Supplementary Materials for

Blood single cell immune profiling reveals the interferon-MAPK pathway mediated adaptive immune response for COVID-19

Lulin Huang1,2,3*, Yi Shi1,2,3*, Bo Gong1,2,3*, Li Jiang1,2*, Xiaoqi Liu1,2,3, Jialiang Yang1,2, Juan Tang4, Chunfang You4, Qi Jiang5, Bo Long5, Tao Zeng6, Mei Luo6, Fanwei Zeng7, Fanxin Zeng7, Shuqiang Wang8, Xingxiang Yang8, Zhenglin Yang1,2,3, #

#Correspondence should be addressed to: Zhenglin Yang, Email: [email protected] (Z.Y).

This PDF file includes: Materials and Methods Figs. S1 to S15 Tables S1 to S10

Other Supplementary Material for this manuscript includes the following:

External Databases S1-4

All sequencing data will be deposited to public database and can be accessed online through a web portal. Materials and Methods

Sample collection For single cell analysis, 10 COVID-19 patients were included in this study, and the basic information of the included samples is shown in Table S1. All ten patients were collected in Sichuan Province.

Among the COVID-19 patients, their onset time is January 2020, and their age is between 20-62 years old, including five males and five females. Among them, Patient 2, Patient 5 and Patient 10 work or study in Wuhan and return to Sichuan.

Patient 11 worked in Huangmei County, Hubei Province and returned to Sichuan. Patient 9's son-in-law flew from

Wuhan to Sichuan on January 18, 2020, and got in touch with her. The plane of Patient 7 is from Haikou to Chengdu.

The previous flight of the plane was from Wuhan to Haikou. Patient 1 and Patient 3 live in Jiangxi for a long time, driving from Jiangxi to Sichuan. Patient 4 attend a meeting in Changsha from January 18 to January 21, and then return to Sichuan. Patient 8 is the local resident population and has never been to Wuhan. The samples were collected between the 3rd and 23rd day of their course, including one critical case, one server case and six moderate cases, including two cured patients. CT images of the lungs of these patients are shown in Fig.S1. The study also included three normal people

(Table S1). In order to exclude the immune response of other infectious diseases and basic diseases and find the unique immune response of patients with 2019-nCoV, we also included one case of influenza A, one case of acute pharyngitis and one case of cerebral infarction as other controls (Table S1).

Human Blood Samples PBMCs isolation

All experiments using human samples in this study were approved by the Ethics Committee of Sichuan Provincial

People’s Hospital (approval no. 2020(95)). Informed consent was obtained from all donors. Fresh whole blood from

COVID-19 patients, and unrelated controls donors was collected in 2-mL tubes containing ethylene diamine tetraacetic acid (EDTA). Peripheral blood mononuclear cells (PBMCs) were isolated from whole blood within 8 h of sample collection by using 15ml tubes with Lympholyte® cell separation media (CEDARLANE) according to the manufacturer’s instructions. Briefly, each blood sample was diluted with an equal volume of 1X PBS (pH7.4) added into a 15ml tube, and centrifuged at 800 × g for 20 min at room temperature. Enriched cells were washed with PBS and centrifuged at 800 × g for 10 min for twice. Cell numbers and viability were measured using a Countess II Automated Cell Counter (Thermo Fisher Scientific).

Chromium Single Cell V(D)J Libraries Preparation and sequencing

Chromium Single Cell V(D)J libraries were prepared according to the instructions. In brief, GEMs are generated by combining barcoded Single Cell VDJ 5’ Gel Beads v1.1, a Master Mix with cells, and Partitioning Oil on Chromium

Next GEM Chip G. Immediately following GEM generation, the Gel Bead is dissolved and any co-partitioned cell is lysed. Incubation of the GEMs produces 10x Barcoded, full-length cDNA from polyadenylated mRNA. GEMs are broken and pooled after GEM-RT reaction mixtures are recovered. Silane magnetic beads are used to purify the 10x

Barcoded first-strand cDNA from the post GEM-RT reaction mixture, which includes leftover biochemical reagents and primers. After cleanup a user may decide to pursue target enrichment directly from firststrand cDNA, in which case, consult Demonstrated Protocol - Chromium Single Cell V(D)J Reagent Kits-Direct Target Enrichment (Document

CG000166). Amplification generates sufficient material to construct multiple libraries from the same cells, e.g. both T cell and/or B cell enriched libraries and 5’ Expression libraries. Qubit was used for library quantification before pooling. The final library pool was sequenced on the Illumina novaseq instrument using 150-base-pair paired-end reads.

Single-Cell Data Processing

Analysis pipelines in Cell Ranger version 3.0.2 (updated version was used for the 5′ single-cell and TCR/BCR libraries from version 2.1.0 used for the 3′ single-cell libraries) were used for the sequencing data processing. TCR/BCR data were processed by running cellranger vdj with–reference = refdata-cellranger-vdj-GRCh38-alts-ensembl-2.0.0 to assemble TCR/BCR chains and determine clonotypes. Transcriptome data were processed by running cellranger count with– transcriptome = refdata-cellranger-GRCh38-1.2.0.

The output of cellranger aggr was loaded into R by using Seurat v3 (https://satijalab.org/seurat/) for cell cluster and differentical expressed gene analysis between sample groups. The Seurat 3V was used for cluster high-quality population cells and cell clustering (FindClusters) and tSNE visualization (RunTSNE). For the cell clustering results of Seurat, the overall correlation between cell groups and PCA analysis were carried out, and then the bimod likelihood ratio statistical test of Seurat V3 was used to screen the specific differential expression of different cell groups, which met the requirements of pvalue < = 0.05 and more than 2 times differential expression range to screen the differential genes between the designated cell group and other cell groups. For the differentially expressed genes screened from the designated cell group and other cell groups, two-way hierarchical clustering was used to cluster genes and samples, and the clustering parameters (distance metric: Pearson correlation) were displayed by thermogram; Linkage rule: average linkage). The screening basis of cell group specific expression genes is the significant up-regulated expression genes belonging to this cell group and not the up-regulated expression genes belonging to other cell groups. The thermogram only shows that the top 10 genes rank in terms of the average expression amount of this cell group compared with the difference amplitude of other cell groups.

The t-SNE coordinate information of projection_TSNE_SC.csv, or the UMAP coordinate information of projection_UMAP_SC.csv, and the clustering category information of clusters_SC.csv can be imported into cloupe to use the loupe cell browser for visualization.

Pseudotime Analysis

Monocle 2 (version 2.4.0) was used to estimate a pseudo temporal path of cell differentiation (35). Cells clustered in

TC1 and TC2 by Cell Ranger analysis pipelines were loaded to create a Monocle object using the new Cell DataSet function implemented in Monocle 2. Based on all the differentially expressed genes of cell class, DDRTree method is used to reduce the dimension and build the minimum spanning tree. Then, single cells are searched for the optimal sequence in high and low dimension space to fit the optimal cell development or differentiation curve. If the number of cells reaches more than 20000, 20000 representative cells are randomly selected for the following analysis. Analysis of interaction network of target gene set The protein interaction network of this species was queried and downloaded from the STRING protein interaction network database using with values/ranks - functional enrichment analysis. Due to the large number of differential expressed genes between patients and controls, the differential expressed genes with FDR

Integration analysis with TCR / BCR clone According to the clone type obtained by TCR or BCR sequencing, TCR / BCR sequencing corresponds to the cell marker sequence sequenced by 5-terminal transcripts one by one, and the cells without clone type are filtered. Based on the binomial distribution test, the clone types satisfying p value < = 0.05 are screened for significant differences in cell types. For the different clone types, it is shown in UMAP map.

Real time PCR RNA was extracted from patients’ PBMC. The following primers were designed for amplification genes. GAPDH was used as internal reference. Applied Biosystems™ SYBR™ Green was used for real time PCR analysis in 7500 Fast

Instrument (Applied Biosystems®) according to the instructions.

Realtime PCR Primers:

IFI27-forward primer: GGCCAGGATTGCTACAGTTG

IFI27-reverse primer: GAGTCCAGTTGCTCCCAGT

BST2-forward primer: GTGATGGAGTGTCGCAATGT

BST2-reverse primer: TTTGTCCTTGGGCCTTCTCT

FOS-forward primer: GCTGACTGATACACTCCAAGC

FOS-reverse primer: GGGAAGCCACAGACATCTCT

Immunohistochemistry and fluorescence microscopy PBMC smears were used for immunohistochemistry. We used 1× PBS to wash the smears three times. The tissue sections were then subjected to blocking using blocking buffer (5% normal donkey serum, 0.3% TritonTM X-100, and 1× PBS) for 1 hour at room temperature. The sections were then incubated with primary antibody rabbit polyclonal anti-IFI27 in blocking buffer at 4°C overnight. Alexa 488-conjugated anti-rabbit secondary antibody (diluted 1:500; Molecular Probes) was incubated for 2 hours at room temperature. Nuclei were visualized by counterstaining with DAPI in secondary antibody buffer. Finally, the tissues were washed with PBS, mounted and allowed to cure overnight at 4°C. Images were visualized using Zeiss LSM 710 confocal microscopes. Fig. S1 Lung CT images from ten patients with COVID-19. CT features of COVID: ground glass like changes were identified in the lungs.

Fig. S2 Trajectory of differentiating PBMCs of 56 cell subtypes. Fig. S3 Violin map and distributed cell subtypes of 23 newly identified marker genes. Fig. S4 Differential expression patterns of viral mRNA genes in COVID-19 patients vs controls. A. Critical VS normal. B. Server VS normal. C. Moderate VS normal D. Cured VS normal E. SARS-COV-2 vs normal F. SARS-COV-2 vs influenza A G. SARS-COV-2 vs acute pharyngitis H. SARS-COV-2 vs cerebral infarction Fig. S5 viral mRNA gene expression in 56 cell subtypes. Fig. S6 Differential expression patterns of interaction alpha / beta signaling genes in patients with COVID-19 vs other diseases. A. SARS-COV-2 vs influenza A B. B. SARS-COV-2 vs acute pharyngitis C. SARS-COV-2 vs cerebral infarction Fig. S7 mRNA gene expression in 56 cell types of interaction alpha / beta signaling. Fig. S8 Differential expression patterns of MAPK signaling genes in patients with COVID-19 vs other diseases. A. SARS-COV-2 vs influenza A B. SARS-COV-2 vs acute pharyngitis C. SARS-COV-2 vs cerebral infarction Fig. S9 mRNA gene expression in 56 cell subtypes of MAPK pathways. Fig. S10 Differential expression patterns of immunoregulatory interactions between a lymphoid and a non-lymphoid cell and cytolysis genes in patients with COVID-19 vs controls. A. Critical VS normal. B. Server VS normal. C. Moderate VS normal D. Cured VS normal E. SARS-COV-2 vs normal F. SARS-COV-2 vs influenza A G. SARS-COV-2 vs acute pharyngitis H. SARS-COV-2 vs cerebral infarction Fig. S11 mRNA gene expression in 56 cell subtypes of immunoregulatory interactions between a lymphoid and a non-Lymphoid cell and cytolysis genes. Fig. S12 Differential expression patterns of MHC class genes in patients with COVID-19 vs controls. A. Critical VS normal. B. Server VS normal. C. Moderate VS normal D. Cured VS normal E. SARS-COV-2 vs normal F. SARS-COV-2 vs influenza A G. SARS-COV-2 vs acute pharyngitis H. SARS-COV-2 vs cerebral infarction Fig. S13 MHC class gene expression in 56 cell subtypes. Fig. S14 Enriched pathways in COVID-19 vs other diseases. A. SARS-COV-2 vs influenza A B. SARS-COV-2 vs acute pharyngitis C. SARS-COV-2 vs cerebral infarction Fig. S15 Evolutionary conservation analysis of top TCR- and BCR-produced antibodies. A. TCRA, B, TCRB, C, IGL, D, LGK and E, IGH. Table S1 Clinical information ten patients with COVID-19 patients and six controls.

Patient Patient 1 Patient 2 Patient 3 Patient 4 Patient 5 Patient 7 Patient 8 Patient 9 Patient 10-Cur Patient 11-Cur Patient 12-FluA Patient 13-Pha Patient14-CIS Normal-1 Normal-2 Normal-3

Disease condition Critical Server Moderate Moderate Moderate Moderate Moderate Moderate Cured Cured Influenza A Acute pharyngitis Cerebral infarction Normal control Normal control Normal control

She went to

chengdu airport on The patient began January 20 to pick He has been She has never been She took an to work in He has never been up her husband. Interval between working in wuhan to wuhan (she has He Never been to internship in a Huangmei county, to wuhan (living in Long-term resident The plane her lover symptom onset and for a long time. He lived in jiangxi for wuhan (1.18-1.21 She has never been hospital in Wuhan Hubei province on jiangxi, driving to in wuhan (student took was from NA NA NA NA NA NA NA arrival at drove back to a long time and meeting in to wuhan in July 2019 and November 22, mianyang from of a university) haikou to Chengdu, Wuhan(days) mianyang on drove to mianyang changsha) returned to Zigong 2019.01.16 and jiangxi). and the previous January 23 from jiangxi). on January 20, 2020drove away to flight of the plane return to Zigong was from wuhan to

Haikou

Relationship with The patient's patients with novel NA NA NA NA NA NA NA NA NA NA NA NA NA NA NA mother-in-law coronavirus

The time from symptom onset to 5 (contact NA NA NA NA NA NA NA NA NA NA NA NA NA NA NA get in touch with exposure) the patient

Second generation, Generations of NA NA NA NA NA NA NA infected by NA NA NA NA NA NA NA NA viruses son-in-law

Days from onset to 14 8 10 12 7 4 10 10 21 23 12 NA NA NA NA NA sampling (days)

Age(years) 34 43 33 26 25 59 46 62 20 40 24 59 71 57 61 28

Sex Male Male Female Male Male Female Female Female Female Male Female Male Female Female Male Male

He has a habit of Smoking / drinking Occasional drinkingNA NA NA NA NA NA NA NO NA NA NA NA NA NA smoking, smoking for 20 + years,

about 10 cigarettes

a day. He denies

quitting smoking.

He has a habit of

drinking, drinking

for 20 years, about

350 grams a day.

Occupation Engineer Staff Staff Engineer Student Retired NA Retired Nurse NA NA NA NA NA NA NA

Appendicitis Type 2 diabetes, 2 Underlying diseases NA NA NA No NA NA NA NA NA NA NA NA NA NA operation + years history

Interval between admission to hospital and NA NA NA NA NA NA NA NA NA NA NA NA NA NA NA NA symptom onset(days)

A ground glass

dense nodule A little ground Left lower lung Ground glass Left and right lungs CT image features shadow can be seen glass exudation Micro ground glass Micro ground glass patch, consistent Micro ground glass Micro ground glass shadow in the outer Micro ground glass scattered with Micro ground glass of lung (provide in the posterior shadow under the NA NA NA NA NA shadow shadow with viral shadow shadow zone of right lower shadow multiple spots and shadow image) segment of the pleura in the lower pneumonia lobe of lung flakes upper lobe tip of theleft lung

left lung

Cough,

expectoration, small

amount, cough Presenting white sputum, symptoms and NA NA NA NA NA NA NA NA NA NA NA NA NA NA NA fearless of cold, signs fever, chest

tightness, chest

pain, dyspnea, nausea, vomiting,

unconsciousness,

out of hospital

medication

(unknown), no

significant relief of

symptoms

Fever + + + + NA NA NA NA + NA NA NA NA NA NA NA

Cough + + + + + + + - + +(dry) + NA NA NA NA NA

Generalised + - - - - - + (干) + (干) - - + NA NA NA NA NA weakness

Nasal congestion - - - - - + + - - - - NA NA NA NA NA

Rhinorrhoea ------NA NA NA NA NA

Sneezing ------NA NA NA NA NA

Sore throat ------NA NA NA NA NA chest pain - - + ------NA NA NA NA NA

Diarrhoea ------NA NA NA NA NA

Body temperature 40.2 37.7 38.5 37.4 37.9 37℃ 37.5 37 37 37 36.7 NA NA NA NA NA (°C)

Hematocrit (normal 0.398 0.46 0.31 0.43 0.38 51.30 37.10 35.50 36.80 39.90 44.60 46.90 43.80 45.70 43.10 44.20 range 0.40-0.50)

Mean corpuscular volume (fl) (normal 94.5 92.00 72.00 92.00 90.00 87.80 93.40 89.50 70.20 84.40 88.60 91.70 87.60 90.30 94.80 87.70 range 82-100)

Mean corpuscular hemoglobin (pg) 30.9 31.00 23.30 31.80 30.40 30.00 31.90 30.50 21.90 26.80 30.40 29.60 28.70 29.30 30.00 27.60 (normal range

27-34)

RBC distribution - 12.60 17.00 343.00 10.90 39.50 NA NA NA NA 40.00 43.60 37.80 39.50 45.10 40.10 width (%); (normal range 10-16)

Platelet count (×

10⁹ cells / 299 142.00 236.00 132.00 227.00 274.00 NA NA 173.00 118.00 228.00 214.00 NA 156.00 111.00 248.00 L);(normal range

100–300)

Lymphocyte (%);

(normal range 7.3 30.40 15.70 23.10 18.90 34.70 NA 27.40 26.00 24.00 22.60 13.40 17.50 33.00 31.70 39.30

20-50)

Monocyte (%); 3.1 14.50 9.20 11.40 9.10 5.50 8.20 6.80 12.30 11.20 7.00 6.40 3.80 4.20 7.60 8.70 (normal range 3-10)

Neutrophils(%);

(normal 89.5 52.90 74.00 64.10 70.20 58.90 68.10 65.00 61.10 64.40 65.80 79.30 77.90 61.10 59.10 49.70 range40-75)

Eosinophils (%);

(normal range 0 1.30 0.70 0.90 1.30 0.60 0.10 0.60 0.40 0.00 4.30 0.60 0.50 1.40 1.10 1.90

0.4-7)

Basophils (%); 0.1 0.90 0.40 0.50 0.50 0.30 0.20 0.20 0.20 0.40 0.30 0.30 0.30 0.30 0.50 0.40 (normal range 0-2)

Lymphocyte count

(× 10⁹ cells / L); 0.75 1.00 1.52 0.90 1.46 2.20 1.03 1.40 2.32 1.16 1.58 1.85 1.37 2.68 1.37 2.12 (normal range

1.1-3.2)

Monocytes (× 10⁹ cells / L); (normal 0.32 0.48 0.89 0.44 0.70 0.35 0.36 0.35 1.10 0.54 0.49 0.88 0.30 0.34 0.33 0.47 range 0.1 - 0.6)

Neutrophils (× 10⁹ cells / L); (normal 9.25 1.75 7.18 2.50 5.41 3.73 2.98 3.32 5.46 3.12 4.69 10.94 6.12 4.97 2.55 2.68 range 1.8 - 6.3)

Eosinophils (× 10⁹ cells / L); (normal 0 NA 0.03 0.04 0.10 0.04 0.00 0.03 0.04 0.00 0.30 0.08 0.04 0.11 0.05 0.10 range 0.02-0.52) Basophils (× 10⁹ cells / L); (normal 0.01 NA 0.04 0.02 0.04 0.02 0.01 0.01 0.02 0.02 0.02 0.04 0.02 0.02 0.02 0.02 range 0 - 0.2)

Leukocytes (× 10⁹ cells / L); (normal 10.34 3.30 9.70 3.90 7.70 6.34 4.38 5.11 8.93 4.84 6.97 13.80 7.85 8.13 4.32 5.40 range 3.5-9.5)

Erythrocytes (× 10⁹ cells / L); (normal 4.21 5.06 4.30 4.66 4.24 5.84 3.98 3.97 5.24 4.73 5.03 5.11 5.00 5.06 4.54 5.04 range 4.3-5.8) Table S2 List of known marker genes, new marker genes and highly expressed genes of 56 cell subtypes identified by integrated analysis of all the sequenced samples.

Cell (Sub)Type Other information Known marker New marker Highly expressed genes

CD4+ T cell CD4+ T helper LTB, IL7R - LDHB, LEF1, JUNB, SARAF, TCF7, NOSIP, MAL, CDR7

Naive CD8+ T cell LEF1, LDHB - EEF1B2, EEF1A1, NOSIP, ARAF,TCF7,TPT1, CCR7, C12orf57

CD4+ cytotoxic T cell CCL5, CST7 - GNLY, NKG7, GZMB, PRF1, CST7, GZMH, FGFBP2, CCL5, CTSW, FCGR3A

CD4+ T cell CD4+ T helper LTB, IL7R - JUNB, TNFAIP3, CD69, JUN, AQP3, KLF6,VIM,ZFP36L2

CD8+ T cell Naive CD8+ T cell LEF1, CD8A, CD8B - LINC02446, EEF1B2, NELL2, EEF1A1, LDHB, NOSIP, SARAF

B cell memory B cell CD19 MS4A1 CD74, HLA-DRA, CD79A, TCL1A, HLA-DRB1, HLA-DPA1, HLA-DPB1, CD37, HLA-DQB1

CD1C+_B dendritic cell BSET1,CD1D,CD163,CES1,CFS3R, VCAN CST3 SA1009, LYZ, S100A8, FCN1, S100A12, FOS, IFI27, CTSS

CD4+ cytotoxic T cell CST7,CCL4, CD7 - GNLY, NKG7, GZMB, PRF1, SPON2, CTSW, GZMA, CLIC3, FCGR3A

CD8 cytoxict cells CD3D, CD8A,CD8B - GZMH, NKG7, CCL5, CST7, GZMA, IL32, FGFBP2, GZMM,

CD4+ T helper CD3D,CD3E,IL7R - IL32, IL7R, CD3G, LDHB, SARAF, AL138963.3, HBB, C12orf57

CD8+ T cell CD8 cytoxict cells CD8A,CD8B,GZMK - CCL5, IL32, GZMA, DUSP2,LYAR, CMC1, CD2

CD8 cytoxict cells Similar to cluster 9 CD3D, CD8A,CD8B - GNLY, GZMH, NKG7, CCL5, CCST7, GZMB, FGFBP2, GZMA, IL32,

CD1C+_B dendritic cell CD14,CFS3R, VCAN CST3 S100A8, S100A12, S100A6, CST7, LYZ, FOS, IFITM3,AIF1, FTH1, TYROBP

Effector CD8+ memory T (Tem) TAGLN2 - PPBP, TUBB1, CLU, CAVIN2, PF4, MYL9, GNG11, SPARC, NRGN, HIST1H2AC cell

Memory B cell CD27 - LTB, IL32, AQP3, CD52, GSTK1, CNN2, LDHB, CORO1B, CD3D

B cell Activated B cell CD19 MS4A1 CD74, HLA-DRA, CD79A, IGKV3-20, HLA-DRB1, HLA-DPA1, HLA-DPB1, HLA-DQB1, HLA-DQB1

CD4+ T helper LTB,LDHB - PPBP, CLU, PF4, NRGN, MYL9, SPARC, PF4V1, GNG11, CAVIN2

CD4+ T cell CD4+ T helper LTB, IL7R TRBV5-1 EEF1A1, IL7R, CD3E, SARAF, MAL, LEF1, TCF7

ADAM15,BST1,CD1D,CD163,CLEC10A,C CD1C+_B dendritic cell CST3 CST3, LYZ, HLA-DRA, HLA-DRB1, IFI27, S100A9, FCN1, HLA-DRB5, AIF1, CD74 FS3R, VCAN

Activated CD4+ T cell or CD69, KLRG1;KLRB1 - GZMK, DUSP1, JUN, AC245014.3, TNFAIP3, NCR3, FOS Monocyte

CD4+ cytotoxic T cell CCL5, CST7 TRDV2 TRGV9, NKG7, GNLY, TRDC, GZMH, KLRC1

CD8+ T cell Naive CD8+ T cell LEF1, CD8A, CD8B - LINC02446,S100B, NELL2, EEF1B2, CCR7, EEF1A1, LDHB Megakaryocyte progenitor cell PPBP, PF4 - HISTI1H2AC, TUBB1, CAVIN2, RGS18, TSC22D1, GP9, HIST1H3H, TMEM40, GNG11

CD4+ T helper IL7R - MT-CO1, MT-CO2, MT-CYB, MT-ND3, MT-,ATP6, MT-ND4L, MT-CO3, MT-ATP8, MALAT1, MTRNR2L12

CD8 cytoxict cells Similar to cluster 35 - TRBV20-1 LDHB, SARAF, LTB, EEF1A1, LEF1, TCF7, EEF1B2, NOSIP, MAL

CD4+ cytotoxic T cell CCL5, CST7 - NKG7, PRF1, SPON2, GZMB, CLIC3, CTSW, MYOM2, GZMA, KRB1

CD4+ T helper LTB, IL7R - TRBV20-1,AQP3, CD3E, LDHB, GSTK1, PBXIP1, JUNB, IL32

CD4+ T helper LTB, IL7R TRBV7-9 EEF1A1, LDHB, SARAF, CD3E, LEF1, TPT1, MAL

TRBV28,TRBV2 CD4+ T helper LTB,LDHB EEF1A1, TPT1, SARAF, EEF1B2, MAL, IL7R, LEF1 6

CD1C+_B dendritic cell CFS3R, VCAN KLF6 NEAT1, SAT1, MT-CO1, KLF6, CSF3R, NFKBIZ, ZEB2, MT-CO2, VCAN, NAMPT

Megakaryocyte progenitor cell PPBP, PF4 - HIST1H2AC, CAVIN2, GNG11, TUBB1, RGS18,CLU, GP9, NRGN

CD8+ T cell CD8 cytoxict cells CD3D, CD8A,CD8B - TRBV-9, GZMH, CCL5, NKG7, CST7, GZMA, B2M, IL32

Plasmacytoid dendritic cell STMN1 - HMGB2, TUBA1B, TUBB, HIST1H4C, TYMS, HMGN2, H2AFZ, GAPDH, DUT

AXL+SIGLEC6+ dendritic cell CTSW - GNLY, GZMK, CTSW, XCL1, KLRD1, CMC1, CD7, XCL2, NKG7, HOPX

