyrecommendedandENG111 and aginginAmerica. and alcohol,crimecriminals,violence,changingfamily, Sociological focusonphysicalhealth,mentaldrugs SOC 230SocialProblems(3) Corequisite(s): ENG112 Prerequisite(s): ENG111 social stratification,economics,religion,thearts,andchange. cultures withfocusonfamilyorganizations,food-getting, The comparingandcontrastingofseveralnon-westernworld SOC 220ComparingCultures(3) Corequisite(s): ENG111 CPE 071 Prerequisite(s): DEV061orCPEand071 family practices. Historical andcrossculturalexaminationofmarriage SOC 140MarriageandtheFamily(3) Corequisite(s): ENG111 CPE 071 Prerequisite(s): DEV061orCPEand071 deviance. framework tostudyculture,socialization,stratification,and Social theory,methodology,andprinciplestoprovidea SOC 110Sociology(3) (SOC) Sociology Lab Fee:$10 Prerequisite(s): STT264 significance. computation ofstatisticalparameters,andanalysis with acomputerlaboratoryexplorationofstatisticalconcepts, and regression,statisticalinference,analysisofvariance; sampling theory,estimation,designofexperiments,correlation Application ofstatisticaltechniquesandmethodology,including STT 265StatisticsII(4) Lab Fee:$10 Prerequisite(s): DEV 061orCPE061,101 compilation ofroutinestatisticalcomputations. production ofcomputer-generateddatapresentations,and laboratory explorationofprobabilisticandstatisticalconcepts, probability distributionsandtestsofhypotheses;witha data relationships,elementaryprobability,randomvariables, including terminology,descriptivestatistics,dataanalysis, Introduction tostatisticaltechniquesandmethodology, STT 264StatisticsI(4) (STT) Statistics Prerequisite(s): SPN113 with practiceinspeakingandwritingthelanguage. Grammar review,reading,anddiscussionofselectedtexts SPN 211SpanishIV(4) Prerequisite(s): SPN112 language; practiceinconversation,reading,andwriting. Further studyofthevocabularyandstructureSpanish SPN 113SpanishIII(4) Prerequisite(s): ENG 111,ITS103,SWK100 theoretical perspectives. groups, organizationsandcommunities.Exposuretodifferential and principlesrelatedtointerventionswithindividuals, model. Creativeproblemsolving,socialworkvalues,ethics Conceptual frameworkofgeneralistsocialworkpractice SWK 121SocialWorkMethodsandProcedures(5) Prerequisite(s): DEV061orCPE and referralprocess. addiction toharmfulsubstances.Identificationofaddictions Physiological, psychologicalandsocioculturaleffectsof SWK 105ChemicalDependencyI(4) Prerequisite(s): DEV061orCPE to makeacommitmentsocialwork. and outgroups.Explorefeelings,beliefs,valuesreadiness work profession.Etiologyofsocialproblemsminorities Historical overviewofsocialwelfarepoliciesand SWK 100IntroductiontoSocialWelfareandWork(4) (SWK) SocialServices Course Descriptions 109 SWK 238 Social Work and Group Work (3) Social Work and Group SWK 238 professional of group work, history and development Overview of theories of group development, factors, stages ethics, curative characteristics. effective leadership of change, of instructor 136 or permission SWK 121, SWK Prerequisite(s): Practicum I (2) SWK 271 Social Services (160) hour placement in local social One hundred and sixty professional supervision, development service agency under work skills, integration of social work of professional social based training, professional social work theories and skill documentation. 121 Prerequisite(s): SWK 291 Corequisite(s): SWK $20 Liability Insurance: SWK 272 Social Service Practicum II (2) 160-hour placement Continuation of SWK 271 with second in local social service agency. Prerequisite(s): SWK 271 Corequisite(s): SWK 292 SWK 273 Social Service Practicum III (2) practicum in Continuation of SWK 272 with third 160-hour local social service agency. Prerequisite(s): SWK 272 Corequisite(s): SWK 293 SWK 291 Social Service Seminar I (2) to introduce and This is the first of three courses designed The course will upgrade social work documentation skills. learning and problem also provide a forum for student shared Class assignments solving involving their practicum placements. and social work will integrate the practicum experience theory in a classroom setting. Prerequisite(s): SWK 121 Corequisite(s): SWK 271 SWK 292 Social Work Seminar II (2) Continuation of SWK 291, documentation skills, social service field tours, agency guest speakers, and student peer support. Prerequisite(s): SWK 291 Corequisite(s): SWK 272 SWK 293 Social Work Seminar III (2) Continuation of SWK 292, documentation skills, employability skills, ethical issues, and student peer support. Prerequisite(s): SWK 292 Corequisite(s): SWK 273 SWK 297 Special Topics (3) Selected topic related to the practice of social work. Focus on topics will be on current trends issues, and social problems facing social workers and other social service professionals. SWK 130 Social Policy and Services (4) Social Policy and Services SWK 130 through policy process to the social welfare Introduction welfare and of social and organization history development and through contemporary Study evolution social work. evaluate policy effectiveness. Analyze and dated policy. population, particularly minorities. Effect of policy on that affect policy. Understand forces ENG 112, permission. SWK 100 or instructor Prerequisite(s): Education (4) SWK 136 Affective for Social Service and Early Childhood This course is designed develop intrapersonal and interpersonal Education majors to The emphasis is on personal growth communication skills. and development 111, ITS 103, SWK 100 or ECE 100 Prerequisite(s): ENG Lab Fee: $10 SWK 205 Chemical Dependency II (4) of addictions. Theories of treatment, recovery and prevention Treatment skills and modalities. of instructor Prerequisite(s): SWK 105 or permission Dependency (3) SWK 215 Special Populations in Chemical on different Impact and treatment of chemical dependency elderly, women, cultures and populations including minorities, infants and children. of instructor Prerequisite(s): SWK 105 or permission MR/DD (3) SWK 220 Social Service to Individuals with mental retardation/ Social work practice serving individuals with social, ethical developmental disabilities (MR/DD). Etiology, training, and life and political issues, services in education, skills. 100 Prerequisite(s): ENG 111, ITS 103, SWK (3) SWK 231 Generalist Practice/Crisis Intervention applied to crisis and Generalist social work practice model short term intervention and problem solving with families and individuals. Prerequisite(s): ENG 111, ITS 103, SWK 100 or permission of instructor SWK 232 Generalist Practice with Family (3) Generalist social work practice model with emphasis on families, social worker role, planning, goal setting and evaluation within a generalist model of intervention. For SWK majors: SWK 100; For ECE majors: Prerequisite(s): ECE 100, SWK 136 SWK 236 Case Management (5) Overview and application of generalist practice skills to perform case management assessment, planning, and implementation with high risk populations. In addition to class attendance, complete the entire case management process with assigned client. Prerequisite(s): SWK 121 or permission of instructor 110 Course Descriptions Prerequisite(s): DEV061or CPE061 6 credithours).Mayberepeated. AA inPerformingArtsorTechnical Theatrestudents.(maximum to allstudents,butmeetsgraduation requirementsonlyfor management. Arrangedaround student’sschedule.Open Lab experienceinperformance, design,production,or THE 152TheatreLaboratoryIII(3) Prerequisite(s): DEV061orCPE 6 credithours).Mayberepeated. AA inPerformingArtsorTechnicalTheatrestudents(maximum to allstudents,butmeetsgraduationrequirementsonly for management. Arrangedaroundstudent’sschedule.Open Lab experienceinperformance,design,production, or THE 151TheatreLaboratoryII(2) Prerequisite(s): DEV061orCPE 6 credithours).Mayberepeated. AA inPerformingArtsorTechnicalTheatrestudents(maximum to allstudentsbutmeetsgraduationrequirementsonlyfor management. Arrangedaroundstudent’sschedule.Open Lab experienceinperformance,design,production,or THE 150TheatreLaboratoryI(1) Prerequisite(s): DEV061orCPE literary, andproductionperspectives. The artofthetheatreexploredthroughhistorical, THE 130IntroductiontoTheatre(3) Lab Fee:$25 Prerequisite(s): DEV061orCPE makeup forthetheatre. Focus onskillsneededtoworkprops,wardrobe,and THE 115Props,Wardrobe,StageMakeup(3) Lab Fee:$20 Prerequisite(s): THE111 installation. of properties,scenepaintingtechniques,specialeffects,and Continuation ofStagecraftIwithspecialemphasisonconstruction THE 112StagecraftII(4) Lab Fee:$20 Prerequisite(s): DEV061orCPE using hands-onexperiencetocomplementlectures. materials, hardware,andbasicapproachestobuildingscenery Focus onmethodsofsceneryconstruction.Coverstools, THE 111StagecraftI(4) Prerequisite(s): DEV061orCPE speech. Basic trainingandpracticeintheactor’suseofvoice THE 107Speech&VoiceforActor(4) Prerequisite(s): DEV061orCPE on bothpoetryandprose. Introduction totheartoforalinterpretationwithemphasis THE 105OralInterpretationofLiterature(3) (THE) Theatre Prerequisite(s): DEV061or CPE061 sales, publicity,andgeneralprocedures ofhousemanagement. Includes organization,personnel,budgets,accounting,ticket Operation ofcollege,community,andprofessionaltheatre. THE 230TheatreManagement(3) Prerequisite(s): THE220 experience. Continuation ofSoundIwithmoreemphasisonhands-on THE 221SoundII(4) Prerequisite(s): DEV061orCPE recording techniquesandoperationofsoundforperformance. indoor andoutdoorstage.Audioequipmentsystems; Theory andpracticesinsoundreinforcementeffectsfor THE 220SoundI(4) Prerequisite(s): THE210 and hands-onexperience. Continuation ofLightingIwithgreateremphasisondesign THE 211LightingII(4) Prerequisite(s): DEV061orCPE Includes electricaltheoryanduseofdimmingsystems. Study ofstagelightingtechniques,practices,andequipment. THE 210LightingI(4) Prerequisite(s): THE203 Acting II,withadditionalemphasisonactingstyles. Continuation ofthestudyactingtechniquesexaminedin THE 204ActingIII(4) Prerequisite(s): THE202 character/role developmentandscoringtechniques. Continuation ofActingI,THE202,withmoreemphasison THE 203ActingII(4) Prerequisite(s): DEV061orCPE enrolled inTHE160. processes usedbytheactor.Notforstudentswhohave Basic trainingandpracticeinvocal,physical,creative THE 202ActingI(4) Prerequisite(s): DEV061orCPE theatre faculty. for childaudiences.Mustberegisteredwiththeconsentof Survey andpracticalapplicationoftheproductionprocess THE 166Children’sTheatreProduction(4) Prerequisite(s): DEV061orCPE scoring. NotforstudentswhoenrollinTHE202and203. script analysis,actingtheory,principlesoftextandcharacter theory taughttoactingstudents.Includesintroduction on acquaintingnon-actingstudentswiththeconceptsand Introduction totheartofactingfornon-major.Focus THE 160ActingfortheNon-major(4) Course Descriptions 111 THE 280 Directing I (4) THE 280 Directing for the techniques of directing to the art and Introduction analysis and script visual story-telling, stage, including actors. working with THE 202 THE 111 or Prerequisite(s): I (3) THE 285 Co-op Education relate studies to the world of work. The opportunity to in technical theater and application Familiarity with a career theories learned in classroom experiences. of the principles and 100 and approved co-op placement Prerequisite(s): EBE II (3) THE 286 Co-op Education Continuation of Co-op Education Valuable work experience. is required. I; an academic project 285 Prerequisite(s): THE THE 287 Co-op Education III (3) of Co-op Education Valuable work experience. Continuation is required. II; a more extensive academic project Prerequisite(s): THE 286 THE 288 Co-op Education IV (1) an extensive Continuation of work experience, including academic project is required. Prerequisite(s): THE 285 THE 289 Co-op Education V (2) an academic Continuation of work experience, including project. Prerequisite(s): THE 285 THE 235 Stage Management (3) Management THE 235 Stage of the stage responsibilities to the duties and Introduction rehearsals preparation for Includes documentation manager. development of organizational and the and performances, successfully to function skills necessary and interpersonal capacity. in a stage management 061 or CPE 061 Prerequisite(s): DEV Design (4) THE 240 Basics of Theatre of stage, lighting, and costume design. Preliminary concepts for presentation and motivation Covers history of theatrical design concepts. 211, THE 221, THE 270, THE 271 Prerequisite(s): THE I (4) THE 270 Theatre History and development of theatrical production Survey of the history Emphasis from the Ancient Greeks through the Renaissance. Representative on play production rather than literature. plays studied. and DEV 071 or Prerequisite(s): DEV 061 or CPE 061 CPE 071 Corequisite(s): ENG 111 THE 271 Theatre History II (4) theatrical production Survey of the history and development of the present. Emphasis from the seventeenth century through Representative on play production rather than literature. plays studied. and DEV 071 or Prerequisite(s): DEV 061 or CPE 061 CPE 071 Corequisite(s): ENG 111 112 Student Services tdn Services Student Clark lr tt omnt College Community State Clark ocre lcmn n uoigsrie,we want to career placementandtutoring services, From ﬁnancialaidandscholarshipopportunities Take advantage ofClarkState’s studentservices! you to experienceallofClarkState State E SMART. GET . Student Services 113 Transfer Students (Ability to Benefit) (Ability to Senior Citizens Program Admissions ProcessAdmissions International Student Admission Adults Who Have Never Attended College Have Never Adults Who The Admissions Office can provide you with addi- provide you with Office can The Admissions Students interested in applying to the College are Students shall be accepted into the College after If you do not have a high school diploma or a GED If you do not have tional information and entrance requirements. and entrance tional information Clark State is authorized under federal law to accept Clark State is authorized under federal The Admis- non-immigrant (F-1 visa type) students. sions concerning Office can provide you with materials international students. you may enroll in If you are over 60 years of age, on a space-avail- college credit and noncredit classes as well as able basis. Normal admission requirements waived. In addition instructional and general fees are to course enrollment, you’ll also have the opportunity to use the College facilities and educational services. We also encourage you to take part in student activities. If you’d like more information, call or visit the Clark State Admissions Office. The Admissions Office is here to help you get started at Clark State. The Admissions Office, located in Rhodes Hall, Room 210, has everything you need. Fill out the Clark State admissions application and submit it to the Admissions Office. encouraged to submit applications early. Completed applications are required for both full-time and part- time students. All necessary materials may be obtained by contacting the Admissions Office. their completed application has been received by the Admissions Office. Students applying to health programs must also complete additional admissions If you are an adult who has never attended a college, If you are an adult take the Placement Test and meet you need only to you register for classes. with an advisor before at least 19 years of age, you must certificate and are for score on the Placement Test achieve a minimum IV Funds (federal financial aid). You eligibility for Title admission to the College will be granted conditional completed any required until you have successfully and earned at least a 2.0 GPA developmental courses course work. in your first 24 hours of college-level college or If you are transferring from an accredited college tran- university, you need to submit official for transfer scripts for courses you want evaluated directly from the credit. Transcripts must be mailed college to the Admissions Office. Program

