Produktinformation

Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien

Weitere Information auf den folgenden Seiten! See the following pages for more information!

Lieferung & Zahlungsart

Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic SDPR (Human) Recombinant Gene Symbol: SDPR

Protein (P01) Gene Alias: PS-p68, SDR

Catalog Number: H00008436-P01 Gene Summary: This gene encodes a calcium-independent phospholipid-binding protein whose Regulation Status: For research use only (RUO) expression increases in serum-starved cells. This protein is a substrate for protein kinase C (PKC) Product Description: Human SDPR full-length ORF ( phosphorylation and recruits polymerase I and transcript NP_004648.1, 1 a.a. - 425 a.a.) recombinant protein with release factor (PTRF) to caveolae. Removal of this GST-tag at N-terminal. protein causes caveolae loss and its over-expression Sequence: results in caveolae deformation and membrane MGEDAAQAEKFQHPGSDMRQEKPSSPSPMPSSTPSP tubulation] SLNLGNTEEAIRDNSQVNAVTVLTLLDKLVNMLDAVQE NQHKMEQRQISLEGSVKGIQNDLTKLSKYQASTSNTV SKLLEKSRKVSAHTRAVKERMDRQCAQVKRLENNHA QLLRRNHFKVLIFQEENEIPASVFVKQPVSGAVEGKEE LPDENKSLEETLHTVDLSSDDDLPHDEEALEDSAEEKV EESRAEKIKRSSLKKVDSLKKAFSRQNIEKKMNKLGTKI VSVERREKIKKSLTSNHQKISSGKSSPFKVSPLTFGRK KVREGESHAENETKSEDLPSSEQMPNDQEEESFAEG HSEASLASALVEGEIAEEAAEKATSRGSNSGMDSNIDL TIVEDEEEESVALEQAQKVRYEGSYALTSEEAERSDG DPVQPAVLQVHQTS

Host: Wheat Germ (in vitro)

Theoretical MW (kDa): 73.6

Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information)

Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols

Preparation Method: in vitro wheat germ expression system

Purification: Glutathione Sepharose 4 Fast Flow

Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID: 8436

Page 1/1