CD8 cytoxict cells Similar to cluster 9 CD8A, CD8B, CCL5, CST7 TRBV20-1 GZMK, IL32, CST7, NKG7, KLRG1, B2M, CD2

Plasmacytoid dendritic cell SEC11C, MZB1 IGLC2, IGHG1 TRBV5, TRGC2, TRAV14DV4, IL32, NKG7, B2M, GZMH, GZMA,CCL5, CST7

CD4+ cytotoxic T cell CCL5, CST7,LYAR TRDV2 GZMK, TRGV9, KLRB1, GZMA, NKG7, LYAR

CD1C-CD141- dendritic cell AIF1,LST1 - CST3, SERPINA1, PSAP, FCER1G, IFITM3, FTL,COTL1, CFD

S100A8,

CD1C+_B dendritic cell S100A9,S100A12,MNDA,I S100A8, S100A9,S100A12,MNDA,IFITM2 LCN2 LCN2, CAMP, LTF, CPNE3, MNDA, CYSTM1, LAMTOR4

FITM2

CD4+ cytotoxic T cell CCL5, CST7 - GNLY, NKG7, GZMB,PRE1, GZMH, FGFBP2, GZMA, KLRD1

CD8+ T cell Naive CD8+ T cell CD8A,CD8B,NELL2,LEF1 - TRBV7-9, LINC02446, CCR7, EEF1B2, SARAF, CD3E

CD1C+_A dendritic cell CD52, CX3CR1 - AC006369.1, TRBV28, GZMK, CCL5, CD8B, GPN1, DUSP2, CST7, LYAR, IL32

Effector CD8+ memory T CD8+ T cell SYNE1 - RNF213, PTPRC, SYNE2, UTRN, MACF1, LNPEP, MBP, PRF1, GNPTAB (Tem) cell

Megakaryocyte progenitor cell PPBP, PF4 - LINC02446, CD8B, TUBB1, CAVIN2, GNG11, CLU, MPIG6B, SPARC

NEXN,HIST1H2 CD141+CLEC9A+ dendritic cell RGS10 RGS10 HIST1H4H, RGS18, HIST1H3H1, NT5C3A, CA2, PF4, TSC22D1,H3F3A BH

CD8+ T cell CD8A,CD8B - TRBV20-1, LINC02446, EEF1A1, NELL2, LEF1, EEF1B2, TCF7, LDHB

CD4+ T cell CD4+ T helper - TRBV5-1 TRAV14DV4, EEF1A1, LTB, LEF1, LDHB, MAL, IL7R, CCR7, SARAF Naive CD8+ T cell LEF1, LDHB TRBV19 EEF1A1, NACA, TPT1, SARAF, FAU, LTB

B cell Activated B cell CD19 MS4A1 LINC00926, FAM19C, MT-CO2, RALGPS2, MT-ND3, MT-CO1, AFF3, BACH2, ADK

CD4+ T cell LTB,LDHB TRBV7-6 TRBV7-9, TRBV7-4, EEF1A1, TRBV7-2, SARAF, EEF1B2, TRBV7-7

CD4+ T helper - TRBV26 TRBV28, CD8B, LINC02446, CD8A, EEF1A1, NELL2, LEF1, EEF1B2, NUCB2, CARS

CD8+ T cell CD8A,CD8B - TRBV5-1, LINC02446, EEF1A1, NELL2, LEF1, EEF1B2, CCR7, LDHB

LILRA4, ITM2C, IRF7, IRF8,LILRA4, Plasmacytoid dendritic cell CD74, TXN, JCHAIN, CCDC50, ALOX5AP PLD4 -

SPINK2,AC0840 AXL+SIGLEC6+ dendritic cell SOX4 CDK6, C8orf88, CHID1, PRKG2, UBR5-AS1, NET1 33.3,MRPS27

AP00238.7,

EPHA1-AS1,BET

CD4+ T cell LTB 1L,SESN1, EPHA1-AS1, RRAGA, NDUFA8, NUBP2, TCERG1

P2RY10,

KIAA0391

CD4+ T cell Similar to cluster 55 LTB AP00238.7 NMD3, DEGS1, COMMD2, ZNF581, CAPN7, CIAPIN1, HADH, RABGGTB, ZFAN2B, COQ10B Table S3 Compared with the normal controls, significant enriched pathways of each cell subtypes in the critical condition (patient 1).

false Clu Cluster #term ID term description direction discovery matching proteins in your input (labels) ster rate

CD1C+_B 8 CL:18630 MHC class II protein complex top of list 0.0022CD74,HLA-DMA,HLA-DPA1,HLA-DPB1,HLA-DQA1,HLA-DQB1,HLA-DRA,HLA-DRB1 dendritic cell

CD1C-CD141- RPL11,RPL12,RPL13A,RPL18,RPL18A,RPL19,RPL22,RPL23,RPL27,RPL32,RPL34,RPL35,RPL35A,RPL36,RPL37,RPL37A,RPL38 22 CL:14978 Peptide chain elongation bottom of list 2.56E-06 dendritic cell ,RPL39,RPL7,RPL9,RPLP0,RPLP1,RPLP2,RPS13,RPS19,RPS21,RPS26,RPS28,RPS29,RPS3A,RPS7,RPS8

CD1C-CD141- GTP hydrolysis and joining of the 60S ribosomal PABPC1,RPL11,RPL12,RPL13A,RPL18,RPL18A,RPL19,RPL22,RPL23,RPL27,RPL32,RPL34,RPL35,RPL35A,RPL36,RPL37,RPL3 22 CL:14967 bottom of list 2.56E-06 dendritic cell subunit, and Protein export 7A,RPL38,RPL39,RPL7,RPL9,RPLP0,RPLP1,RPLP2,RPS13,RPS19,RPS21,RPS26,RPS28,RPS29,RPS3A,RPS7,RPS8

CD1C-CD141- RPL11,RPL12,RPL13A,RPL18,RPL18A,RPL19,RPL22,RPL23,RPL27,RPL32,RPL35,RPL35A,RPL36,RPL37,RPL37A,RPL38,RPL39 22 CL:14980 Peptide chain elongation bottom of list 3.02E-06 dendritic cell ,RPL7,RPL9,RPLP0,RPLP1,RPLP2,RPS13,RPS19,RPS21,RPS26,RPS28,RPS29,RPS3A,RPS7,RPS8

CD1C-CD141- RPL11,RPL12,RPL13A,RPL18A,RPL19,RPL22,RPL23,RPL27,RPL32,RPL35,RPL35A,RPL36,RPL37,RPL37A,RPL38,RPL39,RPL7, 22 CL:14982 Peptide chain elongation bottom of list 4.02E-06 dendritic cell RPL9,RPLP0,RPLP1,RPLP2,RPS13,RPS19,RPS21,RPS26,RPS28,RPS29,RPS3A,RPS7,RPS8

CD1C-CD141- RPL11,RPL12,RPL13A,RPL18A,RPL19,RPL22,RPL23,RPL27,RPL32,RPL35,RPL35A,RPL36,RPL37,RPL37A,RPL38,RPL39,RPL7, 22 CL:14983 Peptide chain elongation bottom of list 1.83E-05 dendritic cell RPL9,RPLP2,RPS13,RPS19,RPS21,RPS26,RPS28,RPS3A,RPS7,RPS8

CD1C-CD141- RPL11,RPL12,RPL13A,RPL18A,RPL19,RPL22,RPL23,RPL27,RPL35,RPL35A,RPL36,RPL37A,RPL38,RPL39,RPL7,RPL9,RPS13,R 22 CL:14985 Viral mRNA Translation bottom of list 8.97E-05 dendritic cell PS19,RPS21,RPS26,RPS28,RPS3A,RPS7,RPS8

CD1C-CD141- mixed, incl. lipoteichoic acid binding, and 22 CL:4594 bottom of list 0.0036CD14,S100A8,S100A9 dendritic cell neutrophil aggregation

Immunoregulatory interactions between a

CD4+ T helper 23 CL:4212 Lymphoid and a non-Lymphoid cell, and both ends 5.60E-06B2M,GNLY,GZMK,HLA-B,HLA-C,HLA-E

Cytolysis

Immunoregulatory interactions between a

CD4+ T helper 23 CL:4211 Lymphoid and a non-Lymphoid cell, and both ends 1.20E-05B2M,CD2,GNLY,GZMK,HLA-B,HLA-C,HLA-E

Cytolysis

MHC class I protein complex, and inhibitory MHC CD4+ T helper 23 CL:4218 top of list 4.40E-05B2M,HLA-B,HLA-C,HLA-E class I receptor activity

CD4+ T helper 23 CL:4209 mixed, incl. Immunoregulatory interactions both ends 4.40E-05B2M,CD2,CD27,CD7,GNLY,GZMK,HLA-B,HLA-C,HLA-E between a Lymphoid and a non-Lymphoid cell,

and T cell costimulation

MHC_I C-terminus, and MHC class I protein CD4+ T helper 23 CL:4220 top of list 0.00055HLA-B,HLA-C,HLA-E complex binding

Immunoregulatory interactions between a

CD8+ T cell 24 CL:4212 Lymphoid and a non-Lymphoid cell, and both ends 5.60E-06B2M,GNLY,GZMK,HLA-B,HLA-C,HLA-E

Cytolysis

Immunoregulatory interactions between a

CD8+ T cell 24 CL:4211 Lymphoid and a non-Lymphoid cell, and both ends 1.20E-05B2M,CD2,GNLY,GZMK,HLA-B,HLA-C,HLA-E

Cytolysis

MHC class I protein complex, and inhibitory MHC CD8+ T cell 24 CL:4218 top of list 4.40E-05B2M,HLA-B,HLA-C,HLA-E class I receptor activity

mixed, incl. Immunoregulatory interactions

CD8+ T cell 24 CL:4209 between a Lymphoid and a non-Lymphoid cell, both ends 4.40E-05B2M,CD2,CD27,CD7,GNLY,GZMK,HLA-B,HLA-C,HLA-E

and T cell costimulation

MHC_I C-terminus, and MHC class I protein CD8+ T cell 24 CL:4220 top of list 0.00055HLA-B,HLA-C,HLA-E complex binding

CD4+ cytotoxic EEF1A1,RPL10A,RPL13,RPL14,RPL19,RPL21,RPL23A,RPL29,RPL3,RPLP1,RPS12,RPS14,RPS15,RPS16,RPS18,RPS27,RPS4X, 25 CL:14978 Peptide chain elongation top of list 0.00073 T cell RPS6

CD4+ cytotoxic GTP hydrolysis and joining of the 60S ribosomal EEF1A1,PABPC1,RPL10A,RPL13,RPL14,RPL19,RPL21,RPL23A,RPL29,RPL3,RPLP1,RPS12,RPS14,RPS15,RPS16,RPS18,RPS2 25 CL:14967 top of list 0.00073 T cell subunit, and Protein export 7,RPS4X,RPS6

CD4+ cytotoxic GTP hydrolysis and joining of the 60S ribosomal EEF1A1,PABPC1,RPL10A,RPL13,RPL14,RPL19,RPL21,RPL23A,RPL29,RPL3,RPLP1,RPS12,RPS14,RPS15,RPS16,RPS18,RPS2 25 CL:14966 top of list 0.00073 T cell subunit, and Protein export 7,RPS4X,RPS6,TPT1

CD4+ cytotoxic 25 CL:4615 neutrophil aggregation, and Aquaporin 9 bottom of list 0.0018S100A12,S100A8,S100A9 T cell

CD4+ cytotoxic 25 CL:14985 Viral mRNA Translation top of list 0.0018RPL10A,RPL13,RPL14,RPL19,RPL21,RPL23A,RPL29,RPL3,RPS12,RPS14,RPS15,RPS16,RPS18,RPS4X,RPS6 T cell

CD4+ cytotoxic 25 CL:14982 Peptide chain elongation top of list 0.0018RPL10A,RPL13,RPL14,RPL19,RPL21,RPL23A,RPL29,RPL3,RPLP1,RPS12,RPS14,RPS15,RPS16,RPS18,RPS27,RPS4X,RPS6 T cell

CD4+ cytotoxic mixed, incl. lipoteichoic acid binding, and 25 CL:4594 bottom of list 0.002S100A12,S100A8,S100A9,TYROBP T cell neutrophil aggregation immunoglobulin binding, and Immunoregulatory CD4+ cytotoxic 25 CL:4560 interactions between a Lymphoid and a bottom of list 0.0022FCER1G,S100A12,S100A8,S100A9,TYROBP T cell non-Lymphoid cell

CD4+ cytotoxic specific granule lumen, and azurophil granule 25 CL:10246 bottom of list 0.0077CAMP,CST3,GCA,LCN2,LTF,LYZ,MNDA,OLFM4,PGLYRP1,RETN T cell lumen

Immunoregulatory interactions between a

CD4+ T helper 26 CL:4212 Lymphoid and a non-Lymphoid cell, and top of list 0.0003B2M,GNLY,GZMB,HLA-B,HLA-C

Cytolysis

CD1C-CD141- RPL12,RPL13,RPL13A,RPL22,RPL27A,RPL28,RPL29,RPL31,RPL32,RPL34,RPL35,RPL36,RPL37,RPL37A,RPL38,RPL39,RPLP2, 33 CL:14978 Peptide chain elongation bottom of list 2.62E-05 dendritic cell RPS11,RPS12,RPS15,RPS15A,RPS19,RPS2,RPS20,RPS23,RPS27,RPS3A,RPS8

CD1C-CD141- 33 CL:18630 MHC class II protein complex top of list 2.62E-05CD74,HLA-DMA,HLA-DMB,HLA-DPA1,HLA-DPB1,HLA-DQA1,HLA-DQB1,HLA-DRA,HLA-DRB1 dendritic cell

CD1C-CD141- RPL12,RPL13,RPL13A,RPL22,RPL27A,RPL28,RPL29,RPL31,RPL32,RPL35,RPL36,RPL37,RPL37A,RPL38,RPL39,RPLP2,RPS11, 33 CL:14980 Peptide chain elongation bottom of list 2.65E-05 dendritic cell RPS12,RPS15,RPS15A,RPS19,RPS2,RPS20,RPS23,RPS27,RPS3A,RPS8

mixed, incl. MAPK targets/ Nuclear events CD1C-CD141- 33 CL:2403 mediated by MAP kinases, and bZIP Maf bottom of list 2.76E-05DUSP1,FOS,JUN,JUND dendritic cell transcription factor

CD1C-CD141- RPL12,RPL13,RPL13A,RPL22,RPL28,RPL29,RPL31,RPL32,RPL35,RPL36,RPL37,RPL37A,RPL38,RPL39,RPLP2,RPS11,RPS12,R 33 CL:14982 Peptide chain elongation bottom of list 2.76E-05 dendritic cell PS15,RPS15A,RPS19,RPS2,RPS20,RPS23,RPS27,RPS3A,RPS8

CD1C-CD141- GTP hydrolysis and joining of the 60S ribosomal PABPC1,RPL12,RPL13,RPL13A,RPL22,RPL27A,RPL28,RPL29,RPL31,RPL32,RPL34,RPL35,RPL36,RPL37,RPL37A,RPL38,RPL3 33 CL:14967 bottom of list 3.34E-05 dendritic cell subunit, and Protein export 9,RPLP2,RPS11,RPS12,RPS15,RPS15A,RPS19,RPS2,RPS20,RPS23,RPS27,RPS3A,RPS8

CD1C-CD141- MHC class II protein complex, and dynactin 33 CL:18627 top of list 7.23E-05CD74,HLA-DMA,HLA-DMB,HLA-DPA1,HLA-DPB1,HLA-DQA1,HLA-DQA2,HLA-DQB1,HLA-DRA,HLA-DRB1 dendritic cell complex

CD1C-CD141- RPL12,RPL13,RPL13A,RPL22,RPL29,RPL32,RPL35,RPL36,RPL37,RPL37A,RPL38,RPL39,RPLP2,RPS11,RPS12,RPS15,RPS15A 33 CL:14983 Peptide chain elongation bottom of list 8.76E-05 dendritic cell ,RPS19,RPS2,RPS23,RPS3A,RPS8

CD1C-CD141- RPL12,RPL13,RPL13A,RPL22,RPL29,RPL35,RPL36,RPL37A,RPL38,RPL39,RPS11,RPS12,RPS15,RPS15A,RPS19,RPS2,RPS23, 33 CL:14985 Viral mRNA Translation bottom of list 0.00013 dendritic cell RPS3A,RPS8

CD1C-CD141- peptide antigen assembly with MHC class II 33 CL:18633 top of list 0.00021CD74,HLA-DMA,HLA-DMB,HLA-DRA,HLA-DRB1 dendritic cell protein complex

CD1C-CD141- AP-1 transcription factor, and Transcription factor 33 CL:2482 bottom of list 0.0011FOS,JUN,JUND dendritic cell Jun CD8+ T cell 34 CL:22327 Oxidative phosphorylation top of list 0.0036ATP6V1G1,COX6C,MT-ND3,MT-ND4,MT-ND4L

mixed, incl. Immunoregulatory interactions

CD8+ T cell 34 CL:4209 between a Lymphoid and a non-Lymphoid cell, top of list 0.0036B2M,CD7,HLA-B,HLA-C

and T cell costimulation

CD8+ T cell 34 CL:22328 respirasome top of list 0.0049COX6C,MT-ND3,MT-ND4,MT-ND4L

MHC class I protein complex, and inhibitory MHC CD8+ T cell 34 CL:4218 top of list 0.0055B2M,HLA-B,HLA-C class I receptor activity Table S4 Compared with the normal controls, significant enriched pathways of each cell subtypes in the severe condition (patient 2).

false Cell type #term ID term description direction discovery matching proteins in your input (labels) Cluster rate

Naive CD4+ T cell 1CL:14978 Peptide chain elongation top of list 0.003RPL3,RPL4,RPS2,RPS26,RPS4X

Naive CD4+ T cell 1CL:14985 Viral mRNA Translation top of list 0.0035RPL3,RPS2,RPS26,RPS4X

Naive CD4+ T cell 1CL:22328 respirasome top of list 0.0035MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

CD4+ T cell 2CL:22328 respirasome top of list 5.46E-06MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

CD4+ T cell 2CL:22327 Oxidative phosphorylation top of list 6.51E-06ATP6V0E1,MT-ATP6,MT-ATP8,MT-CO1,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

Interferon alpha/beta signaling, and Interferon-induced protein bottom of CD4+ T cell 2CL:4662 0.00013BST2,EPSTI1,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,XAF1 44 family list

CD4+ T cell 2CL:14985 Viral mRNA Translation top of list 0.00013RPL13A,RPL21,RPL3,RPS2,RPS26,RPS27A,RPS4X

Interferon alpha/beta signaling, and Interferon gamma bottom of BST2,EPSTI1,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,PLSCR1,TRIM2 CD4+ T cell 2CL:4661 0.00013 signaling list 2,XAF1

bottom of CD4+ T cell 2CL:4665 Interferon alpha/beta signaling 0.00013BST2,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1 list

CD4+ T cell 2CL:14982 Peptide chain elongation top of list 0.00013RPL13A,RPL21,RPL3,RPS2,RPS20,RPS26,RPS27A,RPS4X

CD4+ T cell 2CL:22502 Leber hereditary optic neuropathy top of list 0.00047MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4

CD4+ T cell 2CL:22332 mitochondrial respiratory chain complex I top of list 0.0013MT-ND2,MT-ND3,MT-ND4L,MT-ND5

bottom of CD4+ T cell 2CL:4668 type I interferon signaling pathway 0.0013BST2,IFI27,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1 list

bottom of CD4+ T cell 2CL:4670 type I interferon signaling pathway 0.0013IFI27,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1 list

2'-5'-oligoadenylate synthase, and type I interferon signaling bottom of CD4+ T cell 2CL:4673 0.0049IFI6,IFIT3,IRF7,MX1,MX2,OAS1,XAF1 pathway list

CD4+ T cell 2CL:22408 Leber hereditary optic neuropathy top of list 0.0055MT-ND2,MT-ND4L,MT-ND5

Effector CD8+ memory T 3CL:22328 respirasome top of list 3.70E-07MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA3 (Tem) cell

Effector CD8+ memory T 3CL:22327 Oxidative phosphorylation top of list 3.70E-07ATP5J2,ATP6V0E1,MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,M (Tem) cell T-ND5,NDUFA3

Effector CD8+ memory T 3CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 1.97E-06MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4 (Tem) cell

Effector CD8+ memory T 3CL:22502 Leber hereditary optic neuropathy top of list 2.77E-06MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4 (Tem) cell

Effector CD8+ memory T bottom of BST2,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OASL,RSAD2,SAMD9L, 3CL:4665 Interferon alpha/beta signaling 0.0001 (Tem) cell list XAF1

Effector CD8+ memory T 3CL:22332 mitochondrial respiratory chain complex I top of list 0.00074MT-ND1,MT-ND2,MT-ND3,MT-ND4L,MT-ND5,NDUFA3 (Tem) cell

Effector CD8+ memory T 3CL:22408 Leber hereditary optic neuropathy top of list 0.001MT-ND1,MT-ND2,MT-ND4L,MT-ND5 (Tem) cell

Effector CD8+ memory T bottom of 3CL:4668 type I interferon signaling pathway 0.001BST2,IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OASL,RSAD2,XAF1 (Tem) cell list

Effector CD8+ memory T bottom of 3CL:4670 type I interferon signaling pathway 0.0015IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OASL,RSAD2,XAF1 (Tem) cell list

Effector CD8+ memory T 4CL:22328 respirasome top of list 3.30E-07MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5 (Tem) cell

Effector CD8+ memory T 4CL:22327 Oxidative phosphorylation top of list 3.30E-07ATP6V0E1,MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5 (Tem) cell

Effector CD8+ memory T bottom of BST2,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OASL,RSAD2,SAMD9L,XA 4CL:4665 Interferon alpha/beta signaling 3.35E-05 (Tem) cell list F1

Effector CD8+ memory T 4CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 3.35E-05MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4 (Tem) cell

Effector CD8+ memory T 4CL:22502 Leber hereditary optic neuropathy top of list 4.49E-05MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4 (Tem) cell

Effector CD8+ memory T bottom of 4CL:4668 type I interferon signaling pathway 0.00034BST2,IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OASL,RSAD2,XAF1 (Tem) cell list

Effector CD8+ memory T bottom of 4CL:4670 type I interferon signaling pathway 0.00069IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OASL,RSAD2,XAF1 (Tem) cell list

Effector CD8+ memory T 4CL:22332 mitochondrial respiratory chain complex I top of list 0.0019MT-ND1,MT-ND2,MT-ND3,MT-ND4L,MT-ND5 (Tem) cell

Effector CD8+ memory T Interferon alpha/beta signaling, and Interferon-induced protein bottom of BST2,EPSTI1,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OASL,PLSCR1,RS 4CL:4662 0.0022 (Tem) cell 44 family list AD2,SAMD9L,XAF1

Effector CD8+ memory T 2'-5'-oligoadenylate synthase, and type I interferon signaling bottom of 4CL:4673 0.0035IFI35,IFI6,IFIT1,IFIT3,IRF7,MX1,MX2,OAS1,OASL,RSAD2,XAF1 (Tem) cell pathway list

Effector CD8+ memory T Interferon alpha/beta signaling, and Interferon gamma bottom of BST2,EPSTI1,GBP1,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,OASL 4CL:4661 0.0035 (Tem) cell signaling list ,PLSCR1,RSAD2,SAMD9L,TRIM22,XAF1

Effector CD8+ memory T Interferon alpha/beta signaling, and Interferon gamma bottom of BST2,EPSTI1,GBP1,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,OASL 4CL:4659 0.0057 (Tem) cell signaling list ,PLSCR1,RSAD2,SAMD9L,SP110,TRIM22,XAF1

Effector CD8+ memory T 4CL:22408 Leber hereditary optic neuropathy top of list 0.0071MT-ND1,MT-ND2,MT-ND4L,MT-ND5 (Tem) cell

Effector CD8+ memory T bottom of 5CL:4665 Interferon alpha/beta signaling 1.33E-05BST2,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OASL,RSAD2,XAF1 (Tem) cell list

Effector CD8+ memory T 5CL:22327 Oxidative phosphorylation top of list 9.75E-05MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5 (Tem) cell

Effector CD8+ memory T 5CL:22328 respirasome top of list 0.00012MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5 (Tem) cell

Effector CD8+ memory T bottom of 5CL:4668 type I interferon signaling pathway 0.00019BST2,IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OASL,RSAD2,XAF1 (Tem) cell list

Effector CD8+ memory T bottom of 5CL:4670 type I interferon signaling pathway 0.00028IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OASL,RSAD2,XAF1 (Tem) cell list

Effector CD8+ memory T Interferon alpha/beta signaling, and Interferon-induced protein bottom of BST2,EPSTI1,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OASL,PLSCR1,RS 5CL:4662 0.00096 (Tem) cell 44 family list AD2,XAF1

Effector CD8+ memory T 5CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 0.0017MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4 (Tem) cell

Effector CD8+ memory T 2'-5'-oligoadenylate synthase, and type I interferon signaling bottom of 5CL:4673 0.0017IFI35,IFI6,IFIT1,IFIT3,IRF7,MX1,MX2,OAS1,OASL,RSAD2,XAF1 (Tem) cell pathway list

Effector CD8+ memory T Interferon alpha/beta signaling, and Interferon gamma bottom of BST2,EPSTI1,GBP1,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,OASL 5CL:4659 0.0017 (Tem) cell signaling list ,PLSCR1,RSAD2,SP110,TRIM22,XAF1

Effector CD8+ memory T 5CL:4661 Interferon alpha/beta signaling, and Interferon gamma bottom of 0.0017BST2,EPSTI1,GBP1,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,OASL (Tem) cell signaling list ,PLSCR1,RSAD2,TRIM22,XAF1

Effector CD8+ memory T 5CL:22502 Leber hereditary optic neuropathy top of list 0.0033MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4 (Tem) cell