Admissions Policy Admissions Enrollment Categories

Post-Secondary Enrollment Options Program Post-Secondary Enrollment Options The Admissions Office can provide you with addi- Your high school counselors can help you decide if For some students additional coursework in sci- For some students additional coursework Admission to the College does not assure admission Admission to the Admission to the College is offered to applicants Admission to the High School or High School Aged Students Not Enrolled in the Post-Secondary Enrollment Options In addition to taking the Placement Test, you will need to meet with an advisor at least quarterly. A limit in the number of credit hours may be imposed. If you are attending high school and Clark State at the same time, you need to submit a letter of permission from your high school principal or guidance counselor at, or before, registering for classes each quarter. tional information and entrance requirements. this program is right for you. In addition, high school counselors are responsible for explaining the equivalency, or lack of equivalency, of a given course at Clark State in meeting high school graduation requirements. The Post-Secondary Enrollment Options Program pro- The Post-Secondary Enrollment Options educational vides high school students with an additional program is intended option to take college classes. The to complement the high school’s college preparatory curriculum. ence, mathematics and English may be needed prior to ence, mathematics and English may programs. Such enrollment in certain courses and review of a student’s coursework is determined through a the College’s Place- past academic record or through can be completed ment Test. While all degree programs may take longer for in two years of full-time study, it true if the student some students. This is particularly if the student needs is attending on a part-time basis, if the student is also to take developmental courses or working. to a particular program of study. Many technologies to a particular program be additional requirements that must have established acceptance. All prospective appli- fulfilled prior to Admissions Office cants are encouraged to contact the for specific information. who are high school graduates or possess GED equiva- who are high school the over 18 years of age, who have lency; to applicants the College’s programs or courses; ability to benefit from eligible to participate in the various and to applicants offered at the College. special programs Clark State Community College is committed to pro- is committed Community College Clark State to maximum opportunity student with the viding each an Open we adhere to and learn. As such, develop Admissions policy.