CD8+ T cell 6CL:14985 Viral mRNA Translation top of list 0.0046RPS2,RPS26,RPS4X

CD4+ T cell 7CL:22328 respirasome top of list 2.20E-07MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

CD4+ T cell 7CL:22327 Oxidative phosphorylation top of list 2.20E-07ATP6V0E1,MT-ATP6,MT-ATP8,MT-CO1,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

bottom of CD4+ T cell 7CL:4665 Interferon alpha/beta signaling 0.00012BST2,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1 list

Interferon alpha/beta signaling, and Interferon gamma bottom of BST2,EPSTI1,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,TRIM22,X CD4+ T cell 7CL:4661 0.00012 signaling list AF1

CD4+ T cell 7CL:22502 Leber hereditary optic neuropathy top of list 0.00012MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4

CD4+ T cell 7CL:14985 Viral mRNA Translation top of list 0.00012RPL13,RPL13A,RPL21,RPL3,RPS19,RPS2,RPS26,RPS27A,RPS4X

Interferon alpha/beta signaling, and Interferon-induced protein bottom of CD4+ T cell 7CL:4662 0.00016BST2,EPSTI1,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1 44 family list

CD4+ T cell 7CL:22332 mitochondrial respiratory chain complex I top of list 0.00037MT-ND1,MT-ND2,MT-ND3,MT-ND4L,MT-ND5

bottom of CD4+ T cell 7CL:4670 type I interferon signaling pathway 0.0035IFI27,IFI35,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1 list

bottom of CD4+ T cell 7CL:4668 type I interferon signaling pathway 0.0035BST2,IFI27,IFI35,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1 list

CD4+ T cell 7CL:22408 Leber hereditary optic neuropathy top of list 0.004MT-ND1,MT-ND2,MT-ND4L,MT-ND5

Effector CD8+ memory T 8CL:22328 respirasome top of list 7.25E-06MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA3,UQCR10 (Tem) cell

Effector CD8+ memory T 8CL:22327 Oxidative phosphorylation top of list 7.25E-06MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA3,UQCR10 (Tem) cell

Effector CD8+ memory T bottom of 8CL:4665 Interferon alpha/beta signaling 2.90E-05BST2,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,OAS1,SAMD9L,XAF1 (Tem) cell list

Effector CD8+ memory T Interferon alpha/beta signaling, and Interferon-induced protein bottom of BST2,EPSTI1,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,OAS1,PLSCR1,SAMD9L,XA 8CL:4662 3.19E-05 (Tem) cell 44 family list F1

Effector CD8+ memory T 8CL:22502 Leber hereditary optic neuropathy top of list 0.00013MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4 (Tem) cell Effector CD8+ memory T 8CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 0.00029MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4,UQCR10 (Tem) cell

Effector CD8+ memory T bottom of 8CL:4668 type I interferon signaling pathway 0.00048BST2,IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,OAS1,XAF1 (Tem) cell list

Effector CD8+ memory T bottom of 8CL:4670 type I interferon signaling pathway 0.0012IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,OAS1,XAF1 (Tem) cell list

Effector CD8+ memory T 8CL:22408 Leber hereditary optic neuropathy top of list 0.0082MT-ND2,MT-ND4L,MT-ND5 (Tem) cell

Effector CD8+ memory T 2'-5'-oligoadenylate synthase, and type I interferon signaling bottom of 8CL:4673 0.0082IFI35,IFI6,IFIT1,IFIT3,IRF7,MX1,OAS1,XAF1 (Tem) cell pathway list

Effector CD8+ memory T Interferon alpha/beta signaling, and Interferon gamma bottom of BST2,EPSTI1,GBP1,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,OAS1,PLSCR1, 8CL:4661 0.0082 (Tem) cell signaling list SAMD9L,TRIM22,XAF1

Effector CD8+ memory T 8CL:22332 mitochondrial respiratory chain complex I top of list 0.0082MT-ND2,MT-ND3,MT-ND4L,MT-ND5,NDUFA3 (Tem) cell

GTP hydrolysis and joining of the 60S ribosomal subunit, and EEF1A1,EEF2,EIF1,EIF3L,EIF4B,PABPC1,RPL21,RPL26,RPL28,RPL3,RPL4,RPL5,RPL6,RPLP0,RPS2,RPS26,RPS27A,RP CD1C+_B dendritic cell 9CL:14967 top of list 7.60E-07 Protein export S3A,RPS4X,RPS6

GTP hydrolysis and joining of the 60S ribosomal subunit, and EEF1A1,EEF1B2,EEF2,EIF1,EIF3L,EIF4B,PABPC1,RPL21,RPL26,RPL28,RPL3,RPL4,RPL5,RPL6,RPLP0,RPS2,RPS26,RP CD1C+_B dendritic cell 9CL:14966 top of list 8.40E-06 Protein export S27A,RPS3A,RPS4X,RPS6,TPT1

CD1C+_B dendritic cell 9CL:14978 Peptide chain elongation top of list 8.40E-06EEF1A1,EEF2,RPL21,RPL26,RPL28,RPL3,RPL4,RPL5,RPL6,RPLP0,RPS2,RPS26,RPS27A,RPS3A,RPS4X,RPS6

CD1C+_B dendritic cell 9CL:14982 Peptide chain elongation top of list 3.80E-05EEF2,RPL21,RPL26,RPL28,RPL3,RPL5,RPL6,RPLP0,RPS2,RPS26,RPS27A,RPS3A,RPS4X,RPS6

CD1C+_B dendritic cell 9CL:14983 Peptide chain elongation top of list 7.75E-05EEF2,RPL21,RPL26,RPL3,RPL6,RPS2,RPS26,RPS27A,RPS3A,RPS4X,RPS6

CD1C+_B dendritic cell 9CL:14985 Viral mRNA Translation top of list 0.00023RPL21,RPL26,RPL3,RPL6,RPS2,RPS26,RPS27A,RPS3A,RPS4X,RPS6

CD1C+_B dendritic cell 9CL:22328 respirasome top of list 0.00025MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

bottom of CD1C+_B dendritic cell 9CL:4668 type I interferon signaling pathway 0.00077BST2,IFI27,IFI35,IFI6,IFIT2,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OAS2,OAS3,OASL,XAF1 list

bottom of CD1C+_B dendritic cell 9CL:4670 type I interferon signaling pathway 0.00077IFI27,IFI35,IFI6,IFIT2,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OAS2,OAS3,OASL,XAF1 list

Interferon alpha/beta signaling, and Interferon-induced protein bottom of BST2,EPSTI1,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,SAMD9 CD8+ T cell 10CL:4662 0.0001 44 family list L,XAF1

CD8+ T cell 10CL:4665 Interferon alpha/beta signaling bottom of 0.0001BST2,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,SAMD9L,XAF1 list

CD8+ T cell 10CL:22328 respirasome top of list 0.00039MT-ATP6,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA3

bottom of CD8+ T cell 10CL:4670 type I interferon signaling pathway 0.0007IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1 list

CD8+ T cell 10CL:22327 Oxidative phosphorylation top of list 0.0007ATP6V0E1,MT-ATP6,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA3

bottom of CD8+ T cell 10CL:4668 type I interferon signaling pathway 0.0007BST2,IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1 list

CD8+ T cell 10CL:14985 Viral mRNA Translation top of list 0.0043RPL21,RPS19,RPS2,RPS26,RPS4X

CD8+ T cell 10CL:22502 Leber hereditary optic neuropathy top of list 0.0071MT-ATP6,MT-CO3,MT-CYB,MT-ND4

Interferon alpha/beta signaling, and Interferon gamma bottom of BST2,EPSTI1,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,PLSCR1, CD8+ T cell 10CL:4661 0.0073 signaling list SAMD9L,TRIM22,XAF1

CD4+ T cell 11CL:22328 respirasome top of list 1.20E-05MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

CD4+ T cell 11CL:14978 Peptide chain elongation top of list 0.00028RPL13A,RPL3,RPL4,RPS2,RPS26,RPS27A,RPS4X

bottom of CD4+ T cell 11CL:4665 Interferon alpha/beta signaling 0.00053BST2,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1 list

CD4+ T cell 11CL:14985 Viral mRNA Translation top of list 0.00053RPL13A,RPL3,RPS2,RPS26,RPS27A,RPS4X

Interferon alpha/beta signaling, and Interferon gamma bottom of BST2,EPSTI1,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,PLSCR1,TRIM2 CD4+ T cell 11CL:4661 0.00079 signaling list 2,XAF1

CD4+ T cell 11CL:22502 Leber hereditary optic neuropathy top of list 0.00079MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4

Interferon alpha/beta signaling, and Interferon-induced protein bottom of CD4+ T cell 11CL:4662 0.00079BST2,EPSTI1,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,XAF1 44 family list

CD4+ T cell 11CL:22332 mitochondrial respiratory chain complex I top of list 0.0029MT-ND2,MT-ND3,MT-ND4L,MT-ND5

bottom of CD4+ T cell 11CL:4670 type I interferon signaling pathway 0.0051IFI27,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1 list

bottom of CD4+ T cell 11CL:4668 type I interferon signaling pathway 0.0069BST2,IFI27,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1 list

Megakaryocyte progenitor 12CL:22328 respirasome top of list 6.34E-05COX6A1,MT-ATP6,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5 cell

Megakaryocyte progenitor bottom of 12CL:4665 Interferon alpha/beta signaling 0.00065BST2,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1 cell list Megakaryocyte progenitor Interferon alpha/beta signaling, and Interferon-induced protein bottom of 12CL:4662 0.00088BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,XAF1 cell 44 family list

Megakaryocyte progenitor Interferon alpha/beta signaling, and Interferon gamma bottom of BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,PLSCR1,TRIM22,XAF 12CL:4661 0.00088 cell signaling list 1

Megakaryocyte progenitor 12CL:22502 Leber hereditary optic neuropathy top of list 0.002MT-ATP6,MT-CO3,MT-CYB,MT-ND4 cell

Megakaryocyte progenitor 12CL:22332 mitochondrial respiratory chain complex I top of list 0.002MT-ND2,MT-ND3,MT-ND4L,MT-ND5 cell

Megakaryocyte progenitor bottom of 12CL:4670 type I interferon signaling pathway 0.0035IFI27,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1 cell list

Megakaryocyte progenitor 12CL:14982 Peptide chain elongation top of list 0.0035RPL13A,RPS2,RPS20,RPS26 cell

Megakaryocyte progenitor bottom of 12CL:4668 type I interferon signaling pathway 0.0042BST2,IFI27,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1 cell list

Megakaryocyte progenitor 12CL:22408 Leber hereditary optic neuropathy top of list 0.0042MT-ND2,MT-ND4L,MT-ND5 cell

Megakaryocyte progenitor 12CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 0.0042COX6A1,MT-ATP6,MT-CO3,MT-CYB,MT-ND4 cell

Megakaryocyte progenitor 12CL:14985 Viral mRNA Translation top of list 0.0091RPL13A,RPS2,RPS26 cell

CD141+CLEC9A+ 13CL:14983 Peptide chain elongation top of list 0.0072EEF2,RPL26,RPL36A,RPL6,RPS26 dendritic cell

CD141+CLEC9A+ 13CL:22328 respirasome top of list 0.0072MT-ATP6,MT-CO1,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L dendritic cell

CD141+CLEC9A+ Interferon alpha/beta signaling, and Interferon-induced protein bottom of 13CL:4662 0.0076BST2,EPSTI1,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,SAMD9L,XAF1 dendritic cell 44 family list

CD141+CLEC9A+ bottom of 13CL:4665 Interferon alpha/beta signaling 0.0076BST2,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,SAMD9L,XAF1 dendritic cell list

CD141+CLEC9A+ Interferon alpha/beta signaling, and Interferon gamma bottom of 13CL:4661 0.0076BST2,EPSTI1,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,SAMD9L,TRIM22,XAF1 dendritic cell signaling list CD141+CLEC9A+ 13CL:18627 MHC class II protein complex, and dynactin complex both ends 0.0076HLA-DQA2,HLA-DQB1,HLA-DRB1,HLA-DRB5 dendritic cell

CD141+CLEC9A+ Interferon alpha/beta signaling, and Interferon gamma bottom of BST2,EPSTI1,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,SAMD9L,SP110,TRIM22 13CL:4659 0.0097 dendritic cell signaling list ,XAF1

Megakaryocyte progenitor Interferon alpha/beta signaling, and Interferon gamma bottom of BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,OAS1,PLSCR1,RSAD2,SP110,T 14CL:4659 1.25E-05 cell signaling list RIM22,XAF1

Megakaryocyte progenitor Interferon alpha/beta signaling, and Interferon gamma bottom of BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,OAS1,PLSCR1,RSAD2,TRIM22,X 14CL:4661 1.25E-05 cell signaling list AF1

Megakaryocyte progenitor bottom of 14CL:4665 Interferon alpha/beta signaling 1.72E-05BST2,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,OAS1,RSAD2,XAF1 cell list

Megakaryocyte progenitor Interferon alpha/beta signaling, and Interferon-induced protein bottom of 14CL:4662 1.72E-05BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,OAS1,PLSCR1,RSAD2,XAF1 cell 44 family list

Megakaryocyte progenitor bottom of 14CL:4668 type I interferon signaling pathway 6.50E-05BST2,IFI27,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,OAS1,RSAD2,XAF1 cell list

Megakaryocyte progenitor bottom of 14CL:4670 type I interferon signaling pathway 6.50E-05IFI27,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,OAS1,RSAD2,XAF1 cell list

Megakaryocyte progenitor 14CL:22502 Leber hereditary optic neuropathy top of list 0.00033MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4 cell

Megakaryocyte progenitor Formation of Fibrin Clot (Clotting Cascade), and platelet alpha 14CL:9922 top of list 0.007F13A1,PROS1,THBS1,TMSB4X cell granule lumen

GTP hydrolysis and joining of the 60S ribosomal subunit, and CD1C+_B dendritic cell 15CL:14967 top of list 2.80E-07EEF1A1,EEF2,EIF1,EIF4B,PABPC1,RPL10A,RPL21,RPL26,RPL28,RPL3,RPL5,RPL6,RPLP0,RPS26,RPS27A,RPS4X,RPS6 Protein export

GTP hydrolysis and joining of the 60S ribosomal subunit, and EEF1A1,EEF1B2,EEF2,EIF1,EIF4B,PABPC1,RPL10A,RPL21,RPL26,RPL28,RPL3,RPL5,RPL6,RPLP0,RPS26,RPS27A,RPS CD1C+_B dendritic cell 15CL:14966 top of list 2.80E-07 Protein export 4X,RPS6,TPT1

CD1C+_B dendritic cell 15CL:14978 Peptide chain elongation top of list 1.38E-05EEF1A1,EEF2,RPL10A,RPL21,RPL26,RPL28,RPL3,RPL5,RPL6,RPLP0,RPS26,RPS27A,RPS4X,RPS6

CD1C+_B dendritic cell 15CL:14982 Peptide chain elongation top of list 2.80E-05EEF2,RPL10A,RPL21,RPL26,RPL28,RPL3,RPL5,RPL6,RPLP0,RPS26,RPS27A,RPS4X,RPS6

CD1C+_B dendritic cell 15CL:14983 Peptide chain elongation top of list 5.15E-05EEF2,RPL10A,RPL21,RPL26,RPL3,RPL6,RPS26,RPS27A,RPS4X,RPS6

CD1C+_B dendritic cell 15CL:14985 Viral mRNA Translation top of list 0.00013RPL10A,RPL21,RPL26,RPL3,RPL6,RPS26,RPS27A,RPS4X,RPS6

CD1C+_B dendritic cell 15CL:22328 respirasome top of list 0.00022MT-ATP6,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

CD1C+_B dendritic cell 15CL:4665 Interferon alpha/beta signaling bottom of 0.00054BST2,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OAS2,OAS3,OASL,XAF1 list

bottom of CD1C+_B dendritic cell 15CL:4668 type I interferon signaling pathway 0.0012BST2,IFI27,IFI35,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OAS2,OAS3,OASL,XAF1 list

bottom of CD1C+_B dendritic cell 15CL:4670 type I interferon signaling pathway 0.0012IFI27,IFI35,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OAS2,OAS3,OASL,XAF1 list

COX6A1,COX6B1,MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,ND CD8+ T cell 16CL:22328 respirasome top of list 4.00E-07 UFA3

ATP6V0E1,COX6A1,COX6B1,MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,M CD8+ T cell 16CL:22327 Oxidative phosphorylation top of list 4.00E-07 T-ND4L,MT-ND5,NDUFA3

CD8+ T cell 16CL:22502 Leber hereditary optic neuropathy top of list 8.53E-06MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4

CD8+ T cell 16CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 0.00011COX6A1,COX6B1,MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4

bottom of BST2,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OASL,RSAD2,XAF CD8+ T cell 16CL:4665 Interferon alpha/beta signaling 0.00022 list 1

CD8+ T cell 16CL:22332 mitochondrial respiratory chain complex I top of list 0.00045MT-ND1,MT-ND2,MT-ND3,MT-ND4L,MT-ND5,NDUFA3

CD8+ T cell 16CL:22408 Leber hereditary optic neuropathy top of list 0.00054MT-ND1,MT-ND2,MT-ND4L,MT-ND5

bottom of CD8+ T cell 16CL:4668 type I interferon signaling pathway 0.0042BST2,IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OASL,RSAD2,XAF1 list

bottom of CD8+ T cell 16CL:4670 type I interferon signaling pathway 0.0053IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OASL,RSAD2,XAF1 list

CD4+ T cell 17CL:22328 respirasome top of list 1.80E-05MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

Interferon alpha/beta signaling, and Interferon-induced protein bottom of CD4+ T cell 17CL:4662 0.00096BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,XAF1 44 family list

CD4+ T cell 17CL:22502 Leber hereditary optic neuropathy top of list 0.00096MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4

Interferon alpha/beta signaling, and Interferon gamma bottom of BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,PLSCR1,TRIM22,XAF CD4+ T cell 17CL:4661 0.00096 signaling list 1

bottom of CD4+ T cell 17CL:4665 Interferon alpha/beta signaling 0.00096BST2,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1 list

CD4+ T cell 17CL:14985 Viral mRNA Translation top of list 0.00096RPL21,RPL3,RPS2,RPS26,RPS4X

CD4+ T cell 17CL:22332 mitochondrial respiratory chain complex I top of list 0.0031MT-ND2,MT-ND3,MT-ND4L,MT-ND5

CD4+ T cell 17CL:4670 type I interferon signaling pathway bottom of 0.0054IFI27,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1 list

bottom of CD4+ T cell 17CL:4668 type I interferon signaling pathway 0.0064BST2,IFI27,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1 list

CD4+ T cell 17CL:22408 Leber hereditary optic neuropathy top of list 0.009MT-ND2,MT-ND4L,MT-ND5

bottom of CD4+ T helper 18CL:4665 Interferon alpha/beta signaling 0.0026ADAR,BST2,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1 list

Interferon alpha/beta signaling, and Interferon-induced protein bottom of CD4+ T helper 18CL:4662 0.0026ADAR,BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1 44 family list

Interferon alpha/beta signaling, and Interferon gamma bottom of CD4+ T helper 18CL:4659 0.0026ADAR,BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,SP110,TRIM22,XAF1 signaling list

CD4+ T helper 18CL:22327 Oxidative phosphorylation top of list 0.0026ATP5H,MT-CO1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,NDUFS5

Interferon alpha/beta signaling, and Interferon gamma bottom of CD4+ T helper 18CL:4661 0.0026ADAR,BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,TRIM22,XAF1 signaling list

GTP hydrolysis and joining of the 60S ribosomal subunit, and CD4+ T helper 18CL:14967 top of list 0.0026EIF3L,EIF4B,RPL3,RPS26,RPS27A Protein export

CD4+ T helper 18CL:22328 respirasome top of list 0.0026MT-CO1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,NDUFS5

GTP hydrolysis and joining of the 60S ribosomal subunit, and CD4+ T helper 18CL:14963 top of list 0.0036EIF3L,EIF4B,EIF5A,RPL3,RPS26,RPS27A Nonsense-mediated mRNA decay

CD141+CLEC9A+ 19CL:14983 Peptide chain elongation top of list 0.00076EEF2,RPL17,RPL26,RPL3,RPL36A,RPL6,RPS26,RPS4X,RPS7 dendritic cell

CD141+CLEC9A+ 19CL:14978 Peptide chain elongation top of list 0.00076EEF2,RPL17,RPL26,RPL3,RPL36A,RPL4,RPL6,RPS26,RPS4X,RPS7 dendritic cell

CD141+CLEC9A+ 19CL:14985 Viral mRNA Translation top of list 0.0027RPL17,RPL26,RPL3,RPL6,RPS26,RPS4X,RPS7 dendritic cell

CD141+CLEC9A+ Interferon alpha/beta signaling, and Interferon gamma bottom of BST2,EPSTI1,IFI27,IFI35,IFI44,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,RSAD2,TRIM 20CL:4661 3.39E-05 dendritic cell signaling list 22,XAF1

CD141+CLEC9A+ Interferon alpha/beta signaling, and Interferon-induced protein bottom of 20CL:4662 3.39E-05BST2,EPSTI1,IFI27,IFI35,IFI44,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,RSAD2,XAF1 dendritic cell 44 family list

CD141+CLEC9A+ 20CL:22328 respirasome top of list 3.39E-05MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,UQCR10 dendritic cell CD141+CLEC9A+ bottom of 20CL:4665 Interferon alpha/beta signaling 3.39E-05BST2,IFI27,IFI35,IFI44,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,RSAD2,XAF1 dendritic cell list

CD141+CLEC9A+ 20CL:22327 Oxidative phosphorylation top of list 8.16E-05ATP6V0E1,MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,UQCR10 dendritic cell

CD141+CLEC9A+ bottom of 20CL:4670 type I interferon signaling pathway 0.00052IFI27,IFI35,IFI6,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,RSAD2,XAF1 dendritic cell list

CD141+CLEC9A+ bottom of 20CL:4668 type I interferon signaling pathway 0.00052BST2,IFI27,IFI35,IFI6,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,RSAD2,XAF1 dendritic cell list

CD141+CLEC9A+ 20CL:22502 Leber hereditary optic neuropathy top of list 0.00067MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4 dendritic cell

CD141+CLEC9A+ 20CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 0.0013MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4,UQCR10 dendritic cell

CD141+CLEC9A+ GTP hydrolysis and joining of the 60S ribosomal subunit, and 20CL:14967 top of list 0.0031EIF1,RPL21,RPS2,RPS26,RPS4X dendritic cell Protein export

CD141+CLEC9A+ 20CL:22332 mitochondrial respiratory chain complex I top of list 0.0059MT-ND2,MT-ND3,MT-ND4L,MT-ND5 dendritic cell

CD141+CLEC9A+ 20CL:14985 Viral mRNA Translation top of list 0.0076RPL21,RPS2,RPS26,RPS4X dendritic cell

CD1C-CD141- dendritic 21CL:22328 respirasome top of list 1.51E-05MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA3,UQCR10 cell

CD1C-CD141- dendritic ATP6V0E1,MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5, 21CL:22327 Oxidative phosphorylation top of list 1.51E-05 cell NDUFA3,UQCR10

CD1C-CD141- dendritic Interferon alpha/beta signaling, and Interferon-induced protein bottom of EPSTI1,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT2,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS3,OASL,PLSCR1,RSAD2, 21CL:4662 6.36E-05 cell 44 family list XAF1

CD1C-CD141- dendritic bottom of 21CL:4665 Interferon alpha/beta signaling 6.36E-05IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT2,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS3,OASL,RSAD2,XAF1 cell list

CD1C-CD141- dendritic bottom of 21CL:4670 type I interferon signaling pathway 0.00019IFI27,IFI35,IFI6,IFIT1,IFIT2,IFIT3,IFITM1,IFITM3,IRF7,ISG20,MX1,MX2,OAS3,OASL,RSAD2,XAF1 cell list

CD1C-CD141- dendritic 21CL:22502 Leber hereditary optic neuropathy top of list 0.00019MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4 cell CD1C-CD141- dendritic Interferon alpha/beta signaling, and Interferon gamma bottom of EPSTI1,FCGR1A,GBP1,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT2,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS3,O 21CL:4661 0.00019 cell signaling list ASL,PLSCR1,RSAD2,TRIM22,XAF1

CD1C-CD141- dendritic 21CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 0.00031MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4,UQCR10 cell

CD1C-CD141- dendritic GTP hydrolysis and joining of the 60S ribosomal subunit, and EEF1A1,EEF1B2,EEF2,EIF3F,EIF3L,EIF4B,NACA,PABPC1,RPL10,RPL10A,RPL21,RPL28,RPL3,RPL4,RPL5,RPL6,RPS2,R 21CL:14963 top of list 0.00031 cell Nonsense-mediated mRNA decay PS27L,RPS4X,RPS6

CD1C-CD141- dendritic Interferon alpha/beta signaling, and Interferon gamma bottom of EPSTI1,FCGR1A,GBP1,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT2,IFIT3,IFITM1,IFITM3,IRF2BP2,IRF7,ISG15,ISG20,MT2A,MX1,MX2 21CL:4659 0.00039 cell signaling list ,OAS3,OASL,PLSCR1,RSAD2,TRIM22,XAF1

CD1C-CD141- dendritic GTP hydrolysis and joining of the 60S ribosomal subunit, and EEF1A1,EEF1B2,EEF2,EIF3F,EIF3L,EIF4B,PABPC1,RPL10,RPL10A,RPL21,RPL28,RPL3,RPL4,RPL5,RPL6,RPS2,RPS27L, 21CL:14966 top of list 0.00045 cell Protein export RPS4X,RPS6

CD1C-CD141- dendritic GTP hydrolysis and joining of the 60S ribosomal subunit, and EEF1A1,EEF2,EIF3F,EIF3L,EIF4B,PABPC1,RPL10,RPL10A,RPL21,RPL28,RPL3,RPL4,RPL5,RPL6,RPS2,RPS27L,RPS4X, 21CL:14967 top of list 0.00093 cell Protein export RPS6