T e 114 Student Services have hadhigh schoolalgebra).Youmay alsobere- you willneedtotakethe algebratest(providedyou Assistant, RegisteredNursing orPracticalNursing, Science EngineeringTechnologies, PhysicalTherapist nology Systems,theAssociate ofArts,theAssociate in MedicalLaboratoryTechnology, InformationTech- depending onyourcollegeplans.Ifyouplantoenroll chance tolearnandsucceedatClarkState. that bestmatchyourskillssoyou’llhavethegreatest used todeterminetheEnglishandmathematicscourses sively inothernon-creditcourses.)Thesetestswill be another collegeoruniversitythoseenrollingexclu- college-level Englishandmathcreditstotransferfrom courses. (Thisdoesnotincludestudentswhohave and mathematicsbeforeyouregisterforyourfirst are requiredtotakeplacementtestsinreading,writing If you’reenteringadegreeprogramattheCollege,you SAT areeligibleforEnglishproficiencytests. 700 SATareeligibleformathematicsproficiencytests. English scoresinthelastfiveyears:20ACTor500SAT. reading andwritingiftheyhavereceivedthefollowing have 510SAT. health programs)areexcusedfromthistestingifthey Students inothermajors(exceptthoseenrolling scores inthelastfiveyears:22ACTor560SAT. ing iftheyhavereceivedthefollowingmathematics are excusedfrommathematics/algebraplacementtest- the AssociateofScienceorEngineeringTechnologies Information TechnologySystems,theAssociateofArts, having totakeinitialplacementtests. following scoresonthesetestswillexemptyoufrom four-year collegetocompleteabachelor’sdegree.The ACT orSAT,especiallyifyouwillbetransferringtoa school student,youareencouragedtotakeeitherthe college entranceexams.However,ifyouareahigh As anopenadmissionsinstitution,wedon’trequire located inRhodesHall. which isscheduledthroughtheCounselingOffice advised toattendanewstudentorientationsession and part-timestudents.Newstudentsarestrongly their acceptancebeginninginOctober. January. WinterQuarterapplicantsarenotifiedof notified oftheiracceptancetotheCollegebeginningin school transcriptupongraduationorGEDcertificate. to theRealtimeReportingprogrammustsubmitahigh requirements asnotedonpage106.Studentsapplying In addition,youmaybeaskedtotakeanalgebratest (d) StudentswithEnglishscoresof23ACTor670 (c) Studentswithmathematicsscoresof23ACTor (b) Studentsareexcusedfromplacementtestingin (a) StudentsinMedicalLaboratoryTechnology, All admissionproceduresapplytobothfull-time Spring, Summer,andFallQuarterapplicantsare Placement Testing Entrance Exams Educational Center. at ClarkStatelocatedonthefirstfloorofBrinkman more informationcontacttheCollegeTechPrepOffice advanced standingintheirpathwayprograms.For Prep Consortium,mayqualifyforscholarshipsand/or prep programs,recognizedbytheClarkStateTech Students whohavecompletedhighschoolcollegetech Registration Office. test beforeregisteringfor classesintheRecordsand tion intheAdmissionsOffice andre-taketheplacement more, youwillneedtoupdate yourstudentinforma- If youarereturningtoClark Stateafterthreeyearsor Records andRegistrationOffice. in theGPA. better willbecountedinthe“hoursearned”but not rollment. AnycoursesinwhichyoureceivedaC or eliminate thecumulativeGPAofyourprevious en- Registration Officeatanytimepriortograduation to consecutive years,youmaypetitiontheRecordsand If youre-enrollafteranabsenceofthreeormore and RegistrationOffice. mation aboutthisprogramisavailableintheRecords graduated withinthelasttwoyears.Additionalinfor- To applyforthesecredits,thestudentsmusthave toward anassociatedegreeorcertificateatClarkState. allow foroneormorecredithourstobegranted Center andUpperValleyJVS. ter, Springfield-ClarkCountyJVS,TollesTechnical Career TechnicalCenter,OhioHi-PointCen- State: GreeneCountyCareerCenter,MiamiValley schools mayqualifyforadvancedstandingatClark High schoolgraduatesofthefollowingcareertechnical advisor bycalling937/328-6019. arrangements inadvancewiththeDisabilityServices modations fortakingtheplacementtests,pleasemake physical orlearningdisability)andneedspecialaccom- fee of$5.Ifyouhaveadocumenteddisability(either and Friday,8:30a.m.-4p.m.Oneretestisallowedata is availableMondaythroughThursday,10a.m.-7p.m. mathematics and/oralgebraarefreeofcharge.Testing valid forthreeyears.Placementtestsinreading,writing, you needtotakecollegepreparatorycourses. scores. TheAdvisingCenterstaffwillletyouknowif (CPE) coursesbasedonyourspecificprogramortest quired toenrollinourcollegepreparatoryeducation For moreinformationaboutFreshStart,contactthe Agreements withthesecareertechnicalschoolsmay Most often,yourplacementtestresultswillremain Career TechnicalCenterGraduates College TechPrepStudents Re-Admission Fresh Start Student Services 115 While on the waiting list, all applicants must main- all applicants must the waiting list, While on courses and other courses which College preparatory prior to sending accep- Transcripts are reviewed the required Applicants who have not achieved placement tests or successfully complete the CPE placement tests or successfully complete courses. of a 2.5 GPA in all students must have a minimum taken at Clark the prerequisite and required courses taken at other State and/or in transferred courses schools. (High school transcript or GED required.) biology or BIO 105, one course of high school or college chemistry within the past five years or CHM 110 and one course in high school or college physics or PHY 110; all with a grade of C or better. PTA program and obtain a petitioning packet from the Admissions Office. This packet contains detailed information about deadlines and any additional requirements needed for admission. All forms must be completed and returned as instructed in the packet. notified of their status by July of each year. programs by the date in which they file a petition in the they file a petition by the date in which programs approved. that petition Office and have Admissions required point average in the cumulative grade tain a 2.0 the curriculum. courses in of the curriculum are not typically are not listed as part the cumulative GPA. included in calculating programs and prior to the beginning tance letters for these Practical Nursing, Registered of the technical courses. Laboratory Technology appli- Nursing and Medical a 2.0 cumulative grade point average cants must achieve for acceptance into the program. in order to be eligible 2.5 Assistant students must have a Physical Therapist cumulative average. the required courses cumulative grade point average in acceptance will be when their names are reviewed for required to re-petition for the program. Physical Therapist Assistant 1. Successfully complete the reading, writing, and math 2. general admission requirements, In addition to the 3. Prerequisites include one course of high school 4. Students need to complete a petition to enter the 5. Applicants who petition by the deadline will be Emergency Medical Services to enter the EMS Students must complete a request the Admissions Of- program. Forms are available in must also meet fice. All incoming Paramedic students on page 5. the state entrance requirements described English Proficiency Space-Limited Programs Health Technologies Admissions Students enrolling after an absence of three or more Students enrolling after an absence If you want to re-enter a health program, you should If you want to re-enter Students who interrupt their attendance and later attendance who interrupt their Students All applicants (including those in high school) are The student should take the test before the end of The student should take the test consecutive years may wish to investigate the Fresh consecutive years may wish to investigate Start Option. also contact the Health and Human Services Division and Human Services also contact the Health for additional reinstatement requirements. return must meet the curricular requirements in place requirements meet the curricular return must courses Technical and basic of their return. at the time to be re- may have to any interruption taken prior five years taken in the last Those that were evaluated. graduation requirements. However, generally will still meet may have more stringent require- some technologies contact your division to determine ments. You should of previous courses. Courses that the acceptability than five years ago will be evaluated were taken more course basis. Courses taken more on an individual will be evaluated for acceptability than seven years ago by the division dean. considered for admission in the Registered Nursing, considered for admission in Practical Nursing, and Physical Therapist Assistant High school applicants for these programs are encouraged to apply for admission to the College in their junior or senior year. They must fulfill the prerequisites as listed. Some programs offered at Clark State are restricted in the number of students who can be admitted each year. These space-limited programs are Medical Laboratory Technology, Physical Therapist Assistant, Practical Nursing and Registered Nursing. Please refer to the curriculum pages or contact the Admissions Office for further information. midterm week of the quarter before he or she would be midterm week of the quarter before Quarter, the test registered for the class. For Fall be graded by three should be taken in the spring. It will determine whether English faculty members who will or English II based the student should take English I for taking the exam on the results of this exam. The fee Arts and Sciences is $60. The student should call the schedule an exam Division office at 937/328-6030 to time. If a student wishes to try and test out of English, he or If a student wishes to try and test out exam. This she will be asked to complete a two-hour a multiple choice exam will include a written essay and the English faculty test, which have been prepared by at Clark State. 116 Student Services Division foracopyofthe ReinstatementPolicy. demic advisorintheHealth andHumanServices to re-enter,thestudent should contacthis/heraca- technical coursesinaspace-limited programandwishes If astudentwithdrawsfrom ordoesnotcontinueinthe SuccessfullycompletetheMST181orequivalent 4. Aftertherequirementshavebeencompleted,stu- 3. Oneunitofhighschoolchemistryorsuccessful 2. Successfullycompletethereading,writingand math 1. Registered Nursing/EveningNursing SuccessfullycompleteMST181orequivalentcourse 3. Aftertheprerequisiteshavebeencompleted,stu- 2. Successfullycompletethereading,writingandmath 1. Practical Nursing(BeginsinSummerQuarter) Contacttheprogramadvisorin Medical Laboratory 3. Oneunitofhighschoolchemistryorsuccessful 2. Oneunitofhighschoolalgebra,anappropriate 1. Medical LaboratoryTechnology waiting list). courses (MST181isnotarequirementforthe tency atthetimeofenrollmentintechnical course andfurnishverificationofnurseaidecompe- name willbeplacedonthewaitinglist. Office. Ifallrequirementsarecomplete,thestudent’s dents mustpetitionfortheprograminAdmissions the waitinglist. is requiredwithinfiveyearsofputtingyournameon completion ofCHM110withagrade of Corbetter preparatory educationcourses. placement testsorsuccessfullycompletecollege 181 isnotarequirementforthewaitinglist). the timeofenrollmentintechnicalcourses (MST and furnishverificationofnurseaidecompetencyat name willbeplacedonthewaitinglist. Office. Ifallrequirementsarecomplete,thestudent’s dents mustpetitionfortheprograminAdmissions preparatory/developmental courses. placement testsorsuccessfullycompletecollege Technology foradmissionconfirmation. with agradeofCorbetterisrecommended. completion ofanintroductorychemistrycourse mended. or betterinDEV101CPEishighlyrecom- score onthealgebraplacementtest,oragradeofC Health andHumanServicesPrograms Reinstatement for guaranteed. cumstances maybeconsidered.Reinstatementisnot Day RNorEveningRN,althoughextraordinarycir- generally reinstatedtotheprogramthattheyleft,i.e., which theyarerequesting reinstatement. Studentsare reinstated onaspace-availablebasistothequarterfor prior creditshaspassed.Eligiblestudentsarethen may needtoberepeatedifthetimelimitforaccepting to acceptingstudentsforreinstatement.Certaincourses Transcripts arereviewedonanindividualbasisprior before thereinstatementrequestwillbeconsidered. PTA students)incoursesrequiredfortheprogram at leasta2.0cumulativegradepointaverage(2.5for study. and therequirementsofyourparticularmajor sibility. YoualsoneedtobeawareofCollegepolicies registration begins. division officeforthenameofyouradvisorbefore demic advisor.Youshouldcontacttheappropriate need help,pleasescheduleameetingwithyouraca- information explainingregistrationprocedures.Ifyou for eachquarter. in planningyoursequenceofclassesandscheduling ally fromyourchosenmajorandareheretoassistyou advisor atplacementtesting.Facultyadvisorsareusu- have adeclaredmajor,we’llassignyoufaculty the CounselingOfficeforacademicguidance.Ifyou ment test. have completedanapplicationandtakentheplace- you inschedulingyourfirstquarterclassesafter in theCollege’sEnrollmentServicesOfficewillassist to usethisservice.Ifyouareanewstudent,anadvisor throughout eachacademicquarter.Weencourageyou Academic advisingisavailabletoClarkStatestudents and returningstudents. hours youhaveearned.Open registrationisfornew registration prioritybased onthenumberofcredit rently enrolledattheCollege. Thissystemgivesyou and registrationassistance. your program’sdivisionalofficeforacademicadvising nity tolearn(andaskquestions)aboutClarkState. information sessionwhereyouwillhavetheopportu- tion. Newstudentsshouldalsoattendorientation, an 937/328-6028 tomakeanappointmentforregistra- New studentsshouldcontactEnrollmentServices at Students whowishtore-enterarerequiredhave Completing theregistrationprocessisyourrespon- Prior toregistrationeachquarter,you’llreceive If youhavenotdeclaredamajor,shouldcontact Priority registrationisforstudentswhoarecur- If youareareturningstudent,shouldcontact Registration Information Registration Academic Advising Student Services 117 Change of Major Auditing a Course Repeating Courses Cross-Registration Within SOCHE If you receive a grade of D or F in a general education If you receive a grade of D or F in a only once toward A course that is re-taken will count midterm will be recorded as F unless satisfactory will be recorded midterm drop. instructor for the is given to the justification as ac- the drop card should sign The instructor knowledgment. the third week of the quarter. For ated by Friday of a five- or six-week class after the a student to drop must obtain the instructor’s au- third week, he/she so. thorization to do midterm for any dropped classes. be recorded until If you audit a course, you will not receive a grade or If you audit a course, you will not classes but you credit. You will be permitted to attend The fee for auditing won’t be required to take exams. is not convertible is the same as for credit. Audit status convertible to audit to credit status nor is credit status status once the registration has been completed. Stu- dents using veterans’ benefits or receiving financial aid may not audit classes. Students who decide to change majors must complete a Change of Major card available in the Records and Registration Office. You will need to meet placement testing requirements for your new major. If you are a regularly enrolled student at Clark State or any other Southwestern Ohio Council for Higher Edu- cation (SOCHE) institution, you may register to take a class offered by another SOCHE institution at no additional charge on a space available basis. Informa- tion on the conditions established by the consortium is available in the Records and Registration Office. You may repeat any course at the College one time You may repeat If you are en- without having to request permission. you must also abide rolled in a space-limited program, re-enrolling in by the published regulations about courses. for graduation, you elective not specifically required course for may substitute a different general education point average. inclusion in your cumulative grade cumulative grade graduation requirements and in the grade and the new point average. Both the original However, only the grade will appear on the transcript. higher grade counts in your GPA. • following the fifth class day dropped after A course •a five- or six-week course must be initi- Dropping • will of the Summer terms, a grade of W During each Adding Courses Credit Hour Limit Dropping Courses There are five ways to register: fax your schedule There are five ways Information about how and when to register for and when to register about how Information through the fifth class day following midterm will appear on the student transcript with an automatic grade of W. quarter will not be counted as work attempted nor will any notation of the enrollment appear on the student transcript. If you are thinking about dropping all of your If you receive veterans’ benefits and drop a class or request to 937/328-6097, mail your schedule request request to 937/328-6097, Registration Office, telephone reg- to the Records and 937/328-8060, web registration istration by calling Cruiser, and in person at the Records through Campus the Rhodes Hall, Room 213 or and Registration Office, Office, Brinkman Educational Business Technologies Center, Room 201. classes is found in the most current issue of the class current issue found in the most classes is and in the Records Schedules are available schedule. before campus locations Office and other Registration begins. a new quarter • day of the quarter A course dropped from the 15th courses, you should talk with a counselor prior to taking such action. Grades will be reflected on transcripts as follows: • first 14 days of the A course dropped during the withdraw from all classes, it is your responsibility to notify the Veterans Office, Rhodes Hall, Room 213, 937/328-6014. Courses dropped anytime during the quarter could result in an overpayment dating back to the first day of the quarter. If you want to drop courses, you must complete a If you want to drop courses, you advisors, coun- Drop/Add card available from faculty Advising Center or selors, division offices, Academic If you receive the Records and Registration Office. Aid Office prior financial aid, check with the Financial to dropping classes. You can add courses through the fifth class day in Fall, You can add courses through the fifth also add courses Winter or Spring quarters. You may Summer term. The through the second day of any faculty advisors, Drop/Add card can be obtained from Center or the division offices, Academic Advising Records and Registration Office. You may enroll for a maximum of 18 credit hours per You may enroll for a maximum of year. You must quarter during the regular academic advisor and the have the approval of your academic 18 credit hours. division dean to enroll in more than 118 Student Services u o1 rdthus .0$5.00 $5.00 (up to16credithours) Technology fee (up to14credithours) General fee (up to16credithours) Instructional fee oprt rfcec $5 fees areusedtosupport the StudentSenate,student hours registeredinanyone academicquarter.General Instructional feesarecharged onthefirst16credit Corporate Proficiency Varies COMPASS RetestFee Varies Varies $2 Liability insurance(forcertaincoursesonly) Certification fee(forcertaincoursesonly) Lab fee(forcertaincoursesonly) $15 Prior LearningPortfolio Prior LearningPortfolio $15 $5 Proficiency feepercredithour $15 $25 DPP latepaymentfee(perinstallment) $15 $15 Delayed PaymentPlan(DPP)servicecharge Auxiliary servicesfee(perquarter) Transcript fee Late registrationfee(perquarter) Late paymentfee(perquarter) Application fee(onetimeonly) average. are notincludedwhencomputingyourgradepoint of DorlowerisconvertedtoNC.GradesCRNC your gradeofCorbetterisconvertedtoCRanda not knowofyourdecision.Attheendquarter, to thestandardgradingsystem.Yourinstructorwill Once thequarterhasbegun,youcannotchangeback courses. that arebasictoamajor;andtwofromthetechnical selected fromgeneraleducationofferings;twocourses total ofsixcourses.Twothesecoursesmaybe credit/no-credit (CR/NC)basis.Thereisamaximum for permissiontotakeonecourseeachquarterona You maypetitiontheRecordsandRegistrationOffice (per credithour) $60 $5 $75 (maximum ofoneretakepersubjectarea) (Written aspartofaclass) Assessment (percourse) (minimum chargeof$20) You canmakeyourchoiceatthetimeofregistration. Credit/No-Credit Enrollment Other FeesandExpenses Tuition 6.0$122.00 $66.00 ______$6.00 $ 6.00 $111.00 $55.00 resident Ohio Out-of-state until theexpirationofyour insurancecontract. for thiscoverage.Thecoverage willremainineffect be purchased.Fortheseprograms alabfeeisassessed For certainprograms,liability insuranceisrequiredto vices feesorDelayedPayment Planservicecharges. and RegistrationOffice. and areeffectiveonthedatereceivedbyRecords schedule. Alldropsorwithdrawalsmustbeinwriting nology feeswillbemadeaccordingtothefollowing Refunds ofinstructional,general,laboratoryandtech- in theCashier’sOfficeRhodesHall. the initialinstallmentwhenyouregister. register afterthefeepaymentdeadline,youmustpay bill ateachofthethreepublisheddeadlines.Ifyou plan allowsyoutomakepaymentsofone-thirdyour Clark StateoffersaDelayedPaymentPlan(DPP).This College aresatisfied. quarters untilallyourfinancialobligationstothe receive anofficialtranscriptorregisterforsubsequent permitted toattendclasses. have notmettheirfinancialobligationswillbe MasterCard, DiscoverorVISA.Thosestudentswho Payment fortuitionmaybemadebycash,check, catalog formoreinformation. help. PleaserefertotheFinancialAidsectioninthis state andinstitutionalfinancialassistanceprogramsto Clark StateFoundationprovideavarietyoffederal, without someformofassistance.TheCollegeandthe may findthecostofacollegeeducationtobetoogreat fees atthelowestpossiblelevel,someofourstudents Although wemakeeveryefforttomaintaintuitionand beginning ofthequarterinwhichyouareenrolled. fees andexpensesareduepayablepriortothe are subjecttochangewithoutnotice.Yourquarterly Clark StateCommunityCollegeBoardofTrusteesand directly benefitstudents. credit hours.Revenuegeneratedbythisfeeisusedto per credithourtechnologyfee,uptoamaximumof16 ogy iscriticaltothelearningexperience,therea$5 security activitiesonbothcampuses. the CampusPoliceDepartmentandothersafety tion andmaintenanceofparkinglotsroadways, Clinic, CampusMinistryandCareerPlacement. including FinancialAid,Records,Counseling,Health activities andallotherstudentservicesoftheCollege Refunds arenotissuedforlatefees,auxiliaryser- Contracts andadditionalinformationareavailable To helpeasetheburdenofpayingtuitioncosts, In addition,youmaynotbepermittedtograduate, All ofourfeesandexpensesareestablishedbythe Since accessforstudentstostate-of-the-arttechnol- Auxiliary servicesfeesareusedtosupporttheopera- Cash RefundPolicy Payment Student Services 119 Transcripts Student Records Access to Educational Records Specific exceptions and circumstances may require Specific exceptions or residency must be A petition for reclassification All financial obligations to the College (all fees and You have the right to inspect and review your You may request the amendment of your education indirectly received in the preceding 12 consecutive preceding 12 received in the indirectly who from persons or entities support months financial purposes. for all other legal of Ohio are not residents guardian or parent or legal child of a 3) A dependent of a term as of the first day of a person who, the spouse accepted full-time, self-sustaining of enrollment, has of established domicile in the state employment and of other than gaining the benefit Ohio for reasons rates. favorable tuition on student’s residency classification a review of each an individual basis. and Registration Office prior approved by the Records classes for the quarter if the reclas- to the first day of sification is to be effective. You may get an official transcript of your academic You may get an official transcript request form in the record by completing a transcript or by visiting the Records and Registration Office the form. You Clark State web site and downloading to the Records may also mail or fax a written request a transcript, and Registration Office. When requesting number, birth date, include your name, Social Security legal signature the term you last attended Clark State, card number and and payment. If faxing, a credit expiration date is required. The fax number is 937/ 328-6097. All copies are $2 each. Normally, transcripts will be sent within two working days of the request date. fines) must be paid and all college equipment returned before a transcript can be released. The Family Educational Rights and Privacy Act (FERPA) affords you certain rights with respect to your education records. education records within 45 days of the day the Col- lege receives a request for access. You should submit to the registrar written requests that identify the records(s) you wish to inspect. records if you believe it is inaccurate or misleading. You should write the College official responsible for the record, clearly identify the part of the record you Our Records and Registration Office processes your Our Records and Registration Office cards and student records, transcripts, identification It also processes diplomas and works with veterans. name, address, resi- changes in student status such as please contact dency and major. For more information, the Records and Registration Office. Parking Residency If you need more information, please contact the please contact more information, If you need The following persons are classified as residents of first day of class None The Clark State Parking Guide is available for view- first day of class 50% zone or other restricted area $25 first day of class 75% Financial Aid Office or the Cashier’s Office. Aid Office or the Financial the state of Ohio for subsidy and tuition surcharge purposes: 1) Dependent students, at least one of whose parent or legal guardian has been a resident of the state of Ohio for all other legal purposes for 12 consecutive months or more immediately preceding the enrollment of such student in an institution of higher education. 2) Persons who have resided in Ohio for other legal purposes for at least 12 consecutive months preceding their enrollment in an institution of higher education and who are not receiving and have not directly or Clark State follows the Ohio Board of Regents Rule 3333-1-10 for determining a student’s residency status. ing on the College web page. Access the Campus Police section under Student Services. After the ninth calendar day after the After the ninth calendar day after Student in faculty/staff lotImproper parkingNo valid permitParking in visitor lot $20 $20 $10 $10 By the ninth calendar day after the By the ninth calendar displaying a current Fines are assessed for vehicles not vehicle regula- parking permit or for violating motor can be picked up tions. Permits are free of charge and of the Brinkman in the Bookstore or in the lobby to know your li- Educational Center. You will need at the Cashier’s cense plate number. Fines are payable Office. Violations and fines include: Parked in handicapped zoneParked in fire laneMoving violationsParking on grass, sidewalk, loading $50 $50 $25 Fee Refund Schedule for Summer Quarter Fee Refund Schedule DateThe first day of class day after the By the fourth calendar 100% Refund Fee Refund Schedule for Fall, Winter and Spring Quarters Schedule for Fall, Winter Fee Refund Date day of the quarterBy the 7th calendar day of the quarterBy the 14th calendar day of the quarterBy the 21st calendar 100% day of the quarterAfter the 21st calendar 75% None 50% Refund 120 Student Services excessive absencesandhave notofficiallywithdrawn have therighttoissuea failinggradeifyouincur rangements forworkthat has beenmissed.Instructors responsibility tocontact your instructortomakear- unavoidable absencesdo occur,youshouldtakethe urged toattendallclassandlaboratorysessions.When through regularclassparticipation.Therefore,you are Achievement ofacademicgoalsisbestaccomplished oping andimplementingacademicpolicies. and StudentAffairsisultimatelyresponsiblefordevel- Registration Office.ThevicepresidentofAcademic more detailedinformation,contacttheRecordsand of academicpoliciesandproceduresatClarkState.For The followingsectionsareintendedtobeanoverview have submittedarequest. newspaper concerningacademicachievementifyou Office. TheCollegewillnotreleaseinformationtothe information, availableintheRecordsandRegistration not bereleasedbysigningarequesttowithhold institution attended. status andmostrecentpreviouseducationalagencyor of athleticteams,datesenrollment,enrollment nized activitiesandsports,weightheightofmembers and awardsreceived,participationinofficiallyrecog- student name,address,telephonenumber,major,degrees recognizes “DirectoryInformation”asthefollowing: your privacyandeducationalrecords.ClarkState Rights andPrivacyActof1974isdesignedtoprotect The BuckleyAmendmenttotheFamilyEducational Avenue, SW,Washington,DC20202-4605. fice, U.S.DepartmentofEducation,400Maryland administers FERPAis:FamilyPolicyComplianceOf- of FERPA.ThenameandaddresstheOfficethat ures bytheCollegetocomplywithrequirements U.S. DepartmentofEducationconcerningallegedfail- tional interests. disclosure toschoolofficialswithlegitimateeduca- exception whichpermitsdisclosurewithoutconsentis FERPA authorizesdisclosurewithoutconsent.One student’s educationrecords,excepttotheextentthat personally identifiableinformationcontainedinthe College’s establishedgrievanceprocedures. tory toyou)aformalhearinginaccordancewiththe student affairsand(inabsenceofresolutionsatisfac- satisfaction, youmaytakethemattertodeanof misleading. Iftheproblemisnotresolvedtoyour want changedandspecifywhyitisinaccurateor You mayrequestthatyour“DirectoryInformation” You alsohavetherighttofileacomplaintwith You havetherighttoconsentdisclosuresof Academic Policies Release ofInformation Attendance dismissed fromtheCollege foracademicreasons.If vice presidentofAcademicandStudentAffairs. may discussitwiththedivisionaldeanandthen of FallQuarter.Iftheproblemisstillnotresolved,you should discussitwithyourinstructorbythefifthweek grade wasforaSpringorSummerquarterclass,you within fiveweeksaftertheendofquarter.If a grade,youshoulddiscussitwithyourinstructor released overthephone.Ifyouhaveaconcernabout grades throughCampusCruiser.Gradeswillnotbe Records andRegistrationOffice.Youmayaccessyour quarter totheaddresswehaveonfileforyouin Official gradereportsaremailedattheendofeach clude issuingafailinggradeinthecourse. administrator forfurtheraction.Suchactionmayin- ulty membermayrefertheissuetoappropriate occurred. Inseriousorrepetitiveincidences,thefac- any assignmentinwhichacademicmisconducthas academic requirements. giarism oranyotherdishonestydeceptioninfulfilling Academic misconductincludescasesofcheating,pla- or tepe CumulativeGPA Hours attempted listed below: cumulative gradepointaveragefallsbelowthechart You areconsideredtobeonprobationwhenyour point average. courses arenotincludedindeterminingthegrade Grades of“satisfactory”andgradesindevelopmental Dean’s Listinrecognitionofachievementthatquarter. better foraquarter’swork,youwillbeenrolledonthe courses andmaintainagradepointaverageof3.5or If youcarryaminimumofsixcredithourscollege agencies. from theVeteransAdministrationorstatefederal result inhavingtorepaypartorallofanallowance tance tostudents.Failureattendclassesmayalso federal andstateagenciesthatprovidefinancialassis- dance isavailableinthecoursesyllabus. from acourse.Specificinformationconcerningatten- Probation meansthatyou areinjeopardyofbeing Faculty havetheauthoritytoissueafailinggradefor The Collegeisrequiredtoreportnon-attendance vr6 Below2.0 Below1.80 Below1.70 Below1.60 Below1.50 Over 60 46-60 31-45 16-30 1-15 Academic Misconduct Grade Reports Dean’s List Probation Student Services 121 Grading System Credit Hours Grade Points use only) Definition of Credit Hour Definition Total hours: 13 Total points: 33 SUIPR Satisfactory CR Unsatisfactory NCEX Incomplete Proficiency TR Credit W No Credit X Experiential Credit IP Credit Transfer N Withdrawal Audit PG In Progress (self-paced courses only) No Grade Reported (Records Office only) Progressing (developmental The total number of grade points, 33, is determined The total number of grade points, Grades issued for developmental courses are not There are other symbols that can be issued with A-ExcellentB-GoodC-AverageD-Poor (4 grade points per credit hour) F-FailingZ–Non-Attendance* (0 grade points per credit hour) points per credit hour) (3 grade hour) (2 grade points per credit never attended) (*Student registered for class but the total number Your GPA is obtained by dividing (1 grade point per credit hour) points per credit hour) (0 grade by adding together the points earned in each course by adding together the points earned number is then (credit hours x grade points). That hours, 13, to divided by the total number of credit In this case the determine the grade point average. average is 33/13= 2.54. counted in your grade point average. A cumulative grade point average refers to the average for all college credit courses taken during your stay at the College. which there are no points associated: All academic credits are expressed in terms of credit expressed in terms credits are All academic on the a credit hour based State defines hours. Clark Board of Regents. of the Ohio requirements is indicated by the following Academic achievement used in calculating grade point grades and points average: courses by the of grade points earned in college credit in those courses. total number of credit hours attempted grades earned by For example, consider the following a student: Course 1Course 2Course 3Course 4 3 3 4 3 B C B C 9 