CD1C-CD141- dendritic 21CL:14978 Peptide chain elongation top of list 0.0088EEF1A1,EEF2,RPL10,RPL10A,RPL21,RPL28,RPL3,RPL4,RPL5,RPL6,RPS2,RPS27L,RPS4X,RPS6 cell

CD1C-CD141- dendritic 21CL:22332 mitochondrial respiratory chain complex I top of list 0.0088MT-ND1,MT-ND2,MT-ND3,MT-ND4L,MT-ND5,NDUFA3 cell

CD8+ T cell 22CL:22327 Oxidative phosphorylation top of list 9.26E-05ATP6V0E1,MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA3

CD8+ T cell 22CL:22328 respirasome top of list 9.26E-05MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA3

Interferon alpha/beta signaling, and Interferon-induced protein bottom of CD8+ T cell 22CL:4662 9.26E-05BST2,EPSTI1,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,XAF1 44 family list

bottom of CD8+ T cell 22CL:4665 Interferon alpha/beta signaling 9.26E-05BST2,IFI27,IFI35,IFI44,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1 list

bottom of CD8+ T cell 22CL:4668 type I interferon signaling pathway 0.00099BST2,IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1 list

CD8+ T cell 22CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 0.0012MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4

CD8+ T cell 22CL:22502 Leber hereditary optic neuropathy top of list 0.0018MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4

bottom of CD8+ T cell 22CL:4670 type I interferon signaling pathway 0.0021IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1 list

CD4+ T cell 23CL:22328 respirasome top of list 5.94E-05MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

CD4+ T cell 23CL:4662 Interferon alpha/beta signaling, and Interferon-induced protein bottom of 0.0015BST2,EPSTI1,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1 44 family list

bottom of CD4+ T cell 23CL:4665 Interferon alpha/beta signaling 0.0015BST2,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1 list

CD4+ T cell 23CL:22502 Leber hereditary optic neuropathy top of list 0.0015MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4

CD4+ T cell 23CL:14985 Viral mRNA Translation top of list 0.0015RPL21,RPL3,RPS2,RPS26,RPS4X

CD4+ T cell 23CL:14978 Peptide chain elongation top of list 0.0015RPL21,RPL3,RPL4,RPS2,RPS26,RPS4X

Interferon alpha/beta signaling, and Interferon gamma bottom of CD4+ T cell 23CL:4661 0.0016BST2,EPSTI1,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,TRIM22,XAF1 signaling list

bottom of CD4+ T cell 23CL:4670 type I interferon signaling pathway 0.0054IFI27,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1 list

CD4+ T cell 23CL:22332 mitochondrial respiratory chain complex I top of list 0.0054MT-ND2,MT-ND3,MT-ND4L,MT-ND5

GTP hydrolysis and joining of the 60S ribosomal subunit, and T cell(Activated T cell) 24CL:14967 top of list 7.36E-06EIF4B,RPL13,RPL13A,RPL21,RPL3,RPL4,RPS2,RPS26,RPS27A,RPS4X Protein export

T cell(Activated T cell) 24CL:14978 Peptide chain elongation top of list 1.50E-05RPL13,RPL13A,RPL21,RPL3,RPL4,RPS2,RPS26,RPS27A,RPS4X

T cell(Activated T cell) 24CL:14985 Viral mRNA Translation top of list 2.53E-05RPL13,RPL13A,RPL21,RPL3,RPS2,RPS26,RPS27A,RPS4X

T cell(Activated T cell) 24CL:22328 respirasome top of list 2.53E-05COX5A,MT-ATP6,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

bottom of T cell(Activated T cell) 24CL:4670 type I interferon signaling pathway 0.00027IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OAS2,OASL,RSAD2,XAF1 list

bottom of T cell(Activated T cell) 24CL:4668 type I interferon signaling pathway 0.00027BST2,IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OAS2,OASL,RSAD2,XAF1 list

T cell(Activated T cell) 24CL:22502 Leber hereditary optic neuropathy top of list 0.00092MT-ATP6,MT-CO3,MT-CYB,MT-ND4

T cell(Activated T cell) 24CL:22332 mitochondrial respiratory chain complex I top of list 0.0011MT-ND2,MT-ND3,MT-ND4L,MT-ND5

T cell(Activated T cell) 24CL:22408 Leber hereditary optic neuropathy top of list 0.0051MT-ND2,MT-ND4L,MT-ND5

T cell(Activated T cell) 24CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 0.0051COX5A,MT-ATP6,MT-CO3,MT-CYB,MT-ND4

Megakaryocyte progenitor 25CL:22328 respirasome top of list 3.60E-07COX6A1,MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5 cell

Megakaryocyte progenitor ATP5J2,COX6A1,MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT- 25CL:22327 Oxidative phosphorylation top of list 3.60E-07 cell ND5

Megakaryocyte progenitor 25CL:22502 Leber hereditary optic neuropathy top of list 4.56E-06MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4 cell Megakaryocyte progenitor bottom of BST2,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OAS2,OASL,RSAD2,XAF 25CL:4665 Interferon alpha/beta signaling 3.24E-05 cell list 1

Megakaryocyte progenitor 25CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 3.60E-05COX6A1,MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4 cell

Megakaryocyte progenitor 25CL:22332 mitochondrial respiratory chain complex I top of list 0.00032MT-ND1,MT-ND2,MT-ND3,MT-ND4L,MT-ND5 cell

Megakaryocyte progenitor bottom of 25CL:4668 type I interferon signaling pathway 0.00074BST2,IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OAS2,OASL,RSAD2,XAF1 cell list

Megakaryocyte progenitor bottom of 25CL:4670 type I interferon signaling pathway 0.0012IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OAS2,OASL,RSAD2,XAF1 cell list

Megakaryocyte progenitor 25CL:22408 Leber hereditary optic neuropathy top of list 0.0018MT-ND1,MT-ND2,MT-ND4L,MT-ND5 cell

T cell 26CL:22328 respirasome top of list 6.30E-05MT-ATP6,MT-CO3,MT-CYB,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

GTP hydrolysis and joining of the 60S ribosomal subunit, and T cell 26CL:14967 top of list 0.00015EIF4B,RPL13A,RPL27,RPS2,RPS26,RPS27A Protein export

T cell 26CL:14985 Viral mRNA Translation top of list 0.00038RPL13A,RPL27,RPS2,RPS26,RPS27A

Interferon alpha/beta signaling, and Interferon gamma bottom of T cell 26CL:4659 0.0006BST2,EPSTI1,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,SP110,TRIM22,XAF1 signaling list

Interferon alpha/beta signaling, and Interferon gamma bottom of T cell 26CL:4661 0.0006BST2,EPSTI1,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,TRIM22,XAF1 signaling list

Interferon alpha/beta signaling, and Interferon-induced protein bottom of T cell 26CL:4662 0.0006BST2,EPSTI1,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1 44 family list

bottom of T cell 26CL:4665 Interferon alpha/beta signaling 0.0006BST2,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1 list

T cell 26CL:22502 Leber hereditary optic neuropathy top of list 0.0016MT-ATP6,MT-CO3,MT-CYB,MT-ND4

bottom of T cell 26CL:4668 type I interferon signaling pathway 0.0046BST2,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1 list

bottom of T cell 26CL:4670 type I interferon signaling pathway 0.0046IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,XAF1 list

T cell 26CL:22332 mitochondrial respiratory chain complex I top of list 0.0057MT-ND3,MT-ND4L,MT-ND5 Megakaryocyte progenitor Interferon alpha/beta signaling, and Interferon-induced protein bottom of 27CL:4662 3.49E-05BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,OAS1,PLSCR1,RSAD2,XAF1 cell 44 family list

Megakaryocyte progenitor Interferon alpha/beta signaling, and Interferon gamma bottom of BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,OAS1,PLSCR1,RSAD2,TRIM22,X 27CL:4661 3.49E-05 cell signaling list AF1

Megakaryocyte progenitor bottom of 27CL:4665 Interferon alpha/beta signaling 0.00018BST2,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,OAS1,RSAD2,XAF1 cell list

Megakaryocyte progenitor Interferon alpha/beta signaling, and Interferon gamma bottom of BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF2,IRF7,ISG15,ISG20,MT2A,MX1,OAS1,PLSCR1,RSAD2,SP1 27CL:4659 0.00051 cell signaling list 10,TRIM22,XAF1

Megakaryocyte progenitor bottom of 27CL:4668 type I interferon signaling pathway 0.00058BST2,IFI27,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,OAS1,RSAD2,XAF1 cell list

Megakaryocyte progenitor bottom of 27CL:4670 type I interferon signaling pathway 0.00065IFI27,IFI6,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,OAS1,RSAD2,XAF1 cell list

Megakaryocyte progenitor 27CL:1048 EF-hand, Ca insensitive, and Vinculin top of list 0.0039TLN1,VCL,ZYX cell

CD1C+_B dendritic cell 28CL:14983 Peptide chain elongation top of list 2.35E-07RPL13A,RPL21,RPLP2,RPS14,RPS2,RPS26,RPS27A,RPS4X,RPS7,RPS8

CD1C+_B dendritic cell 28CL:14978 Peptide chain elongation top of list 2.35E-07RPL10,RPL13A,RPL21,RPL34,RPLP2,RPS14,RPS2,RPS26,RPS27A,RPS4X,RPS7,RPS8

CD1C+_B dendritic cell 28CL:14982 Peptide chain elongation top of list 2.35E-07RPL10,RPL13A,RPL21,RPLP2,RPS14,RPS2,RPS26,RPS27A,RPS4X,RPS7,RPS8

GTP hydrolysis and joining of the 60S ribosomal subunit, and CD1C+_B dendritic cell 28CL:14967 top of list 2.35E-07EIF4B,RPL10,RPL13A,RPL21,RPL34,RPLP2,RPS14,RPS2,RPS26,RPS27A,RPS3,RPS4X,RPS7,RPS8 Protein export

CD1C+_B dendritic cell 28CL:14985 Viral mRNA Translation top of list 3.76E-07RPL13A,RPL21,RPS14,RPS2,RPS26,RPS27A,RPS4X,RPS7,RPS8

immunoglobulin binding, and Immunoregulatory interactions bottom of CD1C+_B dendritic cell 28CL:4560 0.0022FCER1G,S100A8,S100A9 between a Lymphoid and a non-Lymphoid cell list

Interferon alpha/beta signaling, and Interferon gamma bottom of CD1C+_B dendritic cell 28CL:4661 0.0031BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,PLSCR1,TRIM22,XAF1 signaling list

Interferon alpha/beta signaling, and Interferon gamma bottom of BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,PLSCR1,SP110,TRIM22,XAF CD1C+_B dendritic cell 28CL:4659 0.0032 signaling list 1

bottom of CD1C+_B dendritic cell 28CL:4665 Interferon alpha/beta signaling 0.0033BST2,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,XAF1 list

Interferon alpha/beta signaling, and Interferon-induced protein bottom of CD1C+_B dendritic cell 28CL:4662 0.0041BST2,EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,PLSCR1,XAF1 44 family list COX5B,COX7A2,MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDU CD8+ T cell 29CL:22328 respirasome top of list 3.70E-07 FA3,NDUFB2

ATP5E,ATP6V0E1,COX5B,COX7A2,MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT- CD8+ T cell 29CL:22327 Oxidative phosphorylation top of list 3.70E-07 ND4,MT-ND4L,MT-ND5,NDUFA3,NDUFB2

CD8+ T cell 29CL:22502 Leber hereditary optic neuropathy top of list 2.71E-06MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4

CD8+ T cell 29CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 2.78E-05COX5B,COX7A2,MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4

bottom of CD8+ T cell 29CL:4665 Interferon alpha/beta signaling 4.29E-05BST2,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OAS2,OASL,RSAD2,XAF1 list

CD8+ T cell 29CL:22408 Leber hereditary optic neuropathy top of list 0.0012MT-ND1,MT-ND2,MT-ND4L,MT-ND5

bottom of CD8+ T cell 29CL:4668 type I interferon signaling pathway 0.0017BST2,IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OAS2,OASL,RSAD2,XAF1 list

CD8+ T cell 29CL:22332 mitochondrial respiratory chain complex I top of list 0.0017MT-ND1,MT-ND2,MT-ND3,MT-ND4L,MT-ND5,NDUFA3,NDUFB2

bottom of CD8+ T cell 29CL:4670 type I interferon signaling pathway 0.0026IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OAS2,OASL,RSAD2,XAF1 list

Interferon alpha/beta signaling, and Interferon-induced protein bottom of BST2,EPSTI1,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OAS2,OASL,PLSCR1,R CD8+ T cell 29CL:4662 0.0045 44 family list SAD2,XAF1

Interferon alpha/beta signaling, and Interferon gamma bottom of BST2,EPSTI1,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,OAS2,OASL,PLS CD8+ T cell 29CL:4661 0.0049 signaling list CR1,RSAD2,TRIM22,XAF1

CD1C-CD141- dendritic 30CL:22327 Oxidative phosphorylation top of list 6.19E-05ATP6V0E1,MT-ATP6,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA3,UQCR10 cell

CD1C-CD141- dendritic 30CL:22328 respirasome top of list 6.19E-05MT-ATP6,MT-CO3,MT-CYB,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA3,UQCR10 cell

CD1C-CD141- dendritic Interferon alpha/beta signaling, and Interferon-induced protein bottom of 30CL:4662 0.00083BST2,EPSTI1,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,RSAD2,XAF1 cell 44 family list

CD1C-CD141- dendritic Interferon alpha/beta signaling, and Interferon gamma bottom of 30CL:4661 0.00083BST2,EPSTI1,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,RSAD2,TRIM22,XAF1 cell signaling list

CD1C-CD141- dendritic Interferon alpha/beta signaling, and Interferon gamma bottom of BST2,EPSTI1,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,RSAD2,SP110,TRIM22, 30CL:4659 0.00096 cell signaling list XAF1

CD1C-CD141- dendritic bottom of 30CL:4665 Interferon alpha/beta signaling 0.00096BST2,IFI27,IFI44,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,RSAD2,XAF1 cell list CD1C-CD141- dendritic 30CL:22502 Leber hereditary optic neuropathy top of list 0.0018MT-ATP6,MT-CO3,MT-CYB,MT-ND4 cell

CD1C-CD141- dendritic 30CL:22332 mitochondrial respiratory chain complex I top of list 0.0051MT-ND2,MT-ND3,MT-ND4L,MT-ND5,NDUFA3 cell

CD1C-CD141- dendritic 30CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 0.0051MT-ATP6,MT-CO3,MT-CYB,MT-ND4,UQCR10 cell

CD1C-CD141- dendritic 30CL:22408 Leber hereditary optic neuropathy top of list 0.0087MT-ND2,MT-ND4L,MT-ND5 cell

CD8 cytoxict cells 31CL:22328 respirasome top of list 3.80E-07MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,UQCR10

ATP6V0E1,MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5, CD8 cytoxict cells 31CL:22327 Oxidative phosphorylation top of list 3.80E-07 UQCR10

bottom of BST2,IFI27,IFI35,IFI44L,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OASL,RSAD2,SAMD9L, CD8 cytoxict cells 31CL:4665 Interferon alpha/beta signaling 1.90E-05 list XAF1

CD8 cytoxict cells 31CL:22502 Leber hereditary optic neuropathy top of list 2.09E-05MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4

GTP hydrolysis and joining of the 60S ribosomal subunit, and CD8 cytoxict cells 31CL:14967 top of list 8.97E-05EIF1,EIF4B,RPL13,RPL13A,RPL21,RPL26,RPL36A,RPS19,RPS2,RPS26,RPS27,RPS27A,RPS4X Protein export

CD8 cytoxict cells 31CL:22446 cytochrome complex, and Cytochrome c oxidase subunit VII top of list 0.00015MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4,UQCR10

bottom of CD8 cytoxict cells 31CL:4668 type I interferon signaling pathway 0.00016BST2,IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OASL,RSAD2,XAF1 list

CD8 cytoxict cells 31CL:14982 Peptide chain elongation top of list 0.00018RPL13,RPL13A,RPL21,RPL26,RPL36A,RPS19,RPS2,RPS26,RPS27,RPS27A,RPS4X

CD8 cytoxict cells 31CL:14983 Peptide chain elongation top of list 0.00025RPL13,RPL13A,RPL21,RPL26,RPL36A,RPS19,RPS2,RPS26,RPS27A,RPS4X

bottom of CD8 cytoxict cells 31CL:4670 type I interferon signaling pathway 0.00025IFI27,IFI35,IFI6,IFIT1,IFIT3,IFITM1,IFITM2,IFITM3,IRF7,ISG20,MX1,MX2,OAS1,OASL,RSAD2,XAF1 list

CD8 cytoxict cells 31CL:14985 Viral mRNA Translation top of list 0.00046RPL13,RPL13A,RPL21,RPL26,RPS19,RPS2,RPS26,RPS27A,RPS4X

CD8 cytoxict cells 31CL:22332 mitochondrial respiratory chain complex I top of list 0.00082MT-ND1,MT-ND2,MT-ND3,MT-ND4L,MT-ND5

CD8 cytoxict cells 31CL:22408 Leber hereditary optic neuropathy top of list 0.0025MT-ND1,MT-ND2,MT-ND4L,MT-ND5

Interferon alpha/beta signaling, and Interferon-induced protein bottom of CD8 cytoxict cells 34CL:4662 0.00054DDX60,EPSTI1,GBP2,IFI44L,IFI6,IFIT3,ISG15,ISG20,MX2,OAS3,USP18 44 family list

bottom of CD8 cytoxict cells 34CL:4665 Interferon alpha/beta signaling 0.00065DDX60,GBP2,IFI44L,IFI6,IFIT3,ISG15,ISG20,MX2,OAS3,USP18 list GTP hydrolysis and joining of the 60S ribosomal subunit, and CD8+ T cell 37CL:14966 top of list 0.0031RPL3,RPS26,RPS4X,TPT1 Protein export

CD8+ T cell 37CL:14985 Viral mRNA Translation top of list 0.0054RPL3,RPS26,RPS4X

Interferon alpha/beta signaling, and Interferon-induced protein bottom of CD8+ T cell 40CL:4662 0.0073BST2,EPSTI1,IFI27,IFI44L,IFI6,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OAS3,PLSCR1,XAF1 44 family list

Interferon alpha/beta signaling, and Interferon gamma bottom of CD8+ T cell 40CL:4661 0.0073BST2,EPSTI1,IFI27,IFI44L,IFI6,IFITM1,IFITM3,IRF7,ISG15,ISG20,MT2A,MX1,MX2,OAS1,OAS3,PLSCR1,TRIM22,XAF1 signaling list

bottom of CD8+ T cell 40CL:4665 Interferon alpha/beta signaling 0.0073BST2,IFI27,IFI44L,IFI6,IFITM1,IFITM3,IRF7,ISG15,ISG20,MX1,MX2,OAS1,OAS3,XAF1 list

Plasmacytoid dendritic 43CL:14983 Peptide chain elongation top of list 0.01RPL26,RPL36A,RPS26 cell Table S5 Compared with the normal controls, significant enriched pathways of each cell subtypes in the moderate condition (patient 3, 4, 5, 6, 7 and 8)

false clus type #term ID term description direction discov matching proteins in your input (labels) ter ery rate

Activated 2CL:4665 Interferon alpha/beta signaling bottom of list 0.0017IFI44L,IFI6,IFITM1,ISG15,MX1,XAF1 CD4+ T cell

Activated 2CL:22328 respirasome top of list 0.0035MT-ATP6,MT-CO3,MT-CYB,MT-ND3,MT-ND4,MT-ND4L,MT-ND5 CD4+ T cell

AP-1 transcription factor, and Transcription CD8+ T cell 3CL:2482 bottom of list 0.0071FOS,JUN,JUNB factor Jun

mixed, incl. MAPK targets/ Nuclear events

CD8+ T cell 3CL:2403 mediated by MAP kinases, and bZIP Maf bottom of list 0.0071DUSP1,FOS,IER2,JUN,JUNB

transcription factor

bZIP transcription factor, and Early growth CD8+ T cell 3CL:2481 bottom of list 0.0096FOS,IER2,JUN,JUNB response, N-terminal

Megakaryocyt e progenitor 4CL:4665 Interferon alpha/beta signaling bottom of list 0.00096IFI27,IFI44L,IFI6,IFITM1,ISG15 cell

CD141+CLEC

9A+ dendritic 5CL:4665 Interferon alpha/beta signaling bottom of list 0.00091IFI44L,IFIT3,IFITM1,ISG15,XAF1 cell

CD141+CLEC mixed, incl. MAPK targets/ Nuclear events

9A+ dendritic 5CL:2403 mediated by MAP kinases, and bZIP Maf bottom of list 0.0046DUSP1,FOS,IER2,JUN,JUNB cell transcription factor

CD141+CLEC bZIP transcription factor, and Early growth 9A+ dendritic 5CL:2481 bottom of list 0.0066FOS,IER2,JUN,JUNB response, N-terminal cell

CD141+CLEC 5CL:4670 type I interferon signaling pathway bottom of list 0.0066IFIT3,IFITM1,XAF1 9A+ dendritic cell

CD141+CLEC

9A+ dendritic 5CL:22328 respirasome top of list 0.0066MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND3,MT-ND4,MT-ND4L cell

CD1C+_B GTP hydrolysis and joining of the 60S 6CL:14967 top of list 0.00019EEF1A1,EEF2,EIF3L,EIF4B,PABPC1,RPL13,RPL15,RPL26,RPL3,RPL36A,RPL4,RPL5,RPL6,RPLP0,RPLP1,RPS23,RPS26,RPS4X,RPS6,RPS8 dendritic cell ribosomal subunit, and Protein export

CD1C+_B 6CL:14978 Peptide chain elongation top of list 0.00057EEF1A1,EEF2,RPL13,RPL15,RPL26,RPL3,RPL36A,RPL4,RPL5,RPL6,RPLP0,RPLP1,RPS23,RPS26,RPS4X,RPS6,RPS8 dendritic cell

CD1C+_B 6CL:4670 type I interferon signaling pathway bottom of list 0.0006IFI27,IFI6,IFITM1,IFITM2,IFITM3,MX1 dendritic cell

CD1C+_B 6CL:14982 Peptide chain elongation top of list 0.0006EEF2,RPL13,RPL15,RPL26,RPL3,RPL36A,RPL5,RPL6,RPLP0,RPLP1,RPS23,RPS26,RPS4X,RPS6,RPS8 dendritic cell

CD1C+_B 6CL:4665 Interferon alpha/beta signaling bottom of list 0.0006IFI27,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MX1 dendritic cell

CD1C+_B Interferon alpha/beta signaling, and 6CL:4662 bottom of list 0.0006EPSTI1,IFI27,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MX1 dendritic cell Interferon-induced protein 44 family

CD1C+_B Interferon alpha/beta signaling, and 6CL:4661 bottom of list 0.0006EPSTI1,IFI27,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MT2A,MX1 dendritic cell Interferon gamma signaling

CD1C+_B 6CL:14983 Peptide chain elongation top of list 0.0034EEF2,RPL13,RPL15,RPL26,RPL3,RPL36A,RPL6,RPS23,RPS26,RPS4X,RPS6,RPS8 dendritic cell

CD1C+_B GTP hydrolysis and joining of the 60S EEF1A1,EEF1B2,EEF2,EIF3L,EIF4B,PABPC1,RPL13,RPL15,RPL26,RPL3,RPL36A,RPL4,RPL5,RPL6,RPLP0,RPLP1,RPS23,RPS26,RPS4X,RPS6,RPS8, 6CL:14966 top of list 0.0059 dendritic cell ribosomal subunit, and Protein export TPT1

CD1C+_B 6CL:14985 Viral mRNA Translation top of list 0.0093RPL13,RPL15,RPL26,RPL3,RPL6,RPS23,RPS26,RPS4X,RPS6,RPS8 dendritic cell

Plasmacytoid 7CL:4665 Interferon alpha/beta signaling bottom of list 0.0013BST2,IFI44L,IFI6,IFITM1,IFITM3,IRF7,ISG15,MX1,XAF1 dendritic cell

Plasmacytoid 7CL:4668 type I interferon signaling pathway bottom of list 0.006BST2,IFI6,IFITM1,IFITM3,IRF7,MX1,XAF1 dendritic cell

Plasmacytoid 7CL:4670 type I interferon signaling pathway bottom of list 0.0077IFI6,IFITM1,IFITM3,IRF7,MX1,XAF1 dendritic cell CD1C+_B 8CL:4665 Interferon alpha/beta signaling bottom of list 0.0013IFI27,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MX1,XAF1 dendritic cell

CD1C+_B Interferon alpha/beta signaling, and 8CL:4661 bottom of list 0.0013EPSTI1,IFI27,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MT2A,MX1,XAF1 dendritic cell Interferon gamma signaling

CD1C+_B GTP hydrolysis and joining of the 60S 8CL:14967 top of list 0.0013EEF1A1,EEF2,EIF4B,PABPC1,RPL13,RPL26,RPL3,RPL6,RPLP0,RPLP1,RPS26,RPS6 dendritic cell ribosomal subunit, and Protein export

CD1C+_B GTP hydrolysis and joining of the 60S 8CL:14966 top of list 0.0013EEF1A1,EEF2,EIF4B,PABPC1,RPL13,RPL26,RPL3,RPL6,RPLP0,RPLP1,RPS26,RPS6,TPT1 dendritic cell ribosomal subunit, and Protein export

CD1C+_B Interferon alpha/beta signaling, and 8CL:4662 bottom of list 0.0014EPSTI1,IFI27,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MX1,XAF1 dendritic cell Interferon-induced protein 44 family

CD1C+_B 8CL:4670 type I interferon signaling pathway bottom of list 0.0023IFI27,IFI6,IFITM1,IFITM2,IFITM3,MX1,XAF1 dendritic cell

CD1C+_B 8CL:14978 Peptide chain elongation top of list 0.0024EEF1A1,EEF2,RPL13,RPL26,RPL3,RPL6,RPLP0,RPLP1,RPS26,RPS6 dendritic cell

CD1C+_B 8CL:14982 Peptide chain elongation top of list 0.0034EEF2,RPL13,RPL26,RPL3,RPL6,RPLP0,RPLP1,RPS26,RPS6 dendritic cell

CD4+ T cell 9CL:4665 Interferon alpha/beta signaling bottom of list 0.0013IFI44L,IFI6,IFITM1,ISG15,XAF1

CD8+ T cell 10CL:4665 Interferon alpha/beta signaling bottom of list 0.0026IFI44L,IFITM1,ISG15,XAF1

Plasmacytoid 12CL:4665 Interferon alpha/beta signaling bottom of list 0.00041BST2,IFI44L,IFI6,IFITM1,IFITM3,ISG15,MX1,XAF1 dendritic cell

Plasmacytoid 12CL:4668 type I interferon signaling pathway bottom of list 0.0046BST2,IFI6,IFITM1,IFITM3,MX1,XAF1 dendritic cell

Plasmacytoid 12CL:4670 type I interferon signaling pathway bottom of list 0.0074IFI6,IFITM1,IFITM3,MX1,XAF1 dendritic cell

CD8+ T cell 13CL:4665 Interferon alpha/beta signaling bottom of list 0.00058IFI44L,IFI6,IFITM1,ISG15,MX1,XAF1

CD8+ T cell 13CL:4670 type I interferon signaling pathway bottom of list 0.0079IFI6,IFITM1,MX1,XAF1

Megakaryocyt GTP hydrolysis and joining of the 60S e progenitor 14CL:14966 top of list 0.0021EEF1A1,EIF3L,EIF4B,RPL13,RPL13A,RPL21,RPL3,RPLP1,RPS12,RPS14,RPS18,RPS19,RPS23,RPS3,RPS4X,RPS6,TPT1 ribosomal subunit, and Protein export cell

Megakaryocyt 14CL:22502 Leber hereditary optic neuropathy top of list 0.0021MT-ATP6,MT-CO3,MT-CYB,MT-ND4 e progenitor cell

Megakaryocyt Interferon alpha/beta signaling, and e progenitor 14CL:4661 bottom of list 0.0025IFI27,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MT2A Interferon gamma signaling cell

Megakaryocyt e progenitor 14CL:4665 Interferon alpha/beta signaling bottom of list 0.0025IFI27,IFI6,IFITM1,IFITM2,IFITM3,ISG15 cell

Megakaryocyt GTP hydrolysis and joining of the 60S e progenitor 14CL:14967 top of list 0.0025EEF1A1,EIF3L,EIF4B,RPL13,RPL13A,RPL21,RPL3,RPLP1,RPS12,RPS14,RPS18,RPS19,RPS23,RPS3,RPS4X,RPS6 ribosomal subunit, and Protein export cell

Megakaryocyt e progenitor 14CL:14978 Peptide chain elongation top of list 0.0056EEF1A1,RPL13,RPL13A,RPL21,RPL3,RPLP1,RPS12,RPS14,RPS18,RPS19,RPS23,RPS4X,RPS6 cell

Megakaryocyt e progenitor 14CL:14982 Peptide chain elongation top of list 0.0092RPL13,RPL13A,RPL21,RPL3,RPLP1,RPS12,RPS14,RPS18,RPS19,RPS23,RPS4X,RPS6 cell

Effector CD8+ memory T 16CL:4665 Interferon alpha/beta signaling bottom of list 0.00031BST2,IFI44L,IFI6,IFITM1,IFITM3,IRF1,ISG15,MX1,XAF1

(Tem) cell

Effector CD8+ memory T 16CL:4668 type I interferon signaling pathway bottom of list 0.0023BST2,IFI6,IFITM1,IFITM3,IRF1,MX1,XAF1

(Tem) cell

Effector CD8+ memory T 16CL:4670 type I interferon signaling pathway bottom of list 0.0023IFI6,IFITM1,IFITM3,MX1,XAF1

(Tem) cell

CD8+ T cell 18CL:22328 respirasome top of list 0.0026MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

Megakaryocyt e progenitor 20CL:22502 Leber hereditary optic neuropathy top of list 0.00058MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4 cell

Megakaryocyt 20CL:22446 cytochrome complex, and Cytochrome c top of list 0.00058MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4 e progenitor oxidase subunit VII cell

Megakaryocyt e progenitor 20CL:4665 Interferon alpha/beta signaling bottom of list 0.0027IFI27,IFI44L,IFI6,IFITM3 cell

Megakaryocyt e progenitor 20CL:22328 respirasome top of list 0.003MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA6 cell

Megakaryocyt e progenitor 20CL:22327 Oxidative phosphorylation top of list 0.0033MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5,NDUFA6 cell

Megakaryocyt e progenitor 20CL:4670 type I interferon signaling pathway bottom of list 0.0033IFI27,IFI6,IFITM3 cell

CD1C-CD141- 22CL:4665 Interferon alpha/beta signaling bottom of list 0.0024IFI44L,IFITM1,IFITM2,IFITM3,ISG15,XAF1 dendritic cell

CD1C-CD141- Interferon alpha/beta signaling, and 22CL:4661 bottom of list 0.0052IFI44L,IFITM1,IFITM2,IFITM3,ISG15,MT2A,XAF1 dendritic cell Interferon gamma signaling

CD1C-CD141- 22CL:4670 type I interferon signaling pathway bottom of list 0.0082IFITM1,IFITM2,IFITM3,XAF1 dendritic cell

Naive CD8+ T 24CL:4665 Interferon alpha/beta signaling bottom of list 0.0097IFI44L,IFITM1,ISG15,XAF1 cell

CD8+ T cell 25CL:4665 Interferon alpha/beta signaling bottom of list 0.0029IFI44L,IFITM1,ISG15,MX1

CD1C-CD141- 26CL:22328 respirasome top of list 0.00086MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5 dendritic cell

CD1C-CD141- Interferon alpha/beta signaling, and 26CL:4662 bottom of list 0.0021EPSTI1,IFI27,IFI44L,IFI6,IFITM1,IFITM3,ISG15,MX1,XAF1 dendritic cell Interferon-induced protein 44 family

CD1C-CD141- 26CL:4665 Interferon alpha/beta signaling bottom of list 0.0021IFI27,IFI44L,IFI6,IFITM1,IFITM3,ISG15,MX1,XAF1 dendritic cell

CD1C-CD141- 26CL:22502 Leber hereditary optic neuropathy top of list 0.0065MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4 dendritic cell CD141+CLEC Interferon alpha/beta signaling, and 9A+ dendritic 28CL:4661 bottom of list 0.00052EPSTI1,IFI27,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MT2A,MX1,XAF1 Interferon gamma signaling cell

CD141+CLEC

9A+ dendritic 28CL:4665 Interferon alpha/beta signaling bottom of list 0.00052IFI27,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MX1,XAF1 cell

CD141+CLEC Interferon alpha/beta signaling, and 9A+ dendritic 28CL:4662 bottom of list 0.00052EPSTI1,IFI27,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MX1,XAF1 Interferon-induced protein 44 family cell

CD141+CLEC GTP hydrolysis and joining of the 60S 9A+ dendritic 28CL:14966 top of list 0.00052EEF1A1,EEF1B2,EEF2,EIF3L,EIF4B,PABPC1,RPL13,RPL26,RPL3,RPL36A,RPL4,RPLP0,RPS26,RPS6,TPT1 ribosomal subunit, and Protein export cell

CD141+CLEC

9A+ dendritic 28CL:4670 type I interferon signaling pathway bottom of list 0.00072IFI27,IFI6,IFITM1,IFITM2,IFITM3,MX1,XAF1 cell

CD141+CLEC GTP hydrolysis and joining of the 60S 9A+ dendritic 28CL:14967 top of list 0.00084EEF1A1,EEF2,EIF3L,EIF4B,PABPC1,RPL13,RPL26,RPL3,RPL36A,RPL4,RPLP0,RPS26,RPS6 ribosomal subunit, and Protein export cell

CD141+CLEC

9A+ dendritic 28CL:14978 Peptide chain elongation top of list 0.0077EEF1A1,EEF2,RPL13,RPL26,RPL3,RPL36A,RPL4,RPLP0,RPS26,RPS6 cell

CD141+CLEC 5.52E-0 9A+ dendritic 29CL:4665 Interferon alpha/beta signaling bottom of list IFI44L,IFITM1,IRF7,ISG15,XAF1 5 cell

CD141+CLEC

9A+ dendritic 29CL:4670 type I interferon signaling pathway bottom of list 0.0041IFITM1,IRF7,XAF1 cell

CD141+CLEC

9A+ dendritic 29CL:22502 Leber hereditary optic neuropathy top of list 0.0041MT-CO1,MT-CO3,MT-CYB,MT-ND4 cell

Megakaryocyt 30CL:22328 respirasome top of list 0.0036MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4,MT-ND4L,MT-ND5 e progenitor cell

Megakaryocyt e progenitor 30CL:4665 Interferon alpha/beta signaling bottom of list 0.0084IFI27,IFI44L,IFI6,IFITM1,IFITM3,ISG15,MX1,XAF1 cell

Megakaryocyt e progenitor 30CL:22502 Leber hereditary optic neuropathy top of list 0.0092MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4 cell

Megakaryocyt GTP hydrolysis and joining of the 60S e progenitor 31CL:14966 top of list 0.00025EIF4B,RPL13,RPL13A,RPL21,RPL23A,RPL3,RPL6,RPS14,RPS16,RPS18,RPS19,RPS23,RPS3,RPS3A,RPS4X,RPS5,RPS6,RPS8,TPT1 ribosomal subunit, and Protein export cell

Megakaryocyt GTP hydrolysis and joining of the 60S e progenitor 31CL:14967 top of list 0.00027EIF4B,RPL13,RPL13A,RPL21,RPL23A,RPL3,RPL6,RPS14,RPS16,RPS18,RPS19,RPS23,RPS3,RPS3A,RPS4X,RPS5,RPS6,RPS8 ribosomal subunit, and Protein export cell

Megakaryocyt e progenitor 31CL:14985 Viral mRNA Translation top of list 0.00046RPL13,RPL13A,RPL21,RPL23A,RPL3,RPL6,RPS14,RPS16,RPS18,RPS19,RPS23,RPS3A,RPS4X,RPS5,RPS6,RPS8 cell

Megakaryocyt e progenitor 31CL:22328 respirasome top of list 0.0005MT-ATP6,MT-CO2,MT-CO3,MT-CYB,MT-ND2,MT-ND4,MT-ND4L,MT-ND5 cell

Megakaryocyt e progenitor 31CL:22502 Leber hereditary optic neuropathy top of list 0.00084MT-ATP6,MT-CO3,MT-CYB,MT-ND4 cell

Megakaryocyt cytochrome complex, and Cytochrome c e progenitor 31CL:22446 top of list 0.0011MT-ATP6,MT-CO2,MT-CO3,MT-CYB,MT-ND4 oxidase subunit VII cell

Megakaryocyt Interferon alpha/beta signaling, and e progenitor 31CL:4662 bottom of list 0.0017EPSTI1,IFI27,IFI6,IFITM3 Interferon-induced protein 44 family cell

Megakaryocyt 31CL:4670 type I interferon signaling pathway bottom of list 0.0033IFI27,IFI6,IFITM3 e progenitor cell

CD8+ T cell 32CL:22328 respirasome top of list 0.0069MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND3,MT-ND4,MT-ND4L,MT-ND5

cytochrome complex, and Cytochrome c CD8+ T cell 32CL:22446 top of list 0.0075MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4 oxidase subunit VII

CD8+ T cell 32CL:22502 Leber hereditary optic neuropathy top of list 0.0075MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4

EEF1A1,FAU,RPL10,RPL10A,RPL11,RPL12,RPL13,RPL13A,RPL14,RPL18,RPL19,RPL21,RPL23A,RPL26,RPL3,RPL32,RPL34,RPL35A,RPL36A,RPL39, CD1C+_B 8.27E-0 33CL:14978 Peptide chain elongation top of list RPL5,RPL6,RPL7A,RPL9,RPLP0,RPLP1,RPLP2,RPS12,RPS13,RPS14,RPS15,RPS15A,RPS16,RPS18,RPS21,RPS23,RPS26,RPS27,RPS27A,RPS28,R dendritic cell 6 PS3A,RPS4X,RPS5,RPS6,RPS7,RPS8

EEF1A1,FAU,RPL10,RPL10A,RPL11,RPL12,RPL13,RPL13A,RPL14,RPL18,RPL19,RPL21,RPL23A,RPL26,RPL3,RPL30,RPL32,RPL34,RPL35A,RPL36A, CD1C+_B 8.27E-0 33CL:14976 Peptide chain elongation top of list RPL39,RPL5,RPL6,RPL7A,RPL9,RPLP0,RPLP1,RPLP2,RPS12,RPS13,RPS14,RPS15,RPS15A,RPS16,RPS18,RPS21,RPS23,RPS26,RPS27,RPS27A,RP dendritic cell 6 S28,RPS3A,RPS4X,RPS5,RPS6,RPS7,RPS8

EEF1A1,EIF1,EIF4B,FAU,PABPC1,RPL10,RPL10A,RPL11,RPL12,RPL13,RPL13A,RPL14,RPL18,RPL19,RPL21,RPL23A,RPL26,RPL3,RPL30,RPL32,RPL CD1C+_B GTP hydrolysis and joining of the 60S 8.27E-0 33CL:14967 top of list 34,RPL35A,RPL36A,RPL39,RPL5,RPL6,RPL7A,RPL9,RPLP0,RPLP1,RPLP2,RPS12,RPS13,RPS14,RPS15,RPS15A,RPS16,RPS18,RPS21,RPS23,RPS2 dendritic cell ribosomal subunit, and Protein export 6 6,RPS27,RPS27A,RPS28,RPS3,RPS3A,RPS4X,RPS5,RPS6,RPS7,RPS8,RPSA

EEF1A1,EEF1B2,EIF1,EIF4B,FAU,PABPC1,RPL10,RPL10A,RPL11,RPL12,RPL13,RPL13A,RPL14,RPL18,RPL19,RPL21,RPL23A,RPL26,RPL3,RPL30,RP CD1C+_B GTP hydrolysis and joining of the 60S 8.27E-0 33CL:14966 top of list L32,RPL34,RPL35A,RPL36A,RPL39,RPL5,RPL6,RPL7A,RPL9,RPLP0,RPLP1,RPLP2,RPS12,RPS13,RPS14,RPS15,RPS15A,RPS16,RPS18,RPS21,RPS dendritic cell ribosomal subunit, and Protein export 6 23,RPS26,RPS27,RPS27A,RPS28,RPS3,RPS3A,RPS4X,RPS5,RPS6,RPS7,RPS8,RPSA,TPT1

FAU,RPL10,RPL10A,RPL11,RPL12,RPL13,RPL13A,RPL14,RPL18,RPL19,RPL21,RPL23A,RPL26,RPL3,RPL32,RPL35A,RPL36A,RPL39,RPL5,RPL6,RPL CD1C+_B 1.10E-0 33CL:14980 Peptide chain elongation top of list 7A,RPL9,RPLP0,RPLP1,RPLP2,RPS12,RPS13,RPS14,RPS15,RPS15A,RPS16,RPS18,RPS21,RPS23,RPS26,RPS27,RPS27A,RPS28,RPS3A,RPS4X,RP dendritic cell 5 S5,RPS6,RPS7,RPS8

FAU,RPL10,RPL10A,RPL11,RPL12,RPL13,RPL13A,RPL14,RPL19,RPL21,RPL23A,RPL26,RPL3,RPL32,RPL35A,RPL36A,RPL39,RPL5,RPL6,RPL7A,RPL CD1C+_B 1.18E-0 33CL:14982 Peptide chain elongation top of list 9,RPLP0,RPLP1,RPLP2,RPS12,RPS13,RPS14,RPS15,RPS15A,RPS16,RPS18,RPS21,RPS23,RPS26,RPS27,RPS27A,RPS28,RPS3A,RPS4X,RPS5,RPS dendritic cell 5 6,RPS7,RPS8

CD1C+_B 3.79E-0FAU,RPL10A,RPL11,RPL12,RPL13,RPL13A,RPL14,RPL19,RPL21,RPL23A,RPL26,RPL3,RPL32,RPL35A,RPL36A,RPL39,RPL6,RPL7A,RPL9,RPLP2,RP 33CL:14983 Peptide chain elongation top of list dendritic cell 5S12,RPS13,RPS14,RPS15,RPS15A,RPS16,RPS18,RPS21,RPS23,RPS26,RPS27A,RPS28,RPS3A,RPS4X,RPS5,RPS6,RPS7,RPS8

CD1C+_B specific granule lumen, and azurophil 4.70E-0 33CL:10246 bottom of list CAMP,CST3,CTSS,GRN,LCN2,LTF,LYZ,MNDA,OLFM4,RETN dendritic cell granule lumen 5

CD1C+_B specific granule lumen, and Vitamin B6 6.01E-0 33CL:10247 bottom of list CAMP,CST3,CTSS,LCN2,LTF,LYZ,OLFM4 dendritic cell metabolism 5

CD1C+_B 6.09E-0FAU,RPL10A,RPL11,RPL12,RPL13,RPL13A,RPL14,RPL19,RPL21,RPL23A,RPL26,RPL3,RPL35A,RPL39,RPL6,RPL7A,RPL9,RPS12,RPS13,RPS14,RPS 33CL:14985 Viral mRNA Translation top of list dendritic cell 515,RPS15A,RPS16,RPS18,RPS21,RPS23,RPS26,RPS27A,RPS28,RPS3A,RPS4X,RPS5,RPS6,RPS7,RPS8 CD1C+_B 33CL:4615 neutrophil aggregation, and Aquaporin 9 bottom of list 0.00028S100A12,S100A8,S100A9 dendritic cell

immunoglobulin binding, and CD1C+_B 33CL:4560 Immunoregulatory interactions between a bottom of list 0.0004CD14,FCER1G,S100A12,S100A8,S100A9,TYROBP dendritic cell Lymphoid and a non-Lymphoid cell

mixed, incl. antigen receptor-mediated

CD1C+_B signaling pathway, and Immunoregulatory 33CL:4442 bottom of list 0.00051CD14,FCER1G,S100A12,S100A8,S100A9,SPI1,TYROBP dendritic cell interactions between a Lymphoid and a

non-Lymphoid cell

CD1C+_B mixed, incl. lipoteichoic acid binding, and 33CL:4594 bottom of list 0.00057CD14,S100A12,S100A8,S100A9,TYROBP dendritic cell neutrophil aggregation

CD1C+_B 33CL:10251 specific granule lumen bottom of list 0.00097CAMP,CST3,CTSS,LTF,LYZ,OLFM4 dendritic cell

CD1C+_B 33CL:10260 specific granule lumen bottom of list 0.0017CAMP,LTF,LYZ,OLFM4 dendritic cell

CD1C-CD141- 34CL:22327 Oxidative phosphorylation top of list 0.00062MT-ATP6,MT-ATP8,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5 dendritic cell

CD1C-CD141- 34CL:22328 respirasome top of list 0.00062MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND1,MT-ND2,MT-ND3,MT-ND4,MT-ND4L,MT-ND5 dendritic cell

CD1C-CD141- 34CL:4665 Interferon alpha/beta signaling bottom of list 0.0011IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,ISG15,MX1,XAF1 dendritic cell

CD1C-CD141- Interferon alpha/beta signaling, and 34CL:4662 bottom of list 0.0011EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,ISG15,MX1,PLSCR1,XAF1 dendritic cell Interferon-induced protein 44 family

CD1C-CD141- Interferon alpha/beta signaling, and 34CL:4661 bottom of list 0.0011EPSTI1,IFI27,IFI44L,IFI6,IFIT3,IFITM1,IFITM3,ISG15,MT2A,MX1,PLSCR1,XAF1 dendritic cell Interferon gamma signaling

CD1C-CD141- 34CL:4670 type I interferon signaling pathway bottom of list 0.0033IFI27,IFI6,IFIT3,IFITM1,IFITM3,MX1,XAF1 dendritic cell

CD1C-CD141- cytochrome complex, and Cytochrome c 34CL:22446 top of list 0.0066MT-ATP6,MT-CO1,MT-CO2,MT-CO3,MT-CYB,MT-ND4 dendritic cell oxidase subunit VII

CD1C-CD141- 34CL:22502 Leber hereditary optic neuropathy top of list 0.0066MT-ATP6,MT-CO1,MT-CO3,MT-CYB,MT-ND4 dendritic cell T cell 36CL:4665 Interferon alpha/beta signaling bottom of list 0.00049IFI27,IFI44L,IFI6,IFITM1,IFITM3,ISG15,MX1,XAF1

T cell 36CL:4670 type I interferon signaling pathway bottom of list 0.0034IFI27,IFI6,IFITM1,IFITM3,MX1,XAF1

CD8+ T cell 37CL:4665 Interferon alpha/beta signaling bottom of list 0.00017BST2,IFI27,IFI44L,IFI6,IFITM1,ISG15,ISG20,MX1,XAF1

CD8+ T cell 37CL:4668 type I interferon signaling pathway bottom of list 0.0021BST2,IFI27,IFI6,IFITM1,ISG20,MX1,XAF1

CD8+ T cell 37CL:4670 type I interferon signaling pathway bottom of list 0.0038IFI27,IFI6,IFITM1,ISG20,MX1,XAF1

Plasmacytoid 39CL:4665 Interferon alpha/beta signaling bottom of list 0.0021IFI27,IFI6,IFITM1,ISG15 dendritic cell

Plasmacytoid 39CL:4670 type I interferon signaling pathway bottom of list 0.0079IFI27,IFI6,IFITM1 dendritic cell

Megakaryocyt e progenitor 40CL:4665 Interferon alpha/beta signaling bottom of list 0.00068IFI27,IFI44L,IFI6,IFITM1,ISG15 cell

Megakaryocyt e progenitor 40CL:4670 type I interferon signaling pathway bottom of list 0.006IFI27,IFI6,IFITM1 cell

bZIP transcription factor, and Early growth CD8+ T cell 44CL:2481 bottom of list 0.0044FOS,IER2,JUN,JUNB response, N-terminal

mixed, incl. MAPK targets/ Nuclear events

CD8+ T cell 44CL:2403 mediated by MAP kinases, and bZIP Maf bottom of list 0.0044DUSP1,FOS,IER2,JUN,JUNB

transcription factor

AP-1 transcription factor, and Transcription CD8+ T cell 44CL:2482 bottom of list 0.0065FOS,JUN,JUNB factor Jun

bZIP transcription factor, and Early growth CD8+ T cell 46CL:2481 bottom of list 0.0034FOS,IER2,JUN,JUNB response, N-terminal

AP-1 transcription factor, and Transcription CD8+ T cell 46CL:2482 bottom of list 0.0034FOS,JUN,JUNB factor Jun

mixed, incl. MAPK targets/ Nuclear events Plasmacytoid 47CL:2403 mediated by MAP kinases, and bZIP Maf bottom of list 0.00064DUSP1,FOS,FOSB,IER2,JUN,JUNB dendritic cell transcription factor

Plasmacytoid 47CL:4665 Interferon alpha/beta signaling bottom of list 0.0011IFI27,IFI44L,IFITM1,IFITM3,ISG15,MX1,XAF1 dendritic cell

Plasmacytoid bZIP transcription factor, and Early growth 47CL:2481 bottom of list 0.0011FOS,FOSB,IER2,JUN,JUNB dendritic cell response, N-terminal

Plasmacytoid peptide antigen assembly with MHC class II 47CL:18633 top of list 0.003CD74,HLA-DMA,HLA-DMB,HLA-DRA,HLA-DRB1 dendritic cell protein complex

Plasmacytoid AP-1 transcription factor, and Transcription 47CL:2482 bottom of list 0.0038FOS,FOSB,JUN,JUNB dendritic cell factor Jun

Plasmacytoid 47CL:18630 MHC class II protein complex top of list 0.0051CD74,HLA-DMA,HLA-DMB,HLA-DPA1,HLA-DPB1,HLA-DQA1,HLA-DQB1,HLA-DRA,HLA-DRB1 dendritic cell

Plasmacytoid 47CL:4670 type I interferon signaling pathway bottom of list 0.0097IFI27,IFITM1,IFITM3,MX1,XAF1 dendritic cell

Immunoregulatory interactions between a

T cell 48CL:4212 Lymphoid and a non-Lymphoid cell, and bottom of list 0.0044GNLY,HCST,NKG7

Cytolysis

T cell 48CL:4665 Interferon alpha/beta signaling bottom of list 0.0044BST2,IFI27,IFI44L,IFI6,IFITM1,ISG15

Interferon alpha/beta signaling, and T cell 48CL:4661 bottom of list 0.0044BST2,IFI27,IFI44L,IFI6,IFITM1,ISG15,MT2A Interferon gamma signaling

AXL+SIGLEC GTP hydrolysis and joining of the 60S 6+ dendritic 49CL:14966 top of list 0.0069EEF1B2,EEF2,RPL26,RPL36A ribosomal subunit, and Protein export cell Table S6 Compared with the normal controls, significant entriched pathways of each cell (sub)types in cured patients

type Cluster #term ID term description direction false discovery rate matching proteins in your input (labels)

mixed, incl. MAPK targets/

Nuclear events mediated by CD4+ T cell 4 CL:2403 top of list 7.48E-05 DUSP1,FOS,JUN,JUNB MAP kinases, and bZIP Maf

transcription factor

AP-1 transcription factor, and CD4+ T cell 4 CL:2482 top of list 0.00029 FOS,JUN,JUNB Transcription factor Jun

CD1C+_B bottom of 9 CL:4665 Interferon alpha/beta signaling 0.0055 IFI27,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MX1 dendritic cell list