6 12 6 Dismissal Computer Literacy 1-1516-3031-4546-60over 60 .80 Below Below .90 Below 1.20 Below 1.40 1.60 Below Hours attempted Cumulative GPA In order to avoid being dismissed again, a 2.0 GPA Upon reinstatement, you must meet with the Pro- You may be re-admitted to Clark State on probation You may be re-admitted to Clark State You will be dismissed when your cumulative grade You will be dismissed when your When on academic probation, you may carry a When on academic each quarter must be maintained or dismissal will occur when your cumulative grade point average falls into one of the above ranges. gram Advisor/Division Dean to determine a course of action. You will be permitted to enroll for not more than 12 credit hours for each of the next two quarters and must maintain a 2.0 Grade Point Average (GPA) in each of those quarters. Once this requirement is met, you and your Program Advisor/Division Dean will mutually agree upon the class load you will take for subsequent quarters. after you have sat out one quarter. Computer literacy is essential for Clark State graduates to be productive in the workplace. Clark State requires that you complete the computer requirements listed in your program. point average falls into the following ranges. point average falls into the following A student is dismissed from the College when his/her A student is dismissed from the College below the proba- cumulative grade point average falls that you must tion levels listed above. Dismissal means term in which your sit out the quarter following the However, you GPA slipped below probation levels. one quarter before will be placed on probation at least that probation dismissal for academic reasons. During the Records and term, you will receive a letter from to improve the Registration Office stating that failure result in dismissal. GPA by the end of the quarter will maximum load of 12 course credits during your first maximum load of (This includes students accepted quarter of probation. Of- on probation by the Admissions into the College recommended that you repeat any fice.) It is strongly of- next quarter those courses are failed courses the on probation for two or more fered. If you remain you may take a maximum of nine consecutive quarters, work. course credits of your average places you on probation, you should on probation, places you your average schedule. to select a course your advisor confer with and the such as tutoring support services Academic students on for are strongly recommended writing lab probation. 122 Student Services fees, libraryfines,parking fines)mustbepaidandall tional fees,general laboratory fees,technology istrator. by thefacultyandapproved bythedivisionaladmin- the degreeprogrambeingpursuedunlessrecommended exceed onehalfoftherequiredtechnicalcourses for for acertificateprogram.Thetransfercreditsmay not Clark Stateforanassociatedegreeor18credithours complete atleast30credithoursofcoursework at in requiredmajorcourses. Therapist Assistantprogrammustmaintaina2.5GPA Social Services.Inaddition,studentsinthePhysical Registered Nursing,PhysicalTherapistAssistantand Emergency Medical,MedicalLaboratory,PracticalNursing, opment, EarlyChildhoodEducationAdministration, in allrequiredmajorcourses:EarlyChildhoodDevel- following majorsmusthaveaCasminimumgrade grade pointaverageofatleast2.0.Studentsinthe required coursesforyourmajorandhaveacumulative To qualifyforanassociatedegree,youmustpassall being sought. awareness. Thenumberofclassesvarywiththedegree complete acourseorcourseswhichemphasizeglobal our lives,werequireeachgraduatetosuccessfully Because oftheimportanceinternationaleventsto Fall Quarter. complete allconditionsbyFridayofthefifthweek grade attheendofSpringorSummerQuartermust your transcript.Astudentreceivinganincomplete fifth weekofthefollowingquartertoanFgradeon grade willautomaticallybechangedonFridayofthe grade. Ifyoudonotcompletetherequirements,“I” instructor willchangethe“I”gradetoanotherletter by midtermofthefollowingquarter. Grade formforcompletionofthecourserequirements structor willsetupascheduleontheIncomplete will besubmittedonyourgradereport,andthein- any quarter.Iftheinstructoragreestoan”I”grade,it by theinstructor. ments forthecoursewhenfinalgradesaresubmitted in thefamily),youwillnothavecompletedallrequire- for reasonsbeyondyourcontrol(e.g.,illnessordeath when youareprogressingsatisfactorilyinacourse,but The incomplete(I)gradeprocessmaybeinitiated advisor onrecalculatingyourgradepointaverage. All financialobligations to theCollege(instruc- Students transferringtoClarkStateareexpected When youcompletetheclassrequirements, You mustnotifyyourinstructorbythelastdayof If youchangemajors,pleasecheckwithyournew Graduation Requirements Global Awareness Incomplete quirements. or shestandsintermsofcompletinggraduationre- recognized atcommencementashonorstudents. 3.5 orbetterattheendofWinterQuarterwillbe Summer Quarter. your degreerequirementsarecompletedduringthe graduation ceremony.Diplomaswillbeissuedafter Office forgraduationandparticipateintheJune ments, youmaypetitiontheRecordsandRegistration the SummerQuartertocompletedegreerequire- more thanfourcourseswhichwillbeofferedduring in theJunegraduationceremony. be mailedatthattime,andyoumayelecttoparticipate the Fall,WinterorSpringquarters,yourdiplomawill your degreeorcertificaterequirementsattheendof diplomas willbeissuedatgraduation.Ifyoufinish emony. programs mayalsoparticipateinthegraduationcer- Technical Studies.Studentswhocompletecertificate Business, AssociateofAppliedScienceor of Arts,AssociateScience,Applied Graduates earnoneofthefollowingdegrees:Associate State forworkcompleted atotheraccreditedcolleges You canbegrantedcredit towardadegreeatClark Office. mation isavailablethroughtheRecordsandRegistration Clark StatePriorLearningPortfolio.Additionalinfor- dents, CertifiedProfessionalSecretaryCertificateand Instruction, JointVocationalandCareerCenterstu- nations, MilitaryTrainingandNon-CollegiateSponsored Examination Program,ClarkStateProficiencyExami- College BoardAdvancedPlacement,Level credit andexaminationsforanyofthefollowing: You mayobtainacademiccreditthroughexperiential than 46quarterhours. are asecond-yearstudentonceyouhaveearnedmore quarter hoursofcredit,includingtransfercredit.You a specificprogramandhaveearnedfewerthan46 less perquarter,youarepart-time. at least12credithours.Ifyoucarry11hoursor You areconsideredfull-timewhenyouenrolledin diploma willbeissuedbytheCollege. College equipmentreturnedbeforeyourgradesora It isthestudent’sresponsibilitytoknowwherehe Students withacumulativegradepointaverageof If youhaveacumulative2.0averageandneedno The graduationceremonyisheldinJune.Blank You areafirst-yearstudentifyouregisteredin Transfer CreditstoClark State Student Classification Credit Equivalencies Graduation Process Student Services 123 Priority Deadlines Supporting Material Eligibility Requirements SummerFallWinterSpring 15 March October 15 15 June December 15 Generally, Pell Grants may be used for a maximum Generally, Pell Grants may be used Application for additional aid, such as Federal Work- aid, such as Federal for additional Application by the deadlines below will be Materials completed financial The Financial Aid Office begins processing file the FAFSA, All loan applicants are required to information We can provide you with additional have passed an independently administered test approved by the U.S. Department of Education. program. eligibility and notifies students with an award letter with an award and notifies students eligibility not eligible If you are aid that is being offered. showing in writing. will notify you for aid, we Educational Opportunity Federal Supplemental Study and are be considered as long as funds Grant funds, will you to apply early. available. We encourage beginning of the quarter. processed by the year beginning of three quarters during the academic with Spring Quar- with Summer Quarter and ending for an additional ter. Students who want to be considered Aid Office to verify quarter must contact the Financial If you do not further eligibility beyond three quarters. needed to com- provide the requested documentation may lose funds. plete the verification process, you for the next aid applications and loan applications students whose academic year in the spring for those to be processed. applications are complete and ready with the which indicates eligibility or non-eligibility Financial Aid Office. Please call the about scholarships and deadline dates. Financial Aid Office at 937/328-6034. Additional documentation may be needed for certain situations or to comply with U.S. Department of Edu- cation verification requirements. The Financial Aid Office will advise you on what you need. Listed below are the eligibility requirements for the federal programs. 1. Generally, you must show financial need. 2. You need to have a high school diploma, GED or 3. You are enrolled as a regular student in an eligible 4. You need to be a U.S. citizen or eligible non-citizen. 5. You will need to make satisfactory academic progress. How to Apply Financial Aid The SAR is used to establish your financial need. Clark State uses the Free Application for Federal Decisions regarding acceptance of transfer credit are Decisions regarding acceptance of Transferred credit hours are counted in the cumu- Transferred credit hours are counted If you change majors while attending Clark State, If you change majors while attending Technical and basic courses that were taken in the Technical and basic With a few exceptions, all financial aid awarded is based on demonstrated financial need. By filing the FAFSA, you will be considered for all aid for which you might be eligible. The Financial Aid Office determines Student Aid (FAFSA). FAFSAs are available in the Financial Aid Office or on the web. You should complete this form using prior year income. The information provided on this form is processed and a Student Aid Report (SAR) is sent to you four to six weeks after you mail the form. Financial aid applications are available in January for the upcoming financial aid year which begins with Summer Quarter. You should file these applications as soon as your tax information is available. Financial aid is available from many sources to help Financial aid is available from many would be unable to students who, without such aid, and their families attend college. Although students are primarily responsible for the cost of education, financial aid can fill in the gap if their family can afford only part of the cost. made by the Records and Registration Office in consul- made by the Records and Registration director of Advising tation with division deans and the a decision, you & Articulation. If you disagree with appeals process may follow the appeals process. The “Appeal for Credit” begins with the completion of the Registration office. form located in the Records and lative hours completed but are not counted in the lative hours completed but are cumulative grade point average. you should ask the Records and Registration Office to you should ask the Records and Registration transfer cred- reevaluate the transcript for additional will be considered its. Those required by the new major toward degree completion. last five years generally will be accepted. Some tech- last five years generally stringent requirements; so contact nologies have more to determine what requirements your division in order apply. and universities for courses with a grade of C or better. with a grade of for courses and universities pro- to specific degree may not apply Some credits within a have been earned credits must grams. The and ac- considered current period to be certain time submitted needs to be An official transcript ceptable. where credits were earned. Transfer from each college on a course-by-course basis once credit is evaluated to Clark State. Until you are notified, you have applied for for not duplicating courses you are responsible transferable credit. which you may obtain 124 Student Services after thefirstdayof loanperiod.Arrangements ers cannotreceivethefirst loanpaymentuntil30days multiple disbursements.First-year, first-timeborrow- cial need. independent undergraduatestudentsbasedonfinan- hours). Thisprogramisopentoalldependentand to beatleastahalftimestudent(enrolledinsixcredit made beginningsixmonthsaftertheborrowerceases to helppayforeducationalexpenses.Repayment is (banks, savingsandloanassociationscreditunions) made availabletostudentsbylendinginstitutions This programofferslong-terminterest-bearingloans Grant recipients. tionally needystudentswithprioritygiventoPell funding. FSEOGawardsmustbetargetedtoexcep- vidual awardmaybemuchlessbecauseofrestricted $4,000 peryear;however,theamountofanyindi- a bachelor’sdegree.Themaximumawardbylawis eligible undergraduatestudentswhohavenotearned This isafederalgrantwhichprovidesassistanceto part-time andfull-timestudents,respectively. Grants atClarkStaterangedfrom$400-$4,000for this grant.During2002-03theannualvalueofPell already earnedabachelor’sdegreeisnoteligiblefor hours forwhichastudentenrolls.Awhohas on theStudentAidReportandnumberofcredit depends ontheExpectedFamilyContribution(EFC) not havetoberepaid.Theamountoftheaward built. Asinanygrant,itisaformofgiftaidwhichdoes to providethefoundationonwhichotheraidcanbe The PellGrantisafederalassistanceprogramdesigned not receiveanysurplusfunds. Business Office.Studentswhototallywithdrawmay home addressthefifthweekofquarterby any surplusaidnotusedismailedtothestudent’s for thepaymentoftuition,feesandbooks.Acheck similar toacreditcardwhichcanbeusedoncampus When aidhasbeenawarded,itbecomesavoucher documentation. on afederalstudentloanorfailuretosubmitrequired toward completionofthecertificateordegree,default tutional funds,failuretomakesatisfactoryprogress insufficient demonstratedfinancialneed,lackofinsti- Aid maybedeniedforseveralreasons:noneedor Loan proceedsareusually senttotheCollegein Federal SubsidizedStaffordLoanProgram Federal SupplementalEducational Opportunity Grant(FSEOG) Financial AidVouchers Federal PellGrant Denial ofAid does notcarryafixedloanlimit. gram isthesameasforStaffordLoanprogramsand riod forthePLUSprogram. Congress. Thereisnodefermentoptionorgracepe- interest rateoftheloanisvariableandsetby completely metbytheStaffordLoanprograms.The approval. Theyareusedtosupplementneedsnot and aremaderegardlessofincomependingcredit PLUS loansfordependentstudentsarenotneed-based unsubsidized loans. ment tobemadethestudentforsubsidizedand percent guaranteefeeisdeductedfromeachdisburse- wait fornewborrowersalsoapplies. manner asthesubsidizedloanprogramand30-day Stafford LoanProgram. process isthesameasforFederalSubsidized ment) whilethestudentisenrolled.Theapplication accumulates (i.e.,isnotpaidbythefederalgovern- income. Thetermunsubsidizedmeansthatinterest pendent undergraduatestudentsregardlessoffamily This loanprogramisavailabletodependentorinde- this loaniscontingentupon availabilityoffunds. demonstrate theabilityto repaytheloan.Receiptof There isa$20processing fee.Theborrowermust and mustberepaidbythe eighthweekofthequarter. and books.Thisloancannot exceed$900perquarter gency loanprogramforthe paymentoftuition,fees The DorothyM.MummaShort-TermLoanisanemer- inquire astotheeligibilityforthisprogram. quarter). PleasecontacttheFinancialAidOffice to less thanfull-time(fewer12credithourseach gram (OIP)isforthosestudentswhoareenrolled for The OhioPart-timeStudentInstructionalGrantPro- the applicationforPellGrantprogram,(FAFSA). granting program. financial needandareenrolledfull-timeinadegree- is awardedtoeligibleresidentsofOhiowhoshow This grantisfundedbytheOhioBoardofRegentsand costs untilloanproceedsareissued. must bemadebythestudenttotakecareoftuition The applicationprocessforthefederalPLUSpro- A threepercentloanoriginationfeeanduptoaone Loan proceedsaresenttotheCollegeinsame The applicationprocessisaccomplishedthrough Federal UnsubsidizedStaffordLoanProgram Ohio Part-timeStudentInstructional Parents’ LoansforUndergraduate Ohio InstructionalGrant(OIG) Grant Program(OIP) Students (PLUS) Mumma Loan Student Services 125 Withdrawals Work-Study Program New Programs of Study New Programs of Financial Aid Refund Policy Financial Aid Appeals Process Financial Students who withdraw from all classes prior to If you add or drop credit hours, your financial aid The College-Funded Work-Study Program provides The College-Funded Work-Study The Financial Aid Office assists students with locat- will then review your transcript. You can still receive You can review your transcript. will then a financial aid is suspended assistance. If non-federal appeal. there is no second time, Any student receiving Federal Title IV funds will be subject to the following policy regarding the return of Federal Title IV funds: completing more than 60 percent of an enrollment Your financial aid is based on the number of credit hours for which you are officially registered. You must notify the Financial Aid Office of any changes in enrollment. will be automatically recalculated based on your level of enrollment. This recalculation will continue throughout the refund period. If you lose your eligibility and feel there are mitigating If you lose your eligibility may appeal in writing to the Finan- circumstances, you Committee. If the appeal is granted, cial Aid Appeals on probationary status until you you will be placed percent successful completion rate. reach an overall 67 Appeals Committee is final. The decision of the a their major or are seeking Students who change reaching the credit hour maxi- second degree before Office to determine mums must contact the Financial Aid of major or new new eligibility. Only one change degree will be considered. provides part-time The Federal Work-Study Program financial need and campus employment if you have expenses. You want to earn part of your education credit hours each must be enrolled for at least six During the Sum- quarter to be eligible to participate. for at least six credit mer Quarter, you must be enrolled $5.75 per hour but hours. Currently, the wage rate is in the federal mini- is subject to change with changes 18 hours per week. mum wage. You may work up to year is deter- The amount you may earn in a school need, other mined by the amount of your financial funds. financial aid and availability of federal if you do not part-time campus employment even for the Federal show financial need (as you would Work-Study Program). The wage rate and hours worked are the same as for the federal program. ing part-time employment on campus. Academic Progress Academic Credit Hour Probation Grade Point Probation Financial Aid Suspension Credit Hour Requirements 1-1516-3031-4546-60over 60 Above 1.49 Above 1.59 Above 1.69 Above 1.79 Above 1.99 Total Credit Hours Attempted Grade Point Required You must complete your program of study within You must complete your program 135 credit hours if pursuing a degree or 69 credit 135 credit hours if pursuing a degree hours attempted at hours if pursuing a certificate. All accepted by Clark Clark State and any transfer credits 69 credit hour State are included in the 135 and maximums. If the probationary status is not removed in the above- specified manner, federal financial aid will be suspended. In order to receive further federal aid, you must successfully complete 24 credit hours. The Appeals Committee You must maintain the minimum quarterly GPA until overall GPA reaches the minimum. The student will be awarded federal financial aid on a quarterly basis only, maintaining probation status. All students must have attained a 2.0 GPA by the end of their second year of their program. Any student who has attempted more than 90 hours and does not have an overall 2.0 GPA will be suspended from financial aid eligibility. Aid is processed for one quarter only. You must suc- Aid is processed for one quarter only. cessfully complete 67 percent of attempted hours each quarter until an overall 67 percent completion is reached. If you are more than 36 credit hours short of meeting the minimum 67 percent requirement, you will be suspended from receiving federal financial aid. You will need to successfully complete 67 percent of successfully complete 67 percent You will need to with an A, B, C, D, IP, or S. You all hours attempted grade point average must also maintain an appropriate retain eligibility for as determined by the College to federal aid. As a Clark State student, you are expected to meet you are expected State student, As a Clark toward while working of academic progress standards Financial credits. The certificate or transfer a degree, and the the U.S. Congress is required by Aid Office of of Education to enforce standards U.S. Department for students who receive Federal academic progress SEOG, Federal work-study, and Pell Grant, Federal ap- Loans. This policy is Federal Family Educational aid applicants, regardless of whether plied to all financial aid previously. they received financial 126 Student Services involvement inactivities outsidetheclassroom.Re- a 3.5/4.0gradepointaverage andhavedemonstrated percent oftheirhighschool graduatingclassorhave during thecurrentyear, rank eitherintheupper15 schools withinOhio.Recipients mustbegraduating cally talentedstudentsfromhighschoolsandvocational Fifteen fulltuitionpackagesareavailabletoacademi- Trustee HonorScholarship tions areavailableintheFinancialAidOffice. Clark Stateoffersthefollowingscholarships.Applica- residency andnumberofdependents. status (asdefinedbyfederalandstateprograms), a numberoffactorssuchasmaritalstatus,dependency penses willvaryfromstudenttodependingon indirect (off-campus)educationalcosts.Theseex- Expense budgetsincludebothdirect(on-campus)and policy, pleasecontacttheFinancialAidOffice. result oftherepaymentfederalaidfunds. balance owedtoClarkStateCommunityCollegeasa funds. will notowearepaymentofFederalTitleIVgrant ered tohaveearned100percentoftheaidreceivedand percent ofthepaymentperiod(quarter)areconsid- Grant andFederalSEOG. then subsidized),FederalPlusLoans,Pell following order:FederalStaffordLoans(unsubsidized, expenses. Unearnedfederalaidwillbereturnedinthe required toreturnfundsreleasedthemforpersonal paid atthetimeofdisbursement.Studentsmayalsobe State CommunityCollegechargesthatwereoriginally programs, itcouldresultinthestudentowingClark “earned” fortheperiodstudentremainedenrolled. amount ofaidreceivedthatwasinexcessthe be requiredtoreturnthefederalaidprograms = 0.175). percent oftheaidheorshereceived(20dividedby114 length, thestudentwouldhaveonlyearned17.5 drew onthe20thdayofaquarterthatis114daysin quarter). Forexample,ifastudentcompletelywith- number ofcalendardaysinthepaymentperiod(i.e. number ofdaysthestudentattendeddividedby percentage ofaidearned.Thisiscalculatedbythe pleted, whichshallbecalculatedasfollows: recalculated basedonthepercentageoftermcom- term (quarter)willhavetheireligibilityforfederalaid For moreinformationonthefinancialaidrefund Please notethatstudentsareresponsibleforany Students whoremainenrolledthroughatleast60 If theCollegereturnsfundstoTitleIVaid Clark StateCommunityCollegeandthestudentwill The percentageofthequartercompletedis Scholarships Educational Costs Educational Centerforadditionalinformation. Clark StateCollegeTechPrepOfficeintheBrinkman their TechPrepPathwayatClarkState.Contactthe junior andsenioryearinhighschool,continue a 95%attendancerate,andearn2.5GPAduringtheir winter quarterfollowinghighschoolgraduation,have Scholarships. Studentsmustapplynolaterthanthe Prep ConsortiummayapplyfortheGeorgeMueller of aTechPrepprogramlocatedintheClarkState Students whohavecompletedthehighschoolportion George MuellerCollegeTechPrepScholarship which arefunded by theStateofOhio. You mayalsowanttoapplyforthesescholarships please seethenextpage. Committee. ForalistofFoundationscholarships, tion willthenbereviewedbytheScholarshipReview return itbyMarch31forFallQuarter.Yourapplica- up anapplicationintheFinancialAidOfficeand individuals, businessesandorganizations.Pleasepick administers scholarshipsfundedbycontributionsfrom College anditsstudents.TheFoundationoffers non-profit organizationthatprovidessupporttothe The ClarkStateCommunityCollegeFoundationisa of full-timeinstructional andgeneralfeestodepen- The StateofOhioawardsscholarships forthepayment Ohio WarOrphansScholarship Financial AidOffice. the lineofduty.Applicationismadethrough the dren ofOhiopeaceofficersandfirefighterskilled in The StateofOhiograntstuitionwaiversforthechil- Ohio TuitionWaivers Guard unit. for education.Applicationismadethroughthelocal instructional andgeneralfeesofitsmembersapproved The OhioNationalGuardwillpay100percent of Ohio NationalGuardScholarship plication ismadethroughthehighschoolcounselor. scholarship isawardedthrougheachhighschool.Ap- their highschoolgradesandACTscores.Atleastone scholarship torecenthighschoolgraduatesbasedon The OhioBoardofRegentsawardsa$1,000year Ohio AcademicScholarship 2004. Admissions Office.ApplicationdeadlineisMarch31, may beobtainedfromhighschoolcounselorsorthe achieving statedacademicrequirements.Applications cipients mayretaineligibilityforasecondyearby Other ScholarshipsAvailableatClarkState Clark StateFoundation Student Services 127 Tutoring Success Center Career Services Disability Services The College’s Success Center in Rhodes Hall, Room The College’s Success Center in new and returning 220, offers a full-service area for on a walk-in basis students. Tutoring is available p.m. and Fri- Monday through Thursday, 10 a.m.-7 Internet research day, 8:30 a.m.-5 p.m. Computers for for a variety of and supplemental learning programs can also take advan- classes are also available. Students facilitated tage of various study groups and workshops by the Success Center. Sound career choices are based on knowledge about yourself and the world of work. Whether you are choosing a major, researching your chosen career field or preparing for your job search, the Career Center can help you meet these challenges. The Career Center offers a full range of services designed to assist students in exploring the wide range of personal and professional choices open to them, and to find the career path that fits them best. All Clark State students and alumni are encouraged to use the Career Center’s web-based resume referral service, self assessment, career exploration and job search resources. For more information on how we can help you, please call 937/ 328-6093 or visit us at http://careers.clarkstate.edu. You are entitled to free tutoring as a Clark State tutoring as a entitled to free You are a tutor or in getting If you are interested student. in assistant the tutoring one, please contact becoming Educa- or in the Brinkman Room 220 Rhodes Hall, 106. The assistant assigns tutors tional Center, Room contact hours - usually two and assists in arranging subject. Online tutoring is now hours per week per the Clark State website. available through College is committed to help- Clark State Community physical and learning disabilities ing students with Students are strongly encour- succeed in their classes. in the disability services specialist aged to meet with before enrolling Rhodes Hall, Room 127 several weeks services. Students in classes to determine eligibility for with the disability who qualify for services must meet to arrange for services specialist before each quarter offered on a volun- their support services. Services are them. For more tary basis and the student must request Services information, please contact the Disabilities Office at 937/328-6019. The College Library Counseling Services Academic Services The Library is open Monday through Thursday, 8 Note: Requests for diplomas, transcripts and regis- Interlibrary Loan service is available to students, Interlibrary Loan service is available The Clark State Library is a member of OhioLINK, The Clark State Library is a member A validated Clark State student identification card A validated Clark State student identification Experienced counselors offer an array of programs and services to help you achieve personal growth and academic success. Personal counseling, career exploration and special topic groups are available free of charge. Counseling services are confidential. For more information, please stop by the Counseling Office, Rhodes Hall, Room 127, or call 937/328-6084. a.m.-9 p.m., Friday, 8 a.m.-5 p.m. and Saturday, 10 a.m.-3 p.m. Summer hours vary. Between academic quarters, hours are Monday through Friday, 8 a.m. - 5 p.m. The Library is closed when the College is closed. Please call 937/328-6022 for more information. tration for subsequent quarters may be rejected due to Library obligations. faculty and staff for locating and borrowing materials faculty and staff for locating and borrowing or available through not owned by the College Library from any OhioLINK OhioLINK. You may borrow books library with a validated Clark State ID card. the statewide network of automated library services the statewide network of automated library catalog and that provides access to a central over 100 electronic databases. serves as your library card and entitles you to full serves as your library card and with the Library borrowing privileges in accordance policies is avail- circulation policies. A copy of these able at the circulation desk and online. The Clark State Library, on the ground floor of the Library, on the ground floor of The Clark State Center, provides a variety of materi- Library Resource the to students, faculty, staff and als and services owns more than 35,000 books, community. The Library access to hundreds 300 periodicals with electronic material. The more and 2,000 pieces of audiovisual with access to the media center houses computers through OhioLINK. Internet and electronic databases at the reference Numerous handouts are available on getting started desk, as well as extensive information page at: with research on the library’s web http://lib2.clarkstate.edu/library/library.html. The following sections are intended to be an overview The following sections at Clark State. For more detailed of academic services the dean of Student Affairs. information, contact dent children of deceased or disabled Ohio War Vet- or disabled Ohio of deceased dent children Board of through the Ohio is made erans. Application Regents. 128 Student Services Division. these portfoliosareavailable intheArts&Sciences by membersoftheClark State faculty.Guidelinesfor ences, youmayputtogetherportfoliosthatareassessed If youwouldliketoearncreditforyourlifeexperi- self-confidence andagreatersenseofself-knowledge. career exploration.Theyareintendedtohelpyougain jects fromstudyskillstostressmanagementand These personalgrowthcoursescoveravarietyofsub- signed tosupportandenrichyouracademicwork. The CounselingOfficeoffersaseriesofcourses de- course. have madetoenableyousuccessfullycompletethe approval, youwillneedtoidentifywhatchanges take thecoursemorethantwice.Inordertoobtain sion. Areviewpanelwillbeconvenedifyouwantto grants andotherfinancialaid. full-time statusandareincludedinconsiderationfor average. Theydo,however,countinthecalculationof toward graduationorinyourcumulativegradepoint placement testsandbyyouyouradvisor. from thesedevelopmentalcourses. (algebra orchemistry,forexample),youwillbenefit area thatisanimportantpartofyourcollegeprogram in highschoolordonothaveanybackgroundan of years,didnotdevelopstrongbasicacademicskills you havebeenawayfromtheclassroomforanumber skills sothatyou’llsucceedincollege-levelclasses.If ing, writingandmathematicsaredesignedtobuild College preparatoryeducation(CPE)coursesinread- cation facultymemberat937/328-6073oryouradvisor. work. program allowsyoutoreceivecollegecreditforyour already employedinyourfieldofstudy,theCo-op and threetofivecollegecreditsperquarter.Ifyouare a half-dayandstudytheotherhalf.Youcanearnwages ment. Theparallelworkprogramallowsyouto full-time study,thenaquarterofemploy- a superiorlearningenvironmentforyou. academic learningandon-the-jobtrainingcancreate work experiencewithacademics.Thiscombinationof Cooperative EducationatClarkStatecombinespaid You mayrepeataCPEcourseoncewithoutpermis- College preparatoryeducationcoursesdon’tcount Placement intothesecoursesisdeterminedbythe For moreinformation,contacttheCooperativeEdu- The alternateworkprogramconsistsofaquarter College PreparatoryEducation Personal GrowthCourses Prior LearningPortfolio Cooperative Education toward anassociatedegree. point averageof3.5oraboveand18credithours a memberofPhiThetaKappa,youmusthavegrade to studentsofdistinguishedachievement.Tobecome tion intoPhiThetaKappaprovidesnationalrecognition activities whicheducate,stimulateandenrich.Induc- campus andthecommunitybysponsoringvarious ship andservicetonurtureitsmembers,the Kappa istopromotescholarship,leadership,fellow- was establishedin1987.ThepurposeofPhiTheta associate degree.ClarkState’schapter,AlphaNuLambda, States, CanadaandGermanyatcollegesofferingthe in 1918andhasover1,000chapterstheUnited the two-yearcollege.PhiThetaKappawasestablished Phi ThetaKappaistheInternationalHonorSocietyfor selor. you shouldspeakwithyouracademicadvisororcoun- you areinterestedinenrollinganhonorscourse, Phi ThetaKappaHonorsSocietytopicfortheyear.If We occasionallyofferhonorscoursesthatparallelthe at www.clarkstate.edu/wfd/. more information,pleasecall937/328-3855orvisitus barriers tosuccessthattheyoftenfaceasparents.For Services, thisprogramleadsstudentsinaddressingthe by theClarkCountyDepartmentofJobandFamily students whoaresupportingminorchildren.Funded programs andassistancetolower-incomeClarkCounty The StudentSuccessProgramofferssupport,special Student SuccessProgram Phi ThetaKappa Honors Campus Directory Clark