Interferon alpha/beta signaling, CD1C+_B bottom of 9 CL:4662 and Interferon-induced protein 0.0055 EPSTI1,IFI27,IFI44L,IFI6,IFITM1,IFITM2,IFITM3,ISG15,MX1 dendritic cell list 44 family

mixed, incl. MAPK targets/

CD1C+_B Nuclear events mediated by 9 CL:2403 top of list 0.0057 ATF3,DUSP1,FOS,FOSB,IER2,JUN,JUNB dendritic cell MAP kinases, and bZIP Maf

transcription factor

mixed, incl. MAPK targets/ Effector CD8+ Nuclear events mediated by memory T (Tem) 10 CL:2403 top of list 0.0037 DUSP1,FOS,JUN MAP kinases, and bZIP Maf cell transcription factor

mixed, incl. MAPK targets/

Nuclear events mediated by CD4+ T cell 11 CL:2403 top of list 0.0014 DUSP1,FOS,JUN,JUNB MAP kinases, and bZIP Maf

transcription factor

AP-1 transcription factor, and CD4+ T cell 11 CL:2482 top of list 0.0019 FOS,JUN,JUNB Transcription factor Jun

mixed, incl. MAPK targets/

CD8+ T cell 12 CL:2403 Nuclear events mediated by top of list 0.00062 DUSP1,DUSP2,FOS,JUN,JUNB

MAP kinases, and bZIP Maf transcription factor

AP-1 transcription factor, and CD8+ T cell 12 CL:2482 top of list 0.0016 FOS,JUN,JUNB Transcription factor Jun

Megakaryocyte bottom of 13 CL:18630 MHC class II protein complex 0.00033 CD74,HLA-DPA1,HLA-DPB1,HLA-DRA,HLA-DRB1,HLA-DRB5 progenitor cell list

Megakaryocyte peptide antigen assembly with bottom of 13 CL:18633 0.00095 CD74,HLA-DRA,HLA-DRB1 progenitor cell MHC class II protein complex list

Megakaryocyte MHC class II protein complex, bottom of 13 CL:18626 0.00095 CD74,HLA-DPA1,HLA-DPB1,HLA-DRA,HLA-DRB1,HLA-DRB5,RCSD1 progenitor cell and dynactin complex list

mixed, incl. MAPK targets/

Megakaryocyte Nuclear events mediated by 14 CL:2403 top of list 0.0095 DUSP1,FOS,JUN,JUNB progenitor cell MAP kinases, and bZIP Maf

transcription factor

mixed, incl. MAPK targets/

Nuclear events mediated by CD4+ T cell 15 CL:2403 top of list 0.0011 DUSP1,FOS,JUN,JUNB MAP kinases, and bZIP Maf

transcription factor

AP-1 transcription factor, and CD4+ T cell 15 CL:2482 top of list 0.0012 FOS,JUN,JUNB Transcription factor Jun

mixed, incl. MAPK targets/

Nuclear events mediated by Memory B cell 18 CL:2403 top of list 0.00022 DUSP1,FOS,JUN,JUNB MAP kinases, and bZIP Maf

transcription factor

AP-1 transcription factor, and Memory B cell 18 CL:2482 top of list 0.00072 FOS,JUN,JUNB Transcription factor Jun

mixed, incl. regulation of TOR

Plasmacytoid signaling, and MAPK targets/ 21 CL:2190 top of list 0.00027 DDIT4,DUSP1,DUSP2,FOS,JUN,JUNB dendritic cell Nuclear events mediated by

MAP kinases

Plasmacytoid mixed, incl. MAPK targets/ 21 CL:2403 top of list 0.00027 DUSP1,DUSP2,FOS,JUN,JUNB dendritic cell Nuclear events mediated by MAP kinases, and bZIP Maf

transcription factor

Plasmacytoid AP-1 transcription factor, and 21 CL:2482 top of list 0.0018 FOS,JUN,JUNB dendritic cell Transcription factor Jun

mixed, incl. MAPK targets/

Nuclear events mediated by CD4+ T cell 23 CL:2403 top of list 0.0013 DUSP1,FOS,JUN,JUNB MAP kinases, and bZIP Maf

transcription factor

AP-1 transcription factor, and CD4+ T cell 23 CL:2482 top of list 0.0013 FOS,JUN,JUNB Transcription factor Jun

mixed, incl. MAPK targets/

Nuclear events mediated by T cell 24 CL:2403 top of list 0.0021 DUSP1,FOS,JUN,JUNB MAP kinases, and bZIP Maf

transcription factor

AP-1 transcription factor, and T cell 24 CL:2482 top of list 0.0038 FOS,JUN,JUNB Transcription factor Jun

mixed, incl. MAPK targets/

Nuclear events mediated by CD8+ T cell 27 CL:2403 top of list 0.0022 DUSP1,FOS,JUN,JUNB MAP kinases, and bZIP Maf

transcription factor

AP-1 transcription factor, and CD8+ T cell 27 CL:2482 top of list 0.0072 FOS,JUN,JUNB Transcription factor Jun

bottom of CD8+ T cell 27 CL:18630 MHC class II protein complex 0.0072 CD74,HLA-DPA1,HLA-DPB1,HLA-DRA,HLA-DRB1,HLA-DRB5 list

GTP hydrolysis and joining of

CD8+ T cell 27 CL:14967 the 60S ribosomal subunit, and top of list 0.0074 EIF1,RPL13A,RPS2,RPS20,RPS26

Protein export

MHC class II protein complex, bottom of CD8+ T cell 27 CL:18627 0.0074 CD74,HLA-DPA1,HLA-DPB1,HLA-DQA2,HLA-DRA,HLA-DRB1,HLA-DRB5 and dynactin complex list

CD141+CLEC9A mixed, incl. regulation of TOR 30 CL:2190 top of list 0.0086 DDIT4,DUSP1,DUSP2,FOS,IER2,JUNB,NR4A1,PRKCD + dendritic cell signaling, and MAPK targets/ Nuclear events mediated by

MAP kinases

mixed, incl. MAPK targets/

CD141+CLEC9A Nuclear events mediated by 30 CL:2403 top of list 0.0086 DUSP1,DUSP2,FOS,IER2,JUNB,NR4A1 + dendritic cell MAP kinases, and bZIP Maf

transcription factor

Immunoregulatory interactions Effector CD8+ between a Lymphoid and a bottom of memory T (Tem) 32 CL:4211 0.0016 CD2,HLA-B,PRF1 non-Lymphoid cell, and list cell Cytolysis

CD1C-CD141- MHC class II protein complex, bottom of 34 CL:18626 0.0018 CD74,HLA-DMA,HLA-DPA1,HLA-DPB1,HLA-DQA2,HLA-DRA,HLA-DRB1,HLA-DRB5,RCSD1 dendritic cell and dynactin complex list

mixed, incl. MAPK targets/

CD1C-CD141- Nuclear events mediated by 34 CL:2403 top of list 0.0018 DUSP1,FOS,FOSB,IER2,JUN,JUND dendritic cell MAP kinases, and bZIP Maf

transcription factor

CD1C-CD141- MHC class II protein complex, bottom of 34 CL:18627 0.0018 CD74,HLA-DMA,HLA-DPA1,HLA-DPB1,HLA-DQA2,HLA-DRA,HLA-DRB1,HLA-DRB5 dendritic cell and dynactin complex list

CD1C-CD141- bottom of 34 CL:18630 MHC class II protein complex 0.0027 CD74,HLA-DMA,HLA-DPA1,HLA-DPB1,HLA-DRA,HLA-DRB1,HLA-DRB5 dendritic cell list

CD1C-CD141- AP-1 transcription factor, and 34 CL:2482 top of list 0.0031 FOS,FOSB,JUN,JUND dendritic cell Transcription factor Jun

bZIP transcription factor, and CD1C-CD141- 34 CL:2481 Early growth response, top of list 0.0031 FOS,FOSB,IER2,JUN,JUND dendritic cell N-terminal

mixed, incl. MAPK targets/

CD1C+_B Nuclear events mediated by 38 CL:2403 top of list 0.002 DUSP1,FOS,JUN,JUNB dendritic cell MAP kinases, and bZIP Maf

transcription factor

CD1C+_B AP-1 transcription factor, and 38 CL:2482 top of list 0.0093 FOS,JUN,JUNB dendritic cell Transcription factor Jun mixed, incl. MAPK targets/

Nuclear events mediated by CD8+ T cell 39 CL:2403 top of list 0.0029 DUSP1,FOS,JUN,JUNB MAP kinases, and bZIP Maf

transcription factor

AP-1 transcription factor, and CD8+ T cell 39 CL:2482 top of list 0.0078 FOS,JUN,JUNB Transcription factor Jun

Megakaryocyte 41 CL:14982 Peptide chain elongation top of list 0.0093 RPL13A,RPL17,RPL18A,RPL26,RPS11,RPS2,RPS20 progenitor cell

mixed, incl. MAPK targets/

Nuclear events mediated by CD8+ T cell 42 CL:2403 top of list 7.77E-05 DUSP1,DUSP2,FOS,JUN,JUNB MAP kinases, and bZIP Maf

transcription factor

AP-1 transcription factor, and CD8+ T cell 42 CL:2482 top of list 0.00063 FOS,JUN,JUNB Transcription factor Jun

AXL+SIGLEC6+ EEF1A1,EEF2,GNB2L1,RPL10,RPL13,RPL13A,RPL18A,RPL22,RPL23,RPL24,RPL27A,RPL29,RPL31,RPL32,RPL35A,RPL36AL,RPL37,RPL5,RPL7,RP 43 CL:14976 Peptide chain elongation top of list 8.75E-05 dendritic cell L9,RPLP1,RPS12,RPS14,RPS15A,RPS2,RPS20,RPS23,RPS24,RPS3A,RPS4X,RPS6,RPS7,RPS8,UBA52

AXL+SIGLEC6+ EEF2,RPL10,RPL13,RPL13A,RPL18A,RPL22,RPL23,RPL24,RPL29,RPL31,RPL32,RPL35A,RPL37,RPL5,RPL7,RPL9,RPLP1,RPS12,RPS14,RPS15A,R 43 CL:14982 Peptide chain elongation top of list 8.75E-05 dendritic cell PS2,RPS20,RPS23,RPS24,RPS3A,RPS4X,RPS6,RPS7,RPS8,UBA52

GTP hydrolysis and joining of EEF1A1,EEF1B2,EEF2,EIF2S3,GNB2L1,PABPC1,RPL10,RPL13,RPL13A,RPL18A,RPL22,RPL23,RPL24,RPL27A,RPL29,RPL31,RPL32,RPL35A,RPL36 AXL+SIGLEC6+ 43 CL:14966 the 60S ribosomal subunit, and top of list 8.75E-05 AL,RPL37,RPL5,RPL7,RPL9,RPLP1,RPS12,RPS14,RPS15A,RPS2,RPS20,RPS23,RPS24,RPS3,RPS3A,RPS4X,RPS6,RPS7,RPS8,RPSA,SEC11A,SEC dendritic cell Protein export 11C,SPCS1,TPT1,UBA52

AXL+SIGLEC6+ EEF2,RPL10,RPL13,RPL13A,RPL18A,RPL22,RPL23,RPL24,RPL27A,RPL29,RPL31,RPL32,RPL35A,RPL37,RPL5,RPL7,RPL9,RPLP1,RPS12,RPS14,R 43 CL:14980 Peptide chain elongation top of list 8.75E-05 dendritic cell PS15A,RPS2,RPS20,RPS23,RPS24,RPS3A,RPS4X,RPS6,RPS7,RPS8,UBA52

AXL+SIGLEC6+ EEF1A1,EEF2,GNB2L1,RPL10,RPL13,RPL13A,RPL18A,RPL22,RPL23,RPL24,RPL27A,RPL29,RPL31,RPL32,RPL35A,RPL37,RPL5,RPL7,RPL9,RPLP1, 43 CL:14978 Peptide chain elongation top of list 8.75E-05 dendritic cell RPS12,RPS14,RPS15A,RPS2,RPS20,RPS23,RPS24,RPS3A,RPS4X,RPS6,RPS7,RPS8,UBA52

GTP hydrolysis and joining of EEF1A1,EEF2,EIF2S3,GNB2L1,PABPC1,RPL10,RPL13,RPL13A,RPL18A,RPL22,RPL23,RPL24,RPL27A,RPL29,RPL31,RPL32,RPL35A,RPL36AL,RPL3 AXL+SIGLEC6+ 43 CL:14967 the 60S ribosomal subunit, and top of list 0.00011 7,RPL5,RPL7,RPL9,RPLP1,RPS12,RPS14,RPS15A,RPS2,RPS20,RPS23,RPS24,RPS3,RPS3A,RPS4X,RPS6,RPS7,RPS8,RPSA,SEC11A,SEC11C,SP dendritic cell Protein export CS1,UBA52

GTP hydrolysis and joining of BTF3,EEF1A1,EEF1B2,EEF2,EIF2S3,GNB2L1,PABPC1,RPL10,RPL13,RPL13A,RPL18A,RPL22,RPL23,RPL24,RPL27A,RPL29,RPL31,RPL32,RPL35A, AXL+SIGLEC6+ 43 CL:14963 the 60S ribosomal subunit, and top of list 0.00013 RPL36AL,RPL37,RPL5,RPL7,RPL9,RPLP1,RPS12,RPS14,RPS15A,RPS2,RPS20,RPS23,RPS24,RPS3,RPS3A,RPS4X,RPS6,RPS7,RPS8,RPSA,SEC11 dendritic cell Nonsense-mediated mRNA A,SEC11C,SPCS1,TPT1,UBA52 decay

AXL+SIGLEC6+ EEF2,RPL13,RPL13A,RPL18A,RPL22,RPL23,RPL24,RPL29,RPL32,RPL35A,RPL37,RPL7,RPL9,RPS12,RPS14,RPS15A,RPS2,RPS23,RPS3A,RPS4X, 43 CL:14983 Peptide chain elongation top of list 0.00023 dendritic cell RPS6,RPS7,RPS8,UBA52

AXL+SIGLEC6+ SRP-dependent cotranslational EEF1A1,EEF2,GNB2L1,RPL10,RPL13,RPL13A,RPL18A,RPL22,RPL23,RPL24,RPL27A,RPL29,RPL31,RPL32,RPL35A,RPL36AL,RPL37,RPL5,RPL7,RP 43 CL:14968 top of list 0.00034 dendritic cell protein targeting to membrane L9,RPLP1,RPS12,RPS14,RPS15A,RPS2,RPS20,RPS23,RPS24,RPS3A,RPS4X,RPS6,RPS7,RPS8,SEC11A,SEC11C,SPCS1,UBA52

AXL+SIGLEC6+ RPL13,RPL13A,RPL18A,RPL22,RPL23,RPL24,RPL29,RPL35A,RPL7,RPL9,RPS12,RPS14,RPS15A,RPS2,RPS23,RPS3A,RPS4X,RPS6,RPS7,RPS8,UB 43 CL:14985 Viral mRNA Translation top of list 0.00073 dendritic cell A52

Immunoregulatory interactions

AXL+SIGLEC6+ between a Lymphoid and a bottom of 43 CL:4211 0.0033 CD2,GNLY,GZMB,GZMH,HCST,HLA-A,HLA-C,HLA-E,KLRD1,NKG7 dendritic cell non-Lymphoid cell, and list

Cytolysis

Immunoregulatory interactions

AXL+SIGLEC6+ between a Lymphoid and a bottom of 43 CL:4212 0.0052 GNLY,GZMB,GZMH,HCST,HLA-A,HLA-C,HLA-E,KLRD1,NKG7 dendritic cell non-Lymphoid cell, and list

Cytolysis Table S7 The differential expression of intereron related genes in each cell (sub)types of COVID-19 patients with normals