State

Want to know who’s who at Clark State? Our campus directory will introduce you to the Clark State family of employees. Campus Directory Campus

Clark State Community College GET SMART. 129 Academic Divisions Patrick Jacobs, Instructor L. R. Kelleher, Instructor, B.S., Wilmington College; M.Ed., Arts and Sciences Division Ohio University, CMfgE Certified Ronald A. Key, Dean, Associate Professor, B.A., Kentucky Thomas R. Oliver, Assistant Professor, B.S., Bethany College; Wesleyan College; M.A., University of Kentucky; Ed.D., M.B.A., University of Cincinnati University of Louisville Deborah S. Peairs, Self-Paced Lab Coordinator, B.S., Wright Susan E. Bayes, Administrative Assistant to the Dean State University Shirley L. Thomas, Administrative Support Glen A. Pottenger, Instructor, A.S., The Ohio State University/ Susan Thompson, Customer Service Specialist Agriculture Technical Institute Jim E. Anderson, Associate Professor, A.A.S., Clark State William P. Schindler, Professor, B.S., M.B.A., University of Community College; B.S., M.S., Wright State University Dayton Judith A. Anderson, Professor, B.A., Valparaiso University; Gregory G. Teets, Instructor, A.A.S., Sinclair Community M.A., Texas A & M University College David A. Anon, Interim Academy Commander, A.A.S., Clark Nancy D. Thornton, Associate Professor, B.S., M.Ed., Wright State Community College State University Laurie E. Buchanan, Assistant Professor, B.A., M.A., Ph.D., Theodore D. Toles, Instructor, B.F.A., Miami University Bowling Green State University Rebecca J. Wiggenhorn, Professor, A.A.B., Clark State Michelle Burch, Assistant Professor, A.A., Black Hawk Community College; B.S., Wright State University; M.A., Community College; B.A., M.A., University of Illinois Central Michigan University Thomas E. Drerup, Instructor, A.A., Sinclair Community College; B.A., Wright State University; M.A., Central Michigan University Health and Human Services Division Barbara B. Burcham, Dean, B.S.N., University of Rochester; Mildred V. Hall, Associate Professor, B.S., University of M.S., The Ohio State University Pittsburgh; ABD, Virginia Polytechnic Institute and State Julia Daniels, Administrative Support, A.A.B., Clark State University Community College David L. Hare, Assistant Professor, B.A., Capital University; Judy Adams, Instructor, R.N., Community Hospital School of M.S., Ohio University Nursing; B.A., Antioch University; B.S.N., Franklin Brian M. Heaney, Associate Professor, B.A., Yale University; University; M.S., University of Dayton M.A., The Ohio State University Mary Cornell, Instructor, R.N., Community Hospital of Jeff Koloze, Instructor, B.A., John Carroll University; M.A., Nursing; B.S.N., Franklin University Cleveland State University; Ph.D., Kent State University Susan Doubt, Instructor, B.S., Truman State University; M.S.N., Lynn M. Mealy, Professor, B.A., Marian College; M.Ed., Wright F.N.P., University of Missouri-Columbia State University Paulette D. Grodner, Associate Professor, A.A.S., Clark State David W. Miller, Assistant Professor, M.S., Wright State Community College; B.S.N., Franklin University; M.S., University; Ph.D., The Ohio State University Wright State University Fabian Novello, Assistant Professor, B.A., University of Illinois; Beth M. Gustafson, Instructor, B.S., Quinnipiac College M.S., Purdue University Pamela M. Healy, Curriculum Specialist/Mentor, B.S., The Ohio Robert T. Sweet, Associate Professor, B.A., Wright State State University University; M.A., University of Dayton; Sandra J. Horn, Associate Professor, B.S., Pikeville College; Ph.D., University of Cincinnati M.S., Central Michigan University Bridget C. Ingram, Assistant Professor, A.A.S., University of Business and Applied Technologies Division Akron; B.S., San Diego State University; M.Ed., Ashland Jane A. Cape, Dean, Assistant Professor, B.A., St. Francis University College; M.Ed., Bowling Green State University Cheryl B. Jefferies, Assistant Professor, A.A.S., Central Texas Stephanie L. Gaston, Administrative Assistant to the Dean College; B.A., Monterey Institute of International Studies; Jacquelyn Y. Robinson, Administrative Support B.S.N., M.S.N., Medical University of South Carolina Paulette Y. Saksa, Administrative Support Lawrence N. Killian, Professor, B.S., Cedarville University; B.S., Robert Adkins, Associate Professor, B.S., M.S., University of Central State University; M.S., Syracuse University; Ph.D., Toledo Wright State University Teresa R. Campbell, Assistant Professor, B.S., M.B.A., Wright Connie Mitchell, Instructor, R.N., Community School of State University Nursing; B.S.N., Franklin University Marilyn J. Carlson, Associate Professor, B.S., Central State Veronica L. Peters, Assistant Professor, B.S.N., Roberts University; M.Ed., Wright State University Wesleyan College; M.Ed., University of Central Oklahoma Susan F. Everett, Associate Professor, B.S., Virginia Polytechnic Leatha M. Ross, Assistant Professor, B.S., University of and State University; M.S., Mississippi State University; Maryland; B.S., M.S., F.N.P., Wright State University Ph.D., Iowa State University Mark P. Schmidt, Instructor, B.S., Purdue University, M.S., Charles R. Foley, Instructor, B.S.B.A., M.B.A., The Ohio State Wright State University University Racille G. Smith, Assistant Professor, R.N., The Community Dan J. Heighton, Professor, B.B.A., University of Cincinnati; Hospital School of Nursing; B.S.N., University of the State of M.B.A., Wright State University New York; M.S.Ed, University of Dayton Robyn M. Hennigan, RPR, Instructor, A.A.B., Clark State Lisa G. Stroth, Instructor, A.A.S., Shawnee State University; Community College B.S., Ashland University Reva Hutchins, Associate Professor, A.A., Clark State Donald B. Swabey, Instructor, LPN, EMT-P, A.A.S., Clark State Community College; B.A., Capital University; M.A., Ohio Community College Campus Directory State University; M.P.A., University of Dayton; Ph.D., Rebecca Tomlin, Instructor, R.N., Community Hospital School The Ohio State University of Nursing; B.A., Park College, Missouri 130 Kathleen Traub, Assistant Professor, R.N., St. Mary’s Hospital Peggy J. Marshall, Accounts Receivable Technician School of Nursing; B.S.N., M.S., Wright State University Kimberly L. Haddix, Accounts Payable/Purchasing Technician, Tammy Watt, Assistant Professor, B.S., Wright State University; A.A.B., Clark State Community College M.S.W., The Ohio State University Carrie L. Weinstiger, Accounts Receivable Technician Kathleen J. Wilcox, Associate Professor, A.A.S., Sinclair Community College; B.S.N., M.S., Wright State University Campus Police Department Lynnette Rodrigue, Director, Campus Police, A.A.S., Clark State College Departments Community College; B.A., Wright State University; M.A., University of Akron Academic and Student Affairs Office Eric Cline, Campus Police Officer I Marsha S. Bordner, Vice President of Academic and Student Mark Lopez, Police Officer II Affairs, B.A., M.A., Bowling Green State University; Ph.D., Tracy L. White, Campus Police Officer I The Ohio State University Vicki J. Martin, Assistant to the Vice President, A.S., Miami- Jacobs Junior College Career Services Mary M. Patton, Associate Professor, Director, Career Services/ Community Outreach, B.S., Lesley College; M.S., Western Academic Support Services Illinois University Julie Baumann, Tutoring Assistant, A.A.B., Clark State Dana L. Kapp, Career Services Technician, A.A., Three Rivers Community College Technical College, A.A.B., Clark State Community College James Henry, Testing Technician, B.S., Urbana University Maryrae Kearney, Disability Services Specialist, B.A., Macalester College; M.S.W., University of Iowa College Relations Kristin J. Culp, Director of College Relations, Executive Michael E. Sever, Advising & Articulation Coordinator, B.S., Director of the Foundation, B.A., Wittenberg University M.A., Wright State University Stephen R. Button, Graphic Artist, B.A., Wittenberg University Bonnie G. Young, Success Center Coordinator, A.A.S., Sinclair Troy Donnerberg, Marketing Specialist, B.S., Wright State Community College; B.A., Antioch University, McGregor University School Kimberly A. Frazier, Grants Writer, B.A., University of Cincinnati; M.A., Boston University Admissions Office Kathryn I. Sahle, Director of Marketing, B.A., Wright State Todd L. Jones, Director of Admissions, B.S., M.Ed., Miami University University Kimberly Y. Cole, Customer Services Specialist, A.A.B., Clark State Community College College Tech Prep Julie Schaid, College Tech Prep Coordinator, B.A., Miami Corey Holliday, Minority Recruitment/Retention Specialist, B.S., University; M.S., Central Michigan University; Ph.D., Cumberland College University of Dayton Patricia W. Shafer, Data Management Technician Melissa Griever, Tech Prep Technician Business and Industry Training Teresa A. Mabry, Director, Business and Industry, B.A., Computing Services Romy E. Lu, Director, Information Technology, B.S., Mapua Wittenberg University; M.S., University of Dayton Institute of Technology; M.B.A., M.S., Wright State Horace M. Gladney, Manager, Industrial Services, B.S., Kansas University State University; B.S., Mississippi State University; M.S., Air Christa Bostick, Administrative Support, A.A.B., Clark State Force Institute of Technology Community College Paulette Y. Saksa, Administrative Support Walter Bothe’, Computing Center Specialist, A.A.S., Kennedy- James W. Wahl, Program Manager, B.S., M.S., The Ohio State King College University; Ed.S., Wright State University Shane Bucher, Computer Technician Janine M. Dogan, Institutional Research Specialist, A.A.B., Bookstore and Office Services Clark State Community College, B.S., Wilberforce University Holly J. Snyder, Manager, Bookstore and Office Services, Eric N. Ebbs, PT Computer Technician, A.A.S., Clark State A.A.B., Clark State Community College; B.A., Antioch Community College University; M.S., Central Michigan University Hugh Evans, Network Specialist Ronald Applin, Shipping and Receiving Clerk Lynn Fernando, Manager, Administrative Systems, B.S., Susan M. Elliott, Bookstore Clerk University of Moratuwa, Sri Lanka, M.S., Bowling Green Cynthia M. Hill, Bookstore Buyer State University, Ohio

Tina D. Pacine, Office Services Clerk Directory Campus James W. Gossett, PC/Network Manager, B.S.E.E., The University of Cincinnati; M.B.A., Wright State University Business Affairs Office Steve D. Hurley, Web Administrator Joseph R. Jackson, Vice President for Business Affairs, B.B.A., Laurie S. Means, Web Developer, A.A.B., Clark State Ohio University Community College Angela D. Edwards, Assistant to the Vice President Tim Newberry, Computer Technician, A.A., ITT Technical Institute Business Office Bryan E. Phelps, Senior Computer Technician, A.A., Devry Dixie A. Depew, Controller, B.S., The Ohio State University Institute of Technology Tambry L. Kegley, Staff Accountant, A.A.B., Clark State Shirley K. Schetter, Systems Administrator Community College Wali S. Shamsid-Deen, Computer Technician, A.A.S., Devry Institute of Technology 131 Conference Services Performing Arts Center Margaret A. Watson, Administrative Assistant Katherine L. Eckstrand, Director, Performing Arts Center, B.A., Wilmington College; M.A., DePaul University Continuing Education Lori M. Common, Administrative Assistant Richard A. Starr, Director of Continuing Education, Associate Karen Clark, House/Operations Manager, B.S., University of Professor, A.B., Eastern Kentucky University; M.A., Ball State Montevallo University Beth Dixon, Community Outreach and Education Specialist, Paulette Y. Saksa, Administrative Support B.A., Miami University James D. Hunt, Technical Director and Assistant Professor, Counseling Office B.A., Wilmington College; M.A., Miami University Kandyce K. Meo, Director of Counseling & Academic Support Mary I. Libecap, Community Outreach/Education Director, Services, Professor, B.S., Fairmont State College; M.A., West B.F.A., Wright State University Virginia University; Ed.D., Virginia Polytechnic Institute and Geoffrey Moss, Assistant Technical Director, B.F.A., Wright State University State University Debra E. Ingling, Administrative Assistant, A.A.B., Clark State Jock Pierman, Assistant Technical Director, A.A., Southern Community College Ohio College Mary L. Pirozok, Associate Professor, A.A.S., Clark State Marylu Shobe, Box Office Manager Community College, B.S., Antioch University; M.S., Wright Petra Thompson, Assistant Box Office Manager State University Physical Plant Distance Learning Judy K. Ramirez, Head Custodian Elaine M. Shillito, Professor, Instructional Development Joseph C. Brewer, Custodian Specialist/Distance Learning Coordinator/WebCT Katrina Davis, Custodian Administrator, B.A., Wright State University, M.A., W. Scott Donaldson, Custodian University of Dayton, WebCT Certified Trainer, University Robert Dyke, Custodian of Wisconsin-Madison, Professional Development Certificate Helen R. Frazier, Custodian in Distance Education Tina Holloway, Custodian John T. Lyons, Maintenance Worker Financial Aid Office Mark A. McCarty, Maintenance Worker Renee Young, Customer Service Specialist, A.A.B., Clark State Richard Moore, Custodian Community College Wendy Neumann, Custodian Kathy Schuler, Financial Aid Specialist, B.A., Wright State Gregory Ping, Custodian University John L. Smith, Jr., Custodian, Maintenance Worker, HVAC-R Certification Beverly A. Stevens, Financial Aid Specialist, A.A.B., Clark State Kent C. Thomas, Custodian Community College; B.S., Wilberforce University Charleen Y. Webb, Housekeeper Grounds Amanda S. Honeycutt, Manager, Grounds, A.A.S., Clark State President’s Office Community College Karen E. Rafinski, President, B.S., Moorhead State University; Richard F. Cochenour, Groundskeeper/Custodian, A.A.S., Clark M.S., University of Washington; M.P.A., Harvard University; State Community College Ph.D., University of Minnesota Mellanie K. Weaver, Assistant to the President, A.A.S., Bradford School of Business Health Clinic Roberta Richards, Health Clinic Nurse, B.S.N., University of Akron Receptionists Joanne M. Lemmons, BEC Receptionist Kay Estep, Leffel Lane Evening Receptionist Human Resources Kristen Kimley, BEC Evening Receptionist Ronald E. Connally, Manager, Human Resources, A.A., Katherine S. Trout, BEC Evening Receptionist Community College of the Air Force, B.S., Wright State University Teresa Kelble, Payroll Technician, B.S., Wright State University Records and Registration Office Mary H. Murphy, Human Resources Specialist II Linda E. Rueger, Records Clerk, A.A.B., Clark State Community College; B.A., Capital University Susan D. Zelinski, Student Records Specialist, A.A.B., Clark Library State Community College Carol Brown Wittig, B.A., The University of Akron, M.A., The University of Akron, M.L.S., Kent State University G. James Hebner, Media Services Specialist, A.A.S., Monroe Student Affairs Community College Thomas K. Marshall, Dean of Student Affairs and Enrollment Angela R. Henry, Library Reference Assistant, B.A., Ohio Management, B.S., M.S., Southern Illinois University; Ph.D., Ohio University University Melissa B. Hunter, Technical Services Specialist, B.A., Antioch Wendy R. Cromer, Activities Assistant, BFA, Ohio Northern University - McGregor University Catherine L. Wilson, Circulation Specialist, B.A., Wright State Debra E. Ingling, Administrative Assistant, A.A.B., Clark State Campus Directory University Community College

132 Student Support Services Criminal Justice Leigh A. Fisher, Project Director, B.A., Wittenberg University; Sheriff David Deskins M.S., Wright State University Sheriff Gene Kelly Nita Renfrow, Academic Coordinator, B.S., Bowling Green State Chief Brad Kunze University, M.S. Ed., University of Dayton Chief Dave Newman Chief Lynette Rodrigue Truck Driver Training Institute Gil Weithman R. Joseph Uebel, Director Mary Bullwinkel, Administrative Support Early Childhood Education Merrill E. Bageant, Recruiter Tori Ashley, The Early Childhood Education Center Dennis R. Bailey, Trainer Charlotte Boehm, CGCAYC Tammy Colaric, Trainer Kathy Brandle, Brandle’s Jumping Jack Gregory Fisher, Trainer Tammie Jacobs, Springfield Family YMCA Terrance King, Trainer Diann Johnson, Miami Valley Head Start Ronald A. Langford, Trainer Debra Kimble, The Early Childhood Education Center Otis J. Lowe, Trainer Cathy Linquist, Bright Beginnings James A. Rosen, Classroom Trainer, B.S., Wright State Alix Payton, The Early Childhood Education Center University Margie Starr, Christian Edu-Care Charles Thompson, Training Site Operations Supervisor Nikki Tackett, Christian Edu-Care Marti Ventelo, CGCAYC Advisory Committees Sandy West, Miami Valley Head Start Accounting Sandra Ballard, Cooper Industries EMS/Paramedic Erik Scheiderer, Mercy Medical Center Robert Dwyer, Family Services of Clark/Champaign County Lt. Ray Krug, Springfield Fire & Rescue Julie Griffin, Taylor, Applegate, Hughes & Associates Teri Norris, Community Hospital Connie Henson, AdCare Health Systems Annette Nathan, M.D., Community Hospital Marianne Hinson, Rittal Corporation David Devore, MedTrans EMS Denny Kummerer, Speedway/SuperAmerica Sam Barnes, Springfield-Clark JVS Charles Morris, Retired Chief Michael Beers, Springfield Fire & Rescue Joseph Kelly, Chairman, Smiling Bob Paramedic Memorial Fund Agriculture Business/Horticulture Industries Chief Mike Ludwick, Clark County Fire Chiefs Pam Bennett, Clark County Extension Office Dennie Powell, Greene Memorial Hospital Tim Brennan, Brennans Lawn Maintenance Frank Giampetro, Mercy Memorial Hospital Pam Call James Corbet Ron Cramer, The Siebenthaler Company Engineering and Industrial Technology Marsha Allen, Grimes Aerospace Thomas Dietrich John Franko, Westpatt Chris Goecke, WGC Golf Course Bob Freeze, Springfield JVS Michelle Griffith Ed Leventhal, Valco Gary King, Ohio AgriBusiness Association Art Maupin, Maupin & Associates Jaimee Nirider, Scarff’s Nursery, Inc. Beau May, Rittal Brian Peach, Ohio AgriBusiness Association Jeff Powell, OSMI Dave Perrin, Mechanicsburg High School Gordon Quinn, Consultant Pam Pilgrim, Stutzman’s Nursery Garden Center and Dale Stemen, Siemens Landscaping Reginal Trass, Navistar Fred Schommer Michael Williams, Eagle Tool & Machine Co. Dale Sloan, Sloan’s Ag Consulting Adam Steele, Skillings Supplies Gordon Wallace, Southwest Landmark, Inc. Graphic Design Carol Whitford Stephen Button, Clark State Community College Joan Corbit, Antioch Publishing Company Gregory DeGroat, Dayton Daily News Business Management Gary Detrick, Springfield News-Sun Tammy Adkins, Speedway-Super America Danielle Driscoll, Rittal Corporation

Darlene Carpenter, Morgan Machine Tool Company Directory Campus Andrea Hubler John Femiani, Rittal Corporation Judith Fazio Glenda Greenwood, Security National Bank Mike Hughes, WPAFB Larry Hill, Express Personnel Services Bev Kitchen Jeffrey Powell, Ohio Stamping and Machine, Inc. Linda Metzger, Springfield, Clark County JVS Randy Scott, Speedway-Super America Lilian Nichols, Copeland Corporation Chet Walthall, Heat Treating, Inc. Richard Wagner, Clark State Community College

133 Information Technology Systems Practical Nursing/Registered Nursing Jesse Carringtion, WPAFB Wilma Beckner, Mercy Medical Center Randall Cook, Sumaria Systems, Inc. Ann Jacobson, Mercy Medical Center Ann Gallaher, Greater Dayton IT Alliance Connie Cleavenger, Clark County Mental Health James Gossett, Clark State Community College Melissa Browning, Greene Memorial Hospital Steve Hurley, Clark State Community College Terry Pope, Community Hospital Kathy Limes, Springfield Clark County JVS Angie Nicewaner, Masonic Health Care,Inc. Randy Martin, Reynolds & Reynolds Mary Ann Roberts, Community Hospital William McGregor, Navistar International Gilda McKenzie, St. John’s Center James McKitrick, Lion Apparel Robin Cornett, McAuly Center Mary Meadows, NCR Corporation Carol Story, Villa Springfield Edith Newell, Springfield Clark County JVS Barbara Ludwick, RN, BSN, Community Services Nursing Randy Scott, Speedway-SuperAmerica Steve Baltima, Madison County Hospital Sheila Hiddleson, Clark County Combined Health District Medical Laboratory Technology Stacey Smith, Alumni Representative – LPN Program John Bobblett, M.B.A., MT (ASCP), Community Hospital Heidi Fernung, Alumni Representative – RN Program B. Laurel Elder, Ph.D., CompuNet Clinical Laboratories Bonnie Gardiner, Fayette Memorial Hospital, Connorsville, Realtime Reporting Indiana Lisa Beair, Clark State Community College Alice Liggett, Memorial Hospital of Union County Paula Blosser, Britton & Associates Phyllis Pacifico, Ed.D., MT (ASCP), Wright State University Jeanette Calhoun, Clark County Court of Common Pleas Ralph Sanders, St. Vincent Randolph Hospital, Winchester, Thomas Capper, Clark County Court of Common Pleas Indiana Kimberlee Collins, Collins Reporting Service Gerri Skelly, MT (ASCP), Mercy Medical Center Lisa Conley, Spangler Reporting Services Dr. R. V. Stewart, Mercy Medical Center D. Kay Frazier, Clark State Community College Beverly Wolfe, Miami Valley Career Technology Center Kimberly Frazier, Clark State Community College Christine Marr, Professional Reporters, Inc. Office Administration John Marr, Columbus State Community College Vicki Berg, Oakwood Village Margaret Marsh, Fraley, Cooper & Associates Kathy Borgwald, Speedway SuperAmerica LLC Bruce Matthews, United States District Court Bonnie Davis, The Heart House Michael Mobley, Mike Mobley Reporting Kristina Downing, Express Personnel Services Todd Mobley, Mike Mobley Reporting Heather Dunham Lisa Niles, Esquire Danielle Finch Lynn Peterson, Stenograph Corporation Cheryl Holder, Physicians and Surgeons for Women, Inc. Kimberly Ramey, Mike Mobley Reporting Teresa Hoyt, Rittal Corporation Debbie Smith, Springfield Public Schools Crystal Long, Pentaflex, Inc. Barb Marshall, Medical Professional Resources Social Services Megan Middleton Julie Amos, Mueller Residential Center Jill Pierce, City of Springfield Marjorie Baker, Wright State University Cindy Savage, Manpower Temporary Services Mike Berner, Lifeway for Youth Vinnie Butler, Ohio Masonic Home Physical Therapist Assistant Wendy Dixon, Clark County Dept. Job & Family Services Janis Anthes, P.T., Mercy Medical Center Lyvonne Goings, Ben El Developmental Center Rayna Coss, PTA, CSCC graduate Holly Hester, Greene County Juvenile Court Mark Main, P.T., Springfield Physical Therapy Jo Hill, Springfield Urban League Cole VanSchoyck, P.T., Mercy Medical Center Robin Johnson, Capital University Sharmaine Workman, P.T., The Community Hospital Ann Lite, CARE Richard Hancock, PTA, CSCC graduate Jim Schwind, Mary Rutan Hospital Betsy Filmore, Ph.D., PT PCS, Andrews University Jim Smith, Champaign County Dept. of Job & Family Services Jennifer Rossi, PT, OCS, Sportsmedicine Grant & Orthopedics Dr. Janet Toy Associates Will Wright, Logan Champaign Consolidated Care Campus Directory

134 Index Course Descriptions 68-111 Fresh Start 114 Ability-to-Benefit 113 Course Numbering System 69 General Education 4 Academic Advising 116 Credit Equivalencies 122 Global Awareness 122 Academic Divisions 130 Credit Hour, Definition of 121 Golf Course Maintenance Option Academic Misconduct 120 Credit Hour Limit 117 see Horticultural Industries 22 Academic Policies 120 Credit Hour Probation 125 Grade Point Average Academic Progress 125 Credit Hour Requirements 125 see Grading System 121 Academic Services 127 Credit/No-Credit Enrollment 118 Grade Point Probation 125 Access to Educational Records 119 Criminal Justice 15 Grade Reports 120 Accounting 19 Cross Registration within SOCHE 117 Grading System 121 Accounting Certificate 20 Dean’s List 120 Graduation Process 122 Accreditations/Approvals 3 Delayed Payment Plan Graduation Requirements 122 Adding Courses 117 See Payment 118 Grants Admissions Policy 113 Directory, Campus 129 see Financial Aid 123 Admissions Process 113 Disability Services 127 Graphic Design 35 Advising, Academic 116 Dismissal 121 Guiding Principles 2 Advisory Committees 133 Distance Learning 3 Health Technologies Admissions 115 Agricultural Business 21 Dropping Courses 117 History of the College 2 Articulation Agreement, Statewide 6 Early Childhood Education 49 Honors 128 Assessment of Student Academic Early Childhood Education Horticultural Industries 22 Achievement: Improving Student Administration 51 Golf Course Maintenance Option 22 Learning 3 Early Childhood Education Landscaping and Nursery Operations Associate of Arts 11 Departmental Certificates 52 Option 23 Associate of Science 12 Educational Costs 126 Turf and Landscape Maintenance Associate of Technical Studies 4 Electrical Maintenance Technology Option 23 Attendance 120 see Industrial Technology 31 Human Services Auditing a Course 117 Electronic Business see Social Services 66 Basic Peace Officer Training Academy 13 see Business Management 24 Incomplete 122 Broadcast Captioning/CART Options 47 Emergency Medical Services 53 Industrial Technology 31 Business Management 24 Emergency Medical Services Electrical Maintenance Certificate 32 Electronic Business 25 Departmental Certificates 54 Electronics Certificate 32 Business Management Certificate 26 Emergency Medical Services/ Industrial Technology 31 Business Management Departmental Paramedic Certificate 54 Information Technology Systems 36 Certificates 27 Employment Computer Software Development 36, 37 CAD Drafting Technology 28 see Career Services or Work-Study Network Administration 38, 40 Calendars Inside front cover Program 125, 127 Technical Support 39 Career Services 127 Engineering Transfer 30 International Student Admission 113 Career Technical Center Graduates 114 English Proficiency 115 Judicial Reporting 45 Cash Refund Policy 118 Enrollment Categories 113 Landscaping and Nursery Operations Certificate Programs 4 Entrance Exams 114 Option Change of Major 117 Facilities 3 see Horticultural Industries 22 Cheating Federal Subsidized Stafford Loan Late Fees see Academic Misconduct 120 Program 124 see Fees 118 College Departments 131 Federal Supplemental Educational Law Enforcement College Preparatory Education 128 Opportunity Grant (FSEOG) 124 see Corrections or Criminal College Tech Prep Students 114 Federal Unsubsidized Stafford Loan Justice 14, 15 Computer-Aided Design Certificate 29 Program 124 Legal Assisting 41 Computer Literacy 121 Fees 118 Library 127 Computer Software Development Financial Aid 123 Loans Departmental Certificate 37 Financial Aid Appeals Process 125 see Financial Aid 123 Cooperative Education 128 Financial Aid Refund Policy 125 Major, Change of Corequisites 69 Financial Aid Suspension 125 see Change of Major 117 Corrections 14 Financial Aid Vouchers 124 Manufacturing Certificate 34 Counseling Services 127 Foundation, Clark State 126 Manufacturing Engineering Technology 33

135 Maps, Campus Inside back cover Refund Policy 118 Medical Laboratory 55 Refund Schedule 119 Medical Office Administration Registered Nursing 62 see Office Administration 42 Registered Nursing-Evening 64 Military Training, Credit for Registration Information 116 see Credit Equivalencies 122 Reinstatement for Health and Human Mission Statement 2 Service Programs 116 Mumma Loan 124 Release of Information 120 Nursing, Licensed Practical Repeating Courses 117 see Practical Nursing 61 Residency 119 Nursing, Registered Scholarships 126 see Registered Nursing 62 Senior Citizens Program 113 Nursing Transition LPN to RN 57 SOCHE 117 Office Administration 42 Social Services 66 Medical Office Administration 43 Social Services Departmental Office Administration Certificate 44 Certificates 67 Office Administration Departmental Spaced-limited Programs 115 Certificates 44 Student Classification 122 Ohio Instructional Grant (OIG) 124 Student Records 119 Ohio Part-time Student Instructional Student Services 112 Grant Program (OIP) 124 Student Success Program 128 Paralegal Technology Success Center 127 see Legal Assisting Technology 41 Technical Degrees 4 Paramedic Certificate 54 Theatre Arts 17 Paramedic Certification for RNs 54 Theatre Arts Departmental Certificate 18 Parents' Loans for Undergraduate Transcripts 119 Students (PLUS) 124 Transfer Appeals Process 7 Parking 119 Transfer Credits 122 Payment 118 Transfer Degrees 5 Pell Grant 124 Transfer Module 6, 7 Personal Growth Courses 128 Transfer Students 113 Phi Theta Kappa 128 Tuition 118 Photography Certificate 16 Turf and Landscape Maintenance Physical Therapist Assistant 59 see Horticultural Industries 22 Placement Testing 114 Tutoring 127 Police Academy Vision Statement 2 see Basic Police Officer Training Vocational High School Graduates 114 Academy 13 see Career Technical Center Portfolios Graduates 114 see Prior Learning Portfolio Waiting List Process Post-Secondary Enrollment Options see Health Technologies Program 113 Admissions 115 Practical Nursing Certificate 61 Withdrawals 125 Prerequisites 69 Work-Study Program 125 Preschool Education Writing Lab see Early Childhood Education 49 see Success Center 127 Prior Learning Portfolio 128 Probation, Academic 12 Probation, Financial Aid see Academic Progress 125 Proficiency Examinations see Credit Equivalencies 122 Re-admission 114 Records, Student 119

136 faculty, staff, visitor and handicap parking SR 41 High St S N Springfield W E Inn parking Brinkman Educational S Student Center parking is shaded. Washington St RR E. Main St. E. High St. Brinkman Educational Center Performing Arts Center S. Limestone SR 72 to 68 N St. Spring Downtown student and St. Campus seminar parking Selma

Fountain Ave Rd. Performing Arts Center South H.S. Clark State

Monroe St S Limestone St Community Spring St

Pleasant St Grand Ave. College

S Limestone St (SR 72 S) to Interstate 70 Springfield, Ohio

S. Fountain N Downtown Campus Ave. W E S Leffel Lane Campus John St.

To John Street student Campus parking Shull Hall S. Limestone St. Police SR 72 Carter Way Shull tennis court Applied tennis courts Hall student parking Science Campus Library Resource Police Center Center Riley Way E. Leffel Ln. Rhodes Hall

Maintenance building student parking I 70 student parking SR 72 Gym faculty/staff parking student/visitor Applied and seminar Science parking Center Between the campuses

student receiving faculty/staff parking area - no parking parking student handicap faculty/staff parking parking Library student Resource parking Center

handicap Rhodes Hall faculty/staff motorcycle van and handicap parking parking parking

handicap Student parking parking is shaded. visitor and handicap Springfield, parking

East Leffel Lane Ohio Leffel Lane Campus