Disease Symbol pct.1 pct.2 case_Mean_UMI_Countscontrol_Mean_UMI_CountsLog2_Fold_ChangePvalue AdjustPvaluecluster Cell (sub)type condition critical IFI27 0.548 0.005 5.677419355 0.009324009 2.72590127 5.53E-21 9.58E-17 22CD1C-CD141- dendritic cell critical IFI27 0.203 0 0.7734375 0 0.826548487 6.62E-32 1.15E-27 15CD1C+_B dendritic cell critical IFI27 0.344 0.007 2.323135755 0.021582734 1.701739184 2.66E-81 4.61E-77 8CD1C+_B dendritic cell critical IFI44L 0.548 0.082 0.774193548 0.095571096 0.695480294 9.46E-11 1.64E-06 22CD1C-CD141- dendritic cell critical IFI44L 0.75 0.043 0.75 0.108695652 0.658491536 0 0 37CD141+CLEC9A+ dendritic cell critical IFI44L 0.75 0.043 0.75 0.108695652 0.658491536 0 0 46AXL+SIGLEC6+ dendritic cell critical IFI6 0.806 0.378 2.193548387 0.545454545 1.047129087 6.48E-13 1.12E-08 22CD1C-CD141- dendritic cell critical IFI6 0.73 0.347 1.627151052 0.594039054 0.720812176 4.70E-53 8.14E-49 8CD1C+_B dendritic cell critical IFITM1 0.98 0.937 7.801980198 4.648737651 0.639899628 1.12E-10 1.94E-06 14CD8+ T cell critical IFITM1 0.992 0.953 9.75708502 6.03085443 0.613515256 1.70E-25 2.94E-21 7CD8+ T cell critical IFITM1 0.812 0.627 3.29296875 1.120165746 1.017798618 2.23E-53 3.87E-49 15CD1C+_B dendritic cell critical IFITM2 1 0.974 16.5990566 5.662251656 1.40141634 5.45E-22 9.44E-18 25CD4+ cytotoxic T cell critical IFITM2 0.879 0.709 5.105263158 2.299050633 0.888002562 1.68E-33 2.91E-29 7CD8+ T cell critical IFITM2 0.937 0.717 3.252390057 1.828365879 0.588305177 6.86E-40 1.19E-35 8CD1C+_B dendritic cell critical IFITM2 0.973 0.867 8.44140625 2.79558011 1.314681356 2.28E-60 3.95E-56 15CD1C+_B dendritic cell critical IFITM3 1 0.887 9.594339623 2.562913907 1.572164135 1.89E-34 3.27E-30 25CD4+ cytotoxic T cell critical IFITM3 1 0.869 8.8359375 3.42679558 1.151799813 5.85E-63 1.01E-58 15CD1C+_B dendritic cell critical IFITM3 0.996 0.925 8.850860421 4.755395683 0.775334625 6.38E-68 1.11E-63 8CD1C+_B dendritic cell critical IFITM3 0.44 0.171 0.76 0.171428571 0.587306441 0 0 35CD8+ T cell critical IFITM3 0.44 0.171 0.76 0.171428571 0.587306441 0 0 43B cell critical IRF1 0.15 0.448 0.20501139 0.850198413 -0.618633209 1.44E-33 2.49E-29 9Effector CD8+ memory T (Tem) cell critical IRF1 0.142 0.453 0.189054726 0.871004566 -0.653997963 1.08E-33 1.87E-29 10B cell critical IRF1 0.297 0.695 0.609375 2.299723757 -1.035844724 1.73E-35 2.99E-31 15CD1C+_B dendritic cell critical IRF1 0.392 0.731 0.663194444 2.056254136 -0.877807668 1.95E-38 3.37E-34 4CD8+ T cell critical IRF1 0.491 0.767 0.885277247 2.1336074 -0.73304774 1.68E-44 2.91E-40 8CD1C+_B dendritic cell critical IRF1 0.374 0.609 0.524193548 1.386014781 -0.646556867 7.54E-74 1.31E-69 3CD4+ T cell critical IRF1 0.2 0.686 0.2 1.628571429 -1.131244533 0 0 35CD8+ T cell critical IRF1 0.2 0.686 0.2 1.628571429 -1.131244533 0 0 43B cell critical ISG20 0.633 0.19 1.081632653 0.329694323 0.646620868 2.91E-09 5.05E-05 20CD4+ T helper critical ISG20 0.768 0.479 1.571428571 0.686419753 0.608606409 5.64E-10 9.78E-06 21CD4+ cytotoxic T cell critical ISG20 0.844 0.428 1.84375 0.577264654 0.850369886 8.75E-14 1.52E-09 19CD141+CLEC9A+ dendritic cell critical ISG20 0.814 0.601 2.064777328 1.038765823 0.588086185 1.47E-28 2.54E-24 7CD8+ T cell critical ISG20 0.774 0.205 1.235849057 0.463576159 0.611324974 2.17E-30 3.77E-26 25CD4+ cytotoxic T cell critical ISG20 0.837 0.531 1.885416667 0.843812045 0.646088068 9.59E-44 1.66E-39 4CD8+ T cell critical ISG20 0.87 0.419 2.22 0.609679447 1.000287271 4.41E-47 7.64E-43 5CD4+ cytotoxic T cell critical MT2A 0.461 0.373 1.984375 0.968232044 0.600528511 1.51E-11 2.61E-07 15CD1C+_B dendritic cell critical MT2A 0.727 0.623 4.390057361 1.924974306 0.881876675 1.12E-30 1.95E-26 8CD1C+_B dendritic cell critical SAMHD1 0.25 0.626 0.55859375 1.468232044 -0.663233096 4.42E-25 7.66E-21 15CD1C+_B dendritic cell critical SAMHD1 0.721 0.889 1.223709369 2.354573484 -0.593161102 6.22E-51 1.08E-46 8CD1C+_B dendritic cell severe ADAR 0.409 0.215 1.396923077 0.455823293 0.719348357 1.16E-23 2.05E-19 18CD4+ T helper severe BST2 0.8 0.311 2.2 0.426229508 1.165865747 3.15E-10 5.56E-06 43Plasmacytoid dendritic cell severe BST2 0.706 0.304 2.117647059 0.326086957 1.233282232 1.18E-11 2.07E-07 44CD8 cytoxict cells severe BST2 0.6 0.176 1.177777778 0.215686275 0.841085779 7.33E-12 1.29E-07 32Naive CD8+ T cell severe BST2 0.727 0.206 1.909090909 0.242990654 1.226752932 6.11E-12 1.08E-07 40CD8+ T cell severe BST2 0.757 0.309 1.702702703 0.388157895 0.961231149 5.93E-12 1.05E-07 36CD8+ T cell severe BST2 1 0.737 7.347826087 1.824561404 1.563373681 7.52E-15 1.33E-10 45Plasmacytoid dendritic cell severe BST2 0.633 0.254 1.133333333 0.307692308 0.706086281 7.05E-19 1.24E-14 26 T cell severe BST2 0.943 0.205 1.757142857 0.43373494 0.943395688 1.37E-21 2.42E-17 38Plasmacytoid dendritic cell severe BST2 0.841 0.146 1.492753623 0.238095238 1.009618003 2.88E-27 5.08E-23 28CD1C+_B dendritic cell severe BST2 0.971 0.667 4.507246377 1.209302326 1.317740298 1.75E-27 3.09E-23 35Effector CD8+ memory T (Tem) cell severe BST2 0.935 0.47 3.092592593 0.660869565 1.30107628 1.94E-29 3.43E-25 33Plasmacytoid dendritic cell severe BST2 0.644 0.228 1.074468085 0.267605634 0.710635485 7.48E-31 1.32E-26 23CD4+ T cell severe BST2 0.758 0.413 1.552795031 0.564102564 0.706742587 6.14E-32 1.08E-27 19CD141+CLEC9A+ dendritic cell severe BST2 0.93 0.248 1.91959799 0.460176991 0.999626481 7.73E-36 1.36E-31 30CD1C-CD141- dendritic cell severe BST2 0.842 0.277 2.293233083 0.36416185 1.271489802 2.54E-37 4.48E-33 31CD8 cytoxict cells severe BST2 0.762 0.278 1.75 0.341708543 1.035360307 2.23E-41 3.93E-37 20CD141+CLEC9A+ dendritic cell severe BST2 0.911 0.34 3.035714286 0.429042904 1.497774809 4.60E-43 8.13E-39 29CD8+ T cell severe BST2 0.844 0.288 2.052023121 0.392156863 1.132444114 1.91E-45 3.37E-41 24T cell(Activated T cell) severe BST2 0.922 0.365 2.558823529 0.508108108 1.238660545 7.74E-47 1.37E-42 25Megakaryocyte progenitor cell severe BST2 0.655 0.228 1.2 0.272131148 0.790256114 1.10E-50 1.94E-46 17CD4+ T cell severe BST2 0.668 0.239 1.243902439 0.287864534 0.801029102 7.99E-58 1.41E-53 12Megakaryocyte progenitor cell severe BST2 0.611 0.228 1.211488251 0.280133929 0.788722823 1.67E-64 2.94E-60 11CD4+ T cell severe BST2 0.888 0.046 0.988826816 0.051282051 0.919767868 1.70E-68 3.00E-64 27Megakaryocyte progenitor cell severe BST2 0.734 0.331 1.635616438 0.444572748 0.867497571 8.08E-72 1.43E-67 13CD141+CLEC9A+ dendritic cell severe BST2 0.891 0.327 2.5703125 0.415611814 1.334624648 7.90E-72 1.39E-67 22CD8+ T cell severe BST2 0.893 0.401 2.558718861 0.708496732 1.058630476 1.85E-74 3.26E-70 15CD1C+_B dendritic cell severe BST2 0.892 0.384 2.391752577 0.512244898 1.165339138 1.30E-100 2.30E-96 16CD8+ T cell severe BST2 0.903 0.407 3 0.532804614 1.383826191 1.02E-109 1.80E-105 8Effector CD8+ memory T (Tem) cell severe BST2 0.741 0.306 1.45 0.385989011 0.82186593 9.89E-112 1.74E-107 6CD8+ T cell severe BST2 0.964 0.742 3.278 1.289473684 0.9019205 1.13E-124 1.99E-120 9CD1C+_B dendritic cell severe BST2 0.749 0.277 1.540955631 0.34214876 0.920826599 2.05E-133 3.62E-129 7CD4+ T cell severe BST2 0.834 0.315 2.047524752 0.393974508 1.128433761 1.22E-142 2.15E-138 10CD8+ T cell severe BST2 0.978 0.155 1.541538462 0.381526104 0.879439241 1.30E-148 2.29E-144 18CD4+ T helper severe BST2 0.571 0.205 0.993109388 0.252766252 0.669903639 5.27E-168 9.30E-164 1Naive CD4+ T cell severe BST2 0.687 0.228 1.343921139 0.286327078 0.865666504 2.94E-175 5.19E-171 2CD4+ T cell severe BST2 0.98 0.029 1.16 0.036016949 1.059983707 5.19E-183 9.16E-179 14Megakaryocyte progenitor cell severe BST2 0.931 0.472 3.301645338 0.714460784 1.327133677 6.47E-242 1.14E-237 4Effector CD8+ memory T (Tem) cell severe BST2 0.97 0.604 4.097288676 1.030597015 1.327826104 2.86E-247 5.04E-243 5Effector CD8+ memory T (Tem) cell severe BST2 0.882 0.351 2.51594533 0.456824513 1.271085536 4.46E-292 7.87E-288 3Effector CD8+ memory T (Tem) cell severe DDX60 0.405 0.052 0.630057803 0.055555556 0.626920613 3.50E-25 6.18E-21 24T cell(Activated T cell) severe DDX60 0.4 0.07 0.8 0.075376884 0.743154541 0 0 34CD8 cytoxict cells severe EPSTI1 0.8 0.101 2 0.105527638 1.440227408 6.68E-11 1.18E-06 34CD8 cytoxict cells severe EPSTI1 0.565 0.191 0.990740741 0.226086957 0.699244046 1.39E-11 2.46E-07 33Plasmacytoid dendritic cell severe EPSTI1 0.556 0.059 0.866666667 0.078431373 0.791529955 1.92E-12 3.39E-08 32Naive CD8+ T cell severe EPSTI1 0.743 0.096 1.257142857 0.168674699 0.94962432 2.01E-16 3.54E-12 38Plasmacytoid dendritic cell severe EPSTI1 0.739 0.217 1.31884058 0.248062016 0.893714015 4.88E-18 8.61E-14 35Effector CD8+ memory T (Tem) cell severe EPSTI1 0.589 0.122 1.035714286 0.138613861 0.838256524 2.01E-19 3.55E-15 29CD8+ T cell severe EPSTI1 0.609 0.044 0.927536232 0.081632653 0.833547368 5.30E-24 9.35E-20 28CD1C+_B dendritic cell severe EPSTI1 0.677 0.133 1.330827068 0.150289017 1.018845577 4.70E-29 8.30E-25 31CD8 cytoxict cells severe EPSTI1 0.637 0.124 1.196078431 0.143243243 0.941797187 2.45E-30 4.33E-26 25Megakaryocyte progenitor cell severe EPSTI1 0.523 0.091 1.0390625 0.107594937 0.880475633 3.78E-32 6.67E-28 22CD8+ T cell severe EPSTI1 0.588 0.084 0.925 0.090452261 0.819931834 1.91E-34 3.37E-30 20CD141+CLEC9A+ dendritic cell severe EPSTI1 0.59 0.11 1.010638298 0.132394366 0.828277096 1.29E-35 2.27E-31 23CD4+ T cell severe EPSTI1 0.54 0.157 0.910638298 0.185245902 0.688868284 4.14E-38 7.30E-34 17CD4+ T cell severe EPSTI1 0.7 0.101 1.1 0.103550296 0.928236944 4.14E-43 7.30E-39 26 T cell severe EPSTI1 0.814 0.053 2.055276382 0.07079646 1.512618618 2.72E-43 4.80E-39 30CD1C-CD141- dendritic cell severe EPSTI1 0.592 0.154 0.980582524 0.170872386 0.75834097 3.77E-45 6.66E-41 8Effector CD8+ memory T (Tem) cell severe EPSTI1 0.809 0.265 2.427745665 0.362745098 1.330744336 1.40E-48 2.48E-44 24T cell(Activated T cell) severe EPSTI1 0.671 0.189 1.322981366 0.217948718 0.931524192 9.35E-53 1.65E-48 19CD141+CLEC9A+ dendritic cell severe EPSTI1 0.634 0.147 1.051546392 0.175510204 0.803424716 4.24E-61 7.47E-57 16CD8+ T cell severe EPSTI1 0.522 0.1 0.941463415 0.111947319 0.804056082 8.86E-63 1.56E-58 12Megakaryocyte progenitor cell severe EPSTI1 0.899 0.062 2.776536313 0.092307692 1.789684353 1.10E-70 1.94E-66 27Megakaryocyte progenitor cell severe EPSTI1 0.636 0.191 1.164356436 0.244495944 0.798376579 6.83E-74 1.21E-69 10CD8+ T cell severe EPSTI1 0.923 0.304 2.602564103 0.409190372 1.354157578 4.20E-74 7.41E-70 21CD1C-CD141- dendritic cell severe EPSTI1 0.548 0.128 1.01305483 0.1484375 0.809714123 1.52E-74 2.67E-70 11CD4+ T cell severe EPSTI1 0.655 0.134 1.219178082 0.147806005 0.951146617 5.00E-108 8.82E-104 13CD141+CLEC9A+ dendritic cell severe EPSTI1 0.645 0.146 1.07337884 0.171900826 0.823133259 2.87E-121 5.06E-117 7CD4+ T cell severe EPSTI1 0.812 0.052 1.295384615 0.102409639 1.058075505 1.43E-121 2.52E-117 18CD4+ T helper severe EPSTI1 0.79 0.088 1.868327402 0.11503268 1.363123715 2.00E-122 3.53E-118 15CD1C+_B dendritic cell severe EPSTI1 0.656 0.11 1.197440585 0.126838235 0.963543735 3.19E-167 5.62E-163 4Effector CD8+ memory T (Tem) cell severe EPSTI1 0.622 0.122 1.046697039 0.139972145 0.844298991 3.35E-171 5.91E-167 3Effector CD8+ memory T (Tem) cell severe EPSTI1 0.92 0.263 2.32 0.360745614 1.286785856 1.35E-181 2.38E-177 9CD1C+_B dendritic cell severe EPSTI1 0.718 0.143 1.435406699 0.168656716 1.059311502 2.48E-183 4.37E-179 5Effector CD8+ memory T (Tem) cell severe EPSTI1 0.6 0.127 1.033953998 0.145308311 0.828551033 5.47E-189 9.66E-185 2CD4+ T cell severe EPSTI1 0.97 0.013 1.87 0.039194915 1.46558446 5.47E-197 9.64E-193 14Megakaryocyte progenitor cell severe EPSTI1 0.473 0.08 0.690783807 0.084024896 0.64129431 1.99E-226 3.51E-222 1Naive CD4+ T cell severe EPSTI1 0.545 0.112 0.727272727 0.112149533 0.635145118 0 0 40CD8+ T cell severe EPSTI1 0.542 0.024 0.916666667 0.024096386 0.904247951 0 0 42Megakaryocyte progenitor cell severe EPSTI1 0.522 0.105 0.695652174 0.105263158 0.617450353 0 0 45Plasmacytoid dendritic cell severe EPSTI1 0.645 0.211 0.870967742 0.210526316 0.628150242 0 0 46B cell severe FCGR1A 0.598 0.157 0.946619217 0.220915033 0.6730079 1.45E-42 2.56E-38 15CD1C+_B dendritic cell severe FCGR1A 0.686 0.098 1.256410256 0.111597374 1.021395068 2.50E-51 4.42E-47 21CD1C-CD141- dendritic cell severe FCGR1A 0.852 0.361 1.744 0.426535088 0.943765249 1.25E-145 2.20E-141 9CD1C+_B dendritic cell severe GBP1 0.459 0.127 0.879699248 0.161849711 0.694078386 6.79E-12 1.20E-07 31CD8 cytoxict cells severe GBP1 0.647 0.268 1.312138728 0.408496732 0.715071746 4.32E-17 7.63E-13 24T cell(Activated T cell) severe GBP1 0.5 0.16 0.8125 0.183544304 0.614867283 1.83E-21 3.23E-17 22CD8+ T cell severe GBP1 0.563 0.171 0.970873786 0.205479452 0.70922833 8.98E-31 1.58E-26 8Effector CD8+ memory T (Tem) cell severe GBP1 0.788 0.319 1.948717949 0.371991247 1.103816554 3.54E-68 6.24E-64 21CD1C-CD141- dendritic cell severe GBP1 0.58 0.166 0.992 0.198464912 0.733029976 7.76E-72 1.37E-67 9CD1C+_B dendritic cell severe GBP1 0.555 0.139 0.920255183 0.170149254 0.714605485 2.76E-94 4.87E-90 5Effector CD8+ memory T (Tem) cell severe GBP1 0.505 0.131 0.778793419 0.147058824 0.632959594 2.10E-98 3.70E-94 4Effector CD8+ memory T (Tem) cell severe GBP1 0.4 0.068 1.2 0.068181818 1.042346291 0 0 47AXL+SIGLEC6+ dendritic cell severe GBP2 0.4 0.261 1.8 0.286432161 1.122051448 3.97E-13 7.00E-09 34CD8 cytoxict cells severe GBP2 0.4 0.114 0.8 0.113636364 0.692718681 0 0 47AXL+SIGLEC6+ dendritic cell severe IFI27 0.5 0 1.25 0 1.169925001 4.34E-09 7.66E-05 42Megakaryocyte progenitor cell severe IFI27 0.278 0.009 3.574074074 0.008695652 2.180988785 1.87E-09 3.30E-05 33Plasmacytoid dendritic cell severe IFI27 0.652 0 11.13043478 0 3.600559356 2.73E-10 4.82E-06 45Plasmacytoid dendritic cell severe IFI27 0.321 0.003 1.571428571 0.00330033 1.357816549 4.24E-14 7.49E-10 29CD8+ T cell severe IFI27 1 0.008 41.09090909 0.016666667 5.371590023 8.86E-18 1.56E-13 39CD141+CLEC9A+ dendritic cell severe IFI27 0.391 0.006 1.541353383 0.005780347 1.337281733 9.61E-20 1.70E-15 31CD8 cytoxict cells severe IFI27 0.303 0.006 0.617021277 0.01971831 0.665167989 1.27E-25 2.24E-21 23CD4+ T cell severe IFI27 0.8 0.012 1.742857143 0.012048193 1.438401492 7.19E-26 1.27E-21 38Plasmacytoid dendritic cell severe IFI27 0.388 0.005 0.95 0.016750419 0.939508539 5.14E-27 9.07E-23 20CD141+CLEC9A+ dendritic cell severe IFI27 0.609 0.007 1.971014493 0.010204082 1.556308867 2.68E-33 4.72E-29 28CD1C+_B dendritic cell severe IFI27 0.292 0 0.590062112 0 0.669083122 9.46E-35 1.67E-30 19CD141+CLEC9A+ dendritic cell severe IFI27 0.375 0 1.3125 0 1.209453366 1.20E-35 2.12E-31 22CD8+ T cell severe IFI27 0.445 0.003 4.554913295 0.006535948 2.464365695 1.00E-37 1.77E-33 24T cell(Activated T cell) severe IFI27 0.366 0.005 0.736170213 0.006557377 0.786478982 1.51E-48 2.66E-44 17CD4+ T cell severe IFI27 0.706 0.005 1.941176471 0.010810811 1.540880349 1.98E-56 3.49E-52 25Megakaryocyte progenitor cell severe IFI27 0.376 0 0.881443299 0 0.911839812 1.39E-59 2.46E-55 16CD8+ T cell severe IFI27 0.945 0 4.391959799 0 2.43080974 3.89E-72 6.87E-68 30CD1C-CD141- dendritic cell severe IFI27 0.317 0.01 0.832764505 0.019008264 0.846855671 9.83E-83 1.73E-78 7CD4+ T cell severe IFI27 0.517 0.006 1.390243902 0.016933208 1.232932913 1.53E-86 2.70E-82 12Megakaryocyte progenitor cell severe IFI27 0.927 0 3.759776536 0 2.250893843 7.91E-91 1.40E-86 27Megakaryocyte progenitor cell severe IFI27 0.42 0.005 1.845544554 0.006952491 1.498709151 1.65E-99 2.90E-95 10CD8+ T cell severe IFI27 0.329 0 0.846889952 0 0.885097905 1.59E-113 2.81E-109 5Effector CD8+ memory T (Tem) cell severe IFI27 0.929 0.004 46.35897436 0.008752735 5.552993347 1.13E-128 2.00E-124 21CD1C-CD141- dendritic cell severe IFI27 0.338 0.003 0.775465498 0.003217158 0.823563397 6.12E-158 1.08E-153 2CD4+ T cell severe IFI27 0.416 0.003 1.420273349 0.004178273 1.269154581 3.29E-170 5.81E-166 3Effector CD8+ memory T (Tem) cell severe IFI27 0.883 0 1.643076923 0 1.402218413 1.42E-179 2.51E-175 18CD4+ T helper severe IFI27 0.904 0.001 26.78647687 0.002614379 4.792544187 9.66E-211 1.70E-206 15CD1C+_B dendritic cell severe IFI27 1 0.006 11.06 0.015889831 3.569414046 3.41E-221 6.02E-217 14Megakaryocyte progenitor cell severe IFI27 0.329 0.001 0.769652651 0.00122549 0.821699288 0 0 4Effector CD8+ memory T (Tem) cell severe IFI27 0.388 0.002 0.757281553 0.002162942 0.810228265 0 0 8Effector CD8+ memory T (Tem) cell severe IFI27 0.982 0.007 55.002 0.020833333 5.777659103 0 0 9CD1C+_B dendritic cell severe IFI27 0.355 0.006 1.151436031 0.005580357 1.097271572 0 0 11CD4+ T cell severe IFI27 0.533 0.033 8.977777778 0.032786885 3.272175952 0 0 43Plasmacytoid dendritic cell severe IFI35 0.87 0.246 1.652173913 0.280701754 1.050240837 7.43E-10 1.31E-05 45Plasmacytoid dendritic cell severe IFI35 0.867 0.295 2.266666667 0.426229508 1.19561309 2.10E-11 3.71E-07 43Plasmacytoid dendritic cell severe IFI35 0.667 0.225 1 0.255813953 0.671377253 1.08E-11 1.90E-07 35Effector CD8+ memory T (Tem) cell severe IFI35 0.4 0.069 0.6125 0.072026801 0.588958187 4.06E-24 7.17E-20 20CD141+CLEC9A+ dendritic cell severe IFI35 0.75 0.357 1.472222222 0.382608696 0.838415525 6.91E-25 1.22E-20 33Plasmacytoid dendritic cell severe IFI35 0.492 0.097 0.7265625 0.107594937 0.640472196 3.31E-25 5.85E-21 22CD8+ T cell severe IFI35 0.624 0.16 0.98265896 0.202614379 0.721262425 7.93E-26 1.40E-21 24T cell(Activated T cell) severe IFI35 0.654 0.127 0.954887218 0.132947977 0.787003761 9.36E-28 1.65E-23 31CD8 cytoxict cells severe IFI35 0.569 0.105 0.931372549 0.116216216 0.791009967 1.03E-28 1.82E-24 25Megakaryocyte progenitor cell severe IFI35 0.625 0.142 1.089285714 0.145214521 0.867391928 9.14E-35 1.61E-30 29CD8+ T cell severe IFI35 0.516 0.09 0.832740214 0.112418301 0.720302918 6.96E-50 1.23E-45 15CD1C+_B dendritic cell severe IFI35 0.776 0.427 1.717948718 0.49452954 0.862826822 1.77E-56 3.12E-52 21CD1C-CD141- dendritic cell severe IFI35 0.553 0.144 1.048543689 0.158615717 0.82219652 3.41E-58 6.02E-54 8Effector CD8+ memory T (Tem) cell severe IFI35 0.491 0.131 0.776237624 0.147161066 0.630756631 1.96E-61 3.46E-57 10CD8+ T cell severe IFI35 0.652 0.129 1.036082474 0.142857143 0.833150923 1.60E-72 2.81E-68 16CD8+ T cell severe IFI35 0.514 0.092 0.708191126 0.097520661 0.638221305 1.30E-106 2.29E-102 7CD4+ T cell severe IFI35 0.784 0.337 1.438 0.388157895 0.812526451 3.21E-115 5.66E-111 9CD1C+_B dendritic cell severe IFI35 0.682 0.173 1.254113346 0.195465686 0.914987341 2.18E-168 3.84E-164 4Effector CD8+ memory T (Tem) cell severe IFI35 0.596 0.123 0.952164009 0.130222841 0.788467014 1.19E-184 2.10E-180 3Effector CD8+ memory T (Tem) cell severe IFI35 0.766 0.246 1.53907496 0.285820896 0.981613287 8.16E-188 1.44E-183 5Effector CD8+ memory T (Tem) cell severe IFI35 0.529 0.174 0.852941176 0.173913043 0.658491536 0 0 44CD8 cytoxict cells severe IFI44 0.352 0.035 1 0.079646018 0.889441625 7.47E-11 1.32E-06 30CD1C-CD141- dendritic cell severe IFI44 0.475 0.082 0.675 0.087102178 0.623673549 6.54E-25 1.15E-20 20CD141+CLEC9A+ dendritic cell severe IFI44 0.426 0.048 0.60106383 0.050704225 0.607674219 1.19E-29 2.10E-25 23CD4+ T cell severe IFI44 0.555 0.095 0.959537572 0.10130719 0.831296297 1.17E-36 2.06E-32 24T cell(Activated T cell) severe IFI44 0.488 0.067 0.768683274 0.092810458 0.694632527 1.37E-48 2.41E-44 15CD1C+_B dendritic cell severe IFI44 0.428 0.037 0.631443299 0.03877551 0.65126494 7.91E-53 1.40E-48 16CD8+ T cell severe IFI44 0.439 0.058 0.603133159 0.0625 0.593431422 1.41E-64 2.49E-60 11CD4+ T cell severe IFI44 0.706 0.195 1.092 0.244517544 0.749296284 3.53E-86 6.24E-82 9CD1C+_B dendritic cell severe IFI44 0.515 0.085 0.726962457 0.091735537 0.661613301 5.80E-106 1.02E-101 7CD4+ T cell severe IFI44 0.455 0.046 0.645933014 0.052985075 0.644420635 3.39E-108 5.97E-104 5Effector CD8+ memory T (Tem) cell severe IFI44 0.389 0.031 0.552102377 0.031862745 0.58897264 2.52E-116 4.45E-112 4Effector CD8+ memory T (Tem) cell severe IFI44 0.434 0.038 0.584884995 0.04075067 0.606753669 2.96E-155 5.22E-151 2CD4+ T cell severe IFI44 0.383 0.055 0.59375 0.054852321 0.595384306 0 0 22CD8+ T cell severe IFI44 0.432 0.064 0.648648649 0.064285714 0.631398468 0 0 37CD8+ T cell severe IFI44 0.457 0.067 0.742857143 0.066666667 0.708344916 0 0 41Naive CD8+ T cell severe IFI44 0.542 0.036 0.75 0.036144578 0.756129599 0 0 42Megakaryocyte progenitor cell severe IFI44 0.4 0.136 0.8 0.136363636 0.663572335 0 0 47AXL+SIGLEC6+ dendritic cell severe IFI44L 1 0 3.4 0 2.137503524 3.55E-10 6.26E-06 34CD8 cytoxict cells severe IFI44L 0.909 0.075 2.363636364 0.083333333 1.63454453 3.60E-12 6.35E-08 39CD141+CLEC9A+ dendritic cell severe IFI44L 0.935 0.079 3.612903226 0.157894737 1.994170921 1.56E-13 2.75E-09 46B cell severe IFI44L 0.957 0.123 3.565217391 0.175438596 1.957484385 2.04E-17 3.59E-13 45Plasmacytoid dendritic cell severe IFI44L 0.8 0.011 2.742857143 0.011111111 1.888198441 1.06E-19 1.87E-15 41Naive CD8+ T cell severe IFI44L 0.958 0.012 3.041666667 0.036144578 1.963725018 5.43E-20 9.58E-16 42Megakaryocyte progenitor cell severe IFI44L 0.909 0 2.681818182 0 1.880418384 4.43E-21 7.82E-17 40CD8+ T cell severe IFI44L 0.973 0.033 3.189189189 0.046052632 2.001715598 1.03E-32 1.82E-28 36CD8+ T cell severe IFI44L 0.714 0.003 1.732142857 0.00330033 1.445279391 1.71E-37 3.02E-33 29CD8+ T cell severe IFI44L 0.933 0.044 3.711111111 0.058823529 2.153605198 4.17E-39 7.36E-35 32Naive CD8+ T cell severe IFI44L 1 0.036 3.757142857 0.072289157 2.149401351 1.16E-40 2.05E-36 38Plasmacytoid dendritic cell severe IFI44L 0.737 0.017 2.165413534 0.028901734 1.621288784 1.61E-44 2.84E-40 31CD8 cytoxict cells severe IFI44L 0.971 0.047 3.637681159 0.062015504 2.126598811 7.43E-45 1.31E-40 35Effector CD8+ memory T (Tem) cell severe IFI44L 0.716 0.003 1.901960784 0.002702703 1.533134108 3.38E-59 5.97E-55 25Megakaryocyte progenitor cell severe IFI44L 0.928 0.003 2.47826087 0.003401361 1.793467339 6.73E-63 1.19E-58 28CD1C+_B dendritic cell severe IFI44L 0.99 0.08 4.301507538 0.168141593 2.182187506 2.22E-69 3.92E-65 30CD1C-CD141- dendritic cell severe IFI44L 0.911 0.024 3.1 0.026627219 1.997711493 2.73E-74 4.82E-70 26 T cell severe IFI44L 0.814 0.079 1.923076923 0.09190372 1.420642145 1.44E-80 2.54E-76 21CD1C-CD141- dendritic cell severe IFI44L 0.879 0.059 3 0.078431373 1.891065628 8.70E-85 1.53E-80 24T cell(Activated T cell) severe IFI44L 0.925 0.03 3.275 0.033500838 2.048384862 3.11E-86 5.49E-82 20CD141+CLEC9A+ dendritic cell severe IFI44L 0.939 0 1.262569832 0 1.177962321 2.69E-93 4.74E-89 27Megakaryocyte progenitor cell severe IFI44L 0.77 0.053 2.819875776 0.0625 1.846062881 6.07E-95 1.07E-90 19CD141+CLEC9A+ dendritic cell severe IFI44L 0.888 0.034 2.845744681 0.061971831 1.856517486 7.65E-100 1.35E-95 23CD4+ T cell severe IFI44L 0.854 0.007 2.621359223 0.008651766 1.844103118 1.99E-117 3.51E-113 8Effector CD8+ memory T (Tem) cell severe IFI44L 0.889 0.034 2.74893617 0.040983607 1.848533913 6.41E-151 1.13E-146 17CD4+ T cell severe IFI44L 0.861 0.054 2.323843416 0.081045752 1.620424838 1.87E-153 3.30E-149 15CD1C+_B dendritic cell severe IFI44L 0.902 0.019 2.848780488 0.020696143 1.914847945 2.54E-185 4.48E-181 12Megakaryocyte progenitor cell severe IFI44L 0.995 0.001 1.54 0.002118644 1.341775173 4.44E-223 7.84E-219 14Megakaryocyte progenitor cell severe IFI44L 0.792 0.024 2.500990099 0.026651217 1.769816842 1.15E-226 2.03E-222 10CD8+ T cell severe IFI44L 0.997 0.01 3.713846154 0.024096386 2.202553169 5.73E-227 1.01E-222 18CD4+ T helper severe IFI44L 0.918 0.133 2.692 0.189692982 1.63381324 6.87E-233 1.21E-228 9CD1C+_B dendritic cell severe IFI44L 0.89 0.039 3.031331593 0.043526786 1.949788823 3.97E-240 7.00E-236 11CD4+ T cell severe IFI44L 0.934 0.045 3.638356164 0.058891455 2.131058895 2.25E-245 3.98E-241 13CD141+CLEC9A+ dendritic cell severe IFI44L 0.678 0.012 1.797074954 0.014093137 1.463728755 7.66E-258 1.35E-253 4Effector CD8+ memory T (Tem) cell severe IFI44L 0.656 0.007 1.624145786 0.007660167 1.380838699 4.52E-302 7.97E-298 3Effector CD8+ memory T (Tem) cell severe IFI44L 0.888 0.025 2.740740741 0.030428769 1.860079202 0 0 1Naive CD4+ T cell severe IFI44L 0.92 0.042 3.273822563 0.05308311 2.020907713 0 0 2CD4+ T cell severe IFI44L 0.839 0.016 2.438596491 0.021641791 1.750930384 0 0 5Effector CD8+ memory T (Tem) cell severe IFI44L 0.943 0.02 2.734090909 0.020604396 1.871333291 0 0 6CD8+ T cell severe IFI44L 0.908 0.066 3.003412969 0.075206612 1.896616529 0 0 7CD4+ T cell severe IFI44L 0.763 0.006 1.93556701 0.006122449 1.544833292 0 0 16CD8+ T cell severe IFI44L 0.766 0.006 2.1484375 0.006329114 1.645533821 0 0 22CD8+ T cell severe IFI44L 0.556 0.026 1.157407407 0.026086957 1.072145644 0 0 33Plasmacytoid dendritic cell severe IFI44L 0.946 0.014 2.594594595 0.014285714 1.825364967 0 0 37CD8+ T cell severe IFI44L 0.853 0.043 2.470588235 0.043478261 1.733779663 0 0 44CD8 cytoxict cells severe IFI6 0.824 0.13 2.205882353 0.173913043 1.449395937 5.37E-11 9.47E-07 44CD8 cytoxict cells severe IFI6 0.818 0.168 1.590909091 0.186915888 1.126240695 6.41E-13 1.13E-08 40CD8+ T cell severe IFI6 0.676 0.171 1.594594595 0.192857143 1.12108786 2.77E-16 4.88E-12 37CD8+ T cell severe IFI6 0.771 0.156 2.028571429 0.166666667 1.376245016 9.93E-18 1.75E-13 41Naive CD8+ T cell severe IFI6 1 0.156 3.6 0.165829146 1.980277487 8.68E-19 1.53E-14 34CD8 cytoxict cells severe IFI6 0.911 0.279 4.777777778 0.327868852 2.121402051 2.52E-20 4.45E-16 43Plasmacytoid dendritic cell severe IFI6 0.841 0.14 2.724637681 0.162790698 1.679508657 5.39E-30 9.51E-26 35Effector CD8+ memory T (Tem) cell severe IFI6 0.778 0.191 2.444444444 0.215686275 1.502500341 6.37E-31 1.12E-26 32Naive CD8+ T cell severe IFI6 0.865 0.191 2.081081081 0.197368421 1.363569522 1.18E-31 2.08E-27 36CD8+ T cell severe IFI6 0.957 0.036 1.871428571 0.048192771 1.45386461 4.55E-35 8.03E-31 38Plasmacytoid dendritic cell severe IFI6 0.756 0.13 2.044444444 0.144970414 1.410868667 1.30E-49 2.30E-45 26 T cell severe IFI6 0.911 0.142 3.982142857 0.171617162 2.088265159 9.57E-52 1.69E-47 29CD8+ T cell severe IFI6 0.942 0.082 2.362318841 0.102040816 1.60927888 2.40E-52 4.23E-48 28CD1C+_B dendritic cell severe IFI6 0.925 0.249 3.398496241 0.312138728 1.745090119 7.85E-55 1.39E-50 31CD8 cytoxict cells severe IFI6 0.944 0.226 4.453703704 0.234782609 2.142979253 6.59E-56 1.16E-51 33Plasmacytoid dendritic cell severe IFI6 0.888 0.171 2.725 0.21440536 1.616990362 1.24E-64 2.19E-60 20CD141+CLEC9A+ dendritic cell severe IFI6 0.824 0.135 2.117021277 0.177464789 1.404484085 3.48E-67 6.14E-63 23CD4+ T cell severe IFI6 0.677 0.082 1.434782609 0.086538462 1.164053722 1.53E-74 2.70E-70 19CD141+CLEC9A+ dendritic cell severe IFI6 0.902 0.162 3.911764706 0.191891892 2.042988066 1.51E-77 2.66E-73 25Megakaryocyte progenitor cell severe IFI6 0.948 0.173 4.173410405 0.297385621 1.99550829 1.51E-79 2.66E-75 24T cell(Activated T cell) severe IFI6 1 0.044 3.190954774 0.07079646 1.968594678 1.12E-79 1.98E-75 30CD1C-CD141- dendritic cell severe IFI6 0.927 0.026 1.810055866 0.046153846 1.425503784 2.74E-81 4.83E-77 27Megakaryocyte progenitor cell severe IFI6 0.844 0.194 2.9296875 0.213080169 1.695739693 5.12E-95 9.04E-91 22CD8+ T cell severe IFI6 0.809 0.13 2.068085106 0.149180328 1.416733301 2.00E-102 3.52E-98 17CD4+ T cell severe IFI6 0.981 0.365 4.967948718 0.529540481 1.964136848 1.57E-106 2.77E-102 21CD1C-CD141- dendritic cell severe IFI6 0.671 0.053 1.580821918 0.056581986 1.288425877 9.09E-140 1.60E-135 13CD141+CLEC9A+ dendritic cell severe IFI6 0.902 0.155 3.332474227 0.193877551 1.859536292 4.76E-153 8.39E-149 16CD8+ T cell severe IFI6 0.834 0.135 2.175609756 0.145813735 1.470661097 2.37E-160 4.18E-156 12Megakaryocyte progenitor cell severe IFI6 0.942 0.154 3.922330097 0.173756309 2.068208498 1.18E-165 2.08E-161 8Effector CD8+ memory T (Tem) cell severe IFI6 0.82 0.155 2.2845953 0.174107143 1.484151558 6.83E-175 1.21E-170 11CD4+ T cell severe IFI6 0.968 0.118 4.548042705 0.179084967 2.234311207 2.43E-193 4.29E-189 15CD1C+_B dendritic cell severe IFI6 0.997 0.05 2.135384615 0.088353414 1.526495319 2.99E-202 5.27E-198 18CD4+ T helper severe IFI6 1 0.016 4.07 0.050847458 2.270432486 1.82E-206 3.21E-202 14Megakaryocyte progenitor cell severe IFI6 0.851 0.202 2.867326733 0.236384705 1.645208945 4.41E-214 7.79E-210 10CD8+ T cell severe IFI6 0.784 0.164 1.804545455 0.182692308 1.245692178 4.47E-216 7.89E-212 6CD8+ T cell severe IFI6 0.882 0.159 2.672354949 0.178512397 1.639738574 1.19E-294 2.10E-290 7CD4+ T cell severe IFI6 0.795 0.15 1.931955211 0.162863071 1.334181838 0 0 1Naive CD4+ T cell severe IFI6 0.815 0.145 2.351588171 0.170509383 1.517708388 0 0 2CD4+ T cell severe IFI6 0.935 0.171 4.017084282 0.188718663 2.077441865 0 0 3Effector CD8+ memory T (Tem) cell severe IFI6 0.932 0.188 4.34369287 0.215686275 2.136066123 0 0 4Effector CD8+ memory T (Tem) cell severe IFI6 0.941 0.172 4.615629984 0.214925373 2.20858018 0 0 5Effector CD8+ memory T (Tem) cell severe IFI6 0.994 0.363 8.756 0.625 2.58585004 0 0 9CD1C+_B dendritic cell severe IFI6 0.667 0.145 1.75 0.144578313 1.264615442 0 0 42Megakaryocyte progenitor cell severe IFIT1 0.389 0.009 0.694444444 0.008695652 0.748321392 3.08E-13 5.44E-09 33Plasmacytoid dendritic cell severe IFIT1 0.375 0 0.714285714 0 0.777607579 1.68E-18 2.97E-14 29CD8+ T cell severe IFIT1 0.459 0.012 0.751879699 0.028901734 0.767798506 3.33E-23 5.88E-19 31CD8 cytoxict cells severe IFIT1 0.379 0.016 0.633540373 0.02724359 0.669223783 8.75E-35 1.54E-30 19CD141+CLEC9A+ dendritic cell severe IFIT1 0.359 0.006 0.59223301 0.007930786 0.659654904 2.17E-37 3.83E-33 8Effector CD8+ memory T (Tem) cell severe IFIT1 0.539 0.003 0.843137255 0.002702703 0.878269594 2.45E-40 4.32E-36 25Megakaryocyte progenitor cell severe IFIT1 0.555 0.02 1.231213873 0.035947712 1.106877622 3.65E-43 6.44E-39 24T cell(Activated T cell) severe IFIT1 0.571 0.059 1.153846154 0.067833698 1.012228221 3.44E-44 6.06E-40 21CD1C-CD141- dendritic cell severe IFIT1 0.38 0.007 0.631683168 0.00811124 0.694706108 3.35E-85 5.90E-81 10CD8+ T cell severe IFIT1 0.498 0.01 0.824561404 0.011940299 0.850425526 1.13E-163 2.00E-159 5Effector CD8+ memory T (Tem) cell severe IFIT1 0.521 0.015 0.970749543 0.017156863 0.954202256 2.55E-172 4.51E-168 4Effector CD8+ memory T (Tem) cell severe IFIT1 0.492 0.004 0.820045558 0.004874652 0.856959013 4.91E-207 8.66E-203 3Effector CD8+ memory T (Tem) cell severe IFIT1 0.454 0.004 0.729381443 0.004081633 0.784379548 0 0 16CD8+ T cell severe IFIT1 0.32 0.004 0.59375 0.004219409 0.666350828 0 0 22CD8+ T cell severe IFIT2 0.571 0.177 1.512820513 0.223194748 1.038653507 1.73E-34 3.05E-30 21CD1C-CD141- dendritic cell severe IFIT2 0.448 0.111 0.84 0.175438596 0.64650659 9.82E-44 1.73E-39 9CD1C+_B dendritic cell severe IFIT3 0.677 0 1.516129032 0 1.331205908 6.21E-10 1.10E-05 46B cell severe IFIT3 0.625 0.012 1.083333333 0.012048193 1.041615698 5.61E-10 9.90E-06 42Megakaryocyte progenitor cell severe IFIT3 0.429 0.012 0.828571429 0.012048193 0.853438992 4.46E-10 7.87E-06 38Plasmacytoid dendritic cell severe IFIT3 0.405 0 0.513513514 0 0.597901556 7.49E-12 1.32E-07 36CD8+ T cell severe IFIT3 0.657 0.011 1 0.011111111 0.984058456 7.79E-14 1.37E-09 41Naive CD8+ T cell severe IFIT3 0.489 0.005 0.822222222 0.004901961 0.858644151 1.64E-16 2.89E-12 32Naive CD8+ T cell severe IFIT3 0.406 0.023 0.766917293 0.040462428 0.764009642 3.75E-17 6.62E-13 31CD8 cytoxict cells severe IFIT3 0.467 0 0.788944724 0 0.83910881 1.22E-22 2.16E-18 30CD1C-CD141- dendritic cell severe IFIT3 0.417 0.05 0.834951456 0.098774333 0.739846782 1.21E-23 2.13E-19 8Effector CD8+ memory T (Tem) cell severe IFIT3 0.594 0.02 0.826086957 0.051020408 0.796964784 3.56E-30 6.28E-26 28CD1C+_B dendritic cell severe IFIT3 0.51 0.027 1.009803922 0.02972973 0.964789031 1.05E-32 1.86E-28 25Megakaryocyte progenitor cell severe IFIT3 0.578 0.015 1.211111111 0.023668639 1.111022733 5.58E-35 9.85E-31 26 T cell severe IFIT3 0.536 0 0.793296089 0 0.84261371 1.58E-38 2.79E-34 27Megakaryocyte progenitor cell severe IFIT3 0.59 0.011 1.164893617 0.030985915 1.070271509 2.42E-57 4.27E-53 23CD4+ T cell severe IFIT3 0.728 0.036 2.219653179 0.068627451 1.591146307 1.14E-60 2.02E-56 24T cell(Activated T cell) severe IFIT3 0.345 0.023 0.615841584 0.027809965 0.652712219 9.69E-64 1.71E-59 10CD8+ T cell severe IFIT3 0.827 0.184 2.737179487 0.240700219 1.590795284 1.28E-71 2.25E-67 21CD1C-CD141- dendritic cell severe IFIT3 0.52 0.01 0.796923077 0.016064257 0.822537008 2.16E-74 3.81E-70 18CD4+ T helper severe IFIT3 0.532 0.008 1.046808511 0.009836066 1.019255029 2.60E-75 4.58E-71 17CD4+ T cell severe IFIT3 0.58 0.03 1.099644128 0.049673203 1.000204584 1.28E-84 2.26E-80 15CD1C+_B dendritic cell severe IFIT3 0.801 0.045 2.055900621 0.057692308 1.530677632 5.74E-92 1.01E-87 19CD141+CLEC9A+ dendritic cell severe IFIT3 0.416 0.005 0.579545455 0.005494505 0.651604256 2.04E-119 3.59E-115 6CD8+ T cell severe IFIT3 0.569 0.013 1.187989556 0.022321429 1.097756986 3.76E-120 6.64E-116 11CD4+ T cell severe IFIT3 0.72 0.084 1.614 0.119517544 1.223382004 9.67E-144 1.71E-139 9CD1C+_B dendritic cell severe IFIT3 0.785 0.003 0.97 0.00529661 0.970574402 6.47E-147 1.14E-142 14Megakaryocyte progenitor cell severe IFIT3 0.634 0.066 1.506398537 0.109681373 1.175470344 7.18E-161 1.27E-156 4Effector CD8+ memory T (Tem) cell severe IFIT3 0.608 0.034 1.220136519 0.073553719 1.048254009 7.47E-164 1.32E-159 7CD4+ T cell severe IFIT3 0.641 0.062 1.342902711 0.157462687 1.017331362 9.82E-170 1.73E-165 5Effector CD8+ memory T (Tem) cell severe IFIT3 0.525 0.025 1.003416856 0.034122563 0.954055456 3.45E-188 6.08E-184 3Effector CD8+ memory T (Tem) cell severe IFIT3 0.781 0.016 1.783561644 0.017321016 1.452157039 3.51E-189 6.19E-185 13CD141+CLEC9A+ dendritic cell severe IFIT3 0.559 0.016 1.144578313 0.025201072 1.064787107 6.65E-256 1.17E-251 2CD4+ T cell severe IFIT3 0.532 0.01 0.958656331 0.011065007 0.953988523 0 0 1Naive CD4+ T cell severe IFIT3 0.566 0.01 1.12195122 0.010348071 1.070539095 0 0 12Megakaryocyte progenitor cell severe IFIT3 0.436 0.012 0.75257732 0.012244898 0.791919723 0 0 16CD8+ T cell severe IFIT3 0.367 0.017 0.640625 0.016877637 0.69009943 0 0 22CD8+ T cell severe IFIT3 0.518 0.017 0.892857143 0.01650165 0.896952975 0 0 29CD8+ T cell severe IFIT3 0.296 0.035 0.787037037 0.034782609 0.788241823 0 0 33Plasmacytoid dendritic cell severe IFIT3 0.4 0.01 1 0.010050251 0.985572929 0 0 34CD8 cytoxict cells severe IFITM1 1 0.183 10.18181818 0.491666667 2.906157705 2.83E-11 4.99E-07 39CD141+CLEC9A+ dendritic cell severe IFITM1 0.968 0.237 11.29032258 0.368421053 3.166938672 5.75E-19 1.02E-14 46B cell severe IFITM1 1 0.952 19.54166667 4.277108434 1.960733707 4.63E-21 8.17E-17 42Megakaryocyte progenitor cell severe IFITM1 1 0.891 23.17647059 4 2.273603648 6.98E-23 1.23E-18 44CD8 cytoxict cells severe IFITM1 0.933 0.262 14.02222222 0.524590164 3.300604866 4.68E-24 8.25E-20 43Plasmacytoid dendritic cell severe IFITM1 1 1 18.8 4.488888889 1.85091439 1.15E-27 2.02E-23 41Naive CD8+ T cell severe IFITM1 1 0.963 22.27272727 4.252336449 2.147609048 9.39E-30 1.66E-25 40CD8+ T cell severe IFITM1 1 0.98 19.56756757 4.664473684 1.860357364 7.68E-31 1.36E-26 36CD8+ T cell severe IFITM1 1 0.979 20.54054054 4.714285714 1.914409376 6.41E-35 1.13E-30 37CD8+ T cell severe IFITM1 1 0.626 25.75925926 5.643478261 2.010027498 6.26E-35 1.10E-30 33Plasmacytoid dendritic cell severe IFITM1 1 1 33.1884058 12.34883721 1.356793074 6.62E-37 1.17E-32 35Effector CD8+ memory T (Tem) cell severe IFITM1 0.971 0.916 7.242857143 1.397590361 1.781559303 9.41E-38 1.66E-33 38Plasmacytoid dendritic cell severe IFITM1 1 1 19.91111111 5.573529412 1.669529636 9.13E-39 1.61E-34 32Naive CD8+ T cell severe IFITM1 1 0.986 21.89855072 5.707482993 1.771412895 1.84E-40 3.24E-36 28CD1C+_B dendritic cell severe IFITM1 1 1 31.28571429 8.858085809 1.711516502 1.05E-56 1.85E-52 29CD8+ T cell severe IFITM1 0.995 0.92 7.27638191 1.663716814 1.635559505 5.64E-58 9.94E-54 30CD1C-CD141- dendritic cell severe IFITM1 1 1 8.603076923 4.202811245 0.884205366 4.23E-68 7.47E-64 18CD4+ T helper severe IFITM1 0.972 0.913 5.972067039 1.605128205 1.420232069 4.12E-74 7.28E-70 27Megakaryocyte progenitor cell severe IFITM1 1 0.989 29.10784314 8.218918919 1.707469876 5.78E-75 1.02E-70 25Megakaryocyte progenitor cell severe IFITM1 1 0.967 22.25555556 5.269230769 1.891215064 4.19E-78 7.40E-74 26 T cell severe IFITM1 1 0.954 28.0075188 6.167630058 2.016858815 7.65E-81 1.35E-76 31CD8 cytoxict cells severe IFITM1 1 0.931 28.17919075 7.232026144 1.825620403 1.01E-91 1.79E-87 24T cell(Activated T cell) severe IFITM1 1 0.989 26.2734375 7.632911392 1.659577461 9.40E-93 1.66E-88 22CD8+ T cell severe IFITM1 1 0.908 20.2125 3.534338358 2.225950704 1.42E-104 2.50E-100 20CD141+CLEC9A+ dendritic cell severe IFITM1 1 0.993 26.68932039 7.06777217 1.779087396 7.87E-121 1.39E-116 8Effector CD8+ memory T (Tem) cell severe IFITM1 1 0.952 21.5212766 5.095774648 1.885407133 9.17E-127 1.62E-122 23CD4+ T cell severe IFITM1 1 0.977 21.06808511 5.427868852 1.77954905 1.58E-156 2.78E-152 17CD4+ T cell severe IFITM1 1 0.4 24.34615385 1.098468271 3.594358287 1.92E-182 3.39E-178 21CD1C-CD141- dendritic cell severe IFITM1 1 0.322 10.38509317 0.461538462 2.961586397 1.99E-196 3.51E-192 19CD141+CLEC9A+ dendritic cell severe IFITM1 1 0.967 20.0195122 4.63593603 1.899002047 4.37E-212 7.70E-208 12Megakaryocyte progenitor cell severe IFITM1 1 0.992 30.01546392 8.475510204 1.710712173 1.08E-217 1.90E-213 16CD8+ T cell severe IFITM1 1 0.974 21.96605744 5.5625 1.807185789 3.44E-267 6.06E-263 11CD4+ T cell severe IFITM1 1 0.591 15.49822064 1.079738562 2.987836348 1.87E-307 3.31E-303 15CD1C+_B dendritic cell severe IFITM1 1 0.993 8.91 2.11440678 1.6699276674.89960684377016e-312 8.65E-308 14Megakaryocyte progenitor cell severe IFITM1 1 0.971 18.98621878 5.031811895 1.728342209 0 0 1Naive CD4+ T cell severe IFITM1 1 0.981 23.00876232 5.726541555 1.835624193 0 0 2CD4+ T cell severe IFITM1 1 0.997 29.75854214 7.701253482 1.821691973 0 0 3Effector CD8+ memory T (Tem) cell severe IFITM1 1 0.996 34.16819013 10.25306373 1.643953252 0 0 4Effector CD8+ memory T (Tem) cell severe IFITM1 1 0.999 38.70494418 13.4 1.463249856 0 0 5Effector CD8+ memory T (Tem) cell severe IFITM1 1 0.966 19.55454545 4.853021978 1.812203867 0 0 6CD8+ T cell severe IFITM1 1 0.975 24.17576792 5.916528926 1.863915679 0 0 7CD4+ T cell severe IFITM1 0.996 0.093 15.142 0.222587719 3.722809454 0 0 9CD1C+_B dendritic cell severe IFITM1 1 0.942 22.86732673 4.618771727 2.086710292 0 0 10CD8+ T cell severe IFITM1 1 0.394 12.60273973 0.602771363 3.085256711 0 0 13CD141+CLEC9A+ dendritic cell severe IFITM2 0.903 0.342 3.258064516 0.526315789 1.480144327 6.69E-10 1.18E-05 46B cell severe IFITM2 1 0.65 7.090909091 1.525 1.680018424 6.37E-10 1.12E-05 39CD141+CLEC9A+ dendritic cell severe IFITM2 0.826 0.246 2.608695652 0.298245614 1.474914124 2.61E-10 4.60E-06 45Plasmacytoid dendritic cell severe IFITM2 0.914 0.892 2.571428571 1.168674699 0.719687603 6.79E-14 1.20E-09 38Plasmacytoid dendritic cell severe IFITM2 1 0.935 7.421568627 4.216216216 0.691085308 2.21E-14 3.90E-10 25Megakaryocyte progenitor cell severe IFITM2 0.9 0.642 2.577777778 1.198224852 0.702724818 1.00E-14 1.77E-10 26 T cell severe IFITM2 0.925 0.745 3.630057803 1.895424837 0.677255159 2.47E-15 4.36E-11 24T cell(Activated T cell) severe IFITM2 0.955 0.815 6.07518797 2.479768786 1.023777028 1.28E-21 2.26E-17 31CD8 cytoxict cells severe IFITM2 0.878 0.634 2.941489362 1.318309859 0.765667475 1.07E-22 1.88E-18 23CD4+ T cell severe IFITM2 0.99 0.901 6.766990291 3.271809661 0.862508296 2.84E-27 5.01E-23 8Effector CD8+ memory T (Tem) cell severe IFITM2 0.919 0.689 2.808510638 1.313114754 0.719390085 7.12E-33 1.26E-28 17CD4+ T cell severe IFITM2 0.938 0.704 4.65 1.475711893 1.190407435 2.50E-35 4.41E-31 20CD141+CLEC9A+ dendritic cell severe IFITM2 0.876 0.609 2.546583851 0.955128205 0.859166844 1.85E-42 3.26E-38 19CD141+CLEC9A+ dendritic cell severe IFITM2 0.961 0.821 2.346368715 0.984615385 0.753736973 1.92E-43 3.38E-39 27Megakaryocyte progenitor cell severe IFITM2 0.997 0.908 7.115979381 3.967346939 0.708289686 1.86E-43 3.28E-39 16CD8+ T cell severe IFITM2 0.893 0.656 2.72195122 1.166509878 0.780686333 6.89E-44 1.22E-39 12Megakaryocyte progenitor cell severe IFITM2 0.893 0.714 2.634090909 1.337225275 0.636797714 1.24E-55 2.18E-51 6CD8+ T cell severe IFITM2 0.919 0.672 3.190600522 1.366071429 0.824663373 3.65E-60 6.45E-56 11CD4+ T cell severe IFITM2 0.913 0.616 3.603960396 1.334878331 0.979528049 3.94E-82 6.95E-78 10CD8+ T cell severe IFITM2 0.951 0.746 3.866894198 1.771900826 0.812125771 1.38E-87 2.43E-83 7CD4+ T cell severe IFITM2 0.91 0.561 2.969863014 0.978060046 1.005003004 4.29E-89 7.58E-85 13CD141+CLEC9A+ dendritic cell severe IFITM2 1 0.847 7.612099644 2.849673203 1.161629031 5.40E-93 9.52E-89 15CD1C+_B dendritic cell severe IFITM2 0.985 0.919 6.37357631 3.432451253 0.734259756 1.26E-111 2.23E-107 3Effector CD8+ memory T (Tem) cell severe IFITM2 0.995 0.981 3.29 1.299788136 0.899476686 3.68E-113 6.49E-109 14Megakaryocyte progenitor cell severe IFITM2 0.915 0.679 2.952902519 1.327077748 0.764392966 1.48E-126 2.62E-122 2CD4+ T cell severe IFITM2 0.885 0.637 2.529715762 1.170816044 0.701314536 3.14E-150 5.54E-146 1Naive CD4+ T cell severe IFITM2 0.996 0.723 7.072 1.797149123 1.528969005 1.47E-233 2.59E-229 9CD1C+_B dendritic cell severe IFITM3 1 0.432 10 0.636363636 2.748938236 5.78E-10 1.02E-05 47AXL+SIGLEC6+ dendritic cell severe IFITM3 0.892 0.625 2.648648649 0.953947368 0.900970624 9.22E-12 1.63E-07 36CD8+ T cell severe IFITM3 0.919 0.571 2.432432432 0.828571429 0.908514338 1.43E-12 2.53E-08 37CD8+ T cell severe IFITM3 0.88 0.47 6.574074074 1.973913043 1.348707067 3.50E-13 6.17E-09 33Plasmacytoid dendritic cell severe IFITM3 0.943 0.533 2.457142857 0.7 1.024045474 1.55E-13 2.73E-09 41Naive CD8+ T cell severe IFITM3 0.889 0.485 2.466666667 0.735294118 0.998368914 1.80E-15 3.17E-11 32Naive CD8+ T cell severe IFITM3 1 0.717 30.54545455 2.641666667 3.11476136 9.54E-16 1.68E-11 39CD141+CLEC9A+ dendritic cell severe IFITM3 0.929 0.822 4.125 1.831683168 0.855892151 9.20E-16 1.62E-11 29CD8+ T cell severe IFITM3 0.917 0.518 3.458333333 0.698795181 1.391992565 2.45E-16 4.32E-12 42Megakaryocyte progenitor cell severe IFITM3 0.928 0.639 5.52173913 1.568027211 1.344596245 2.06E-19 3.63E-15 28CD1C+_B dendritic cell severe IFITM3 0.922 0.679 3.4765625 1.497890295 0.841681212 1.32E-23 2.34E-19 22CD8+ T cell severe IFITM3 1 0.953 13.33333333 5.348837209 1.174809868 2.25E-26 3.98E-22 35Effector CD8+ memory T (Tem) cell severe IFITM3 0.878 0.491 2.3 0.730769231 0.931052646 1.43E-26 2.52E-22 26 T cell severe IFITM3 0.971 0.797 6.235294118 2.118918919 1.214005616 8.59E-33 1.52E-28 25Megakaryocyte progenitor cell severe IFITM3 1 0.761 8.105527638 1.946902655 1.627543215 1.24E-33 2.18E-29 30CD1C-CD141- dendritic cell severe IFITM3 0.947 0.566 4.278195489 1.092485549 1.334827125 3.92E-34 6.92E-30 31CD8 cytoxict cells severe IFITM3 0.896 0.546 3.479768786 1.062091503 1.11931592 1.70E-35 3.00E-31 24T cell(Activated T cell) severe IFITM3 0.888 0.558 2.760638298 0.890140845 0.992483811 1.02E-40 1.80E-36 23CD4+ T cell severe IFITM3 0.962 0.529 3.8625 0.887772194 1.365013571 5.71E-48 1.01E-43 20CD141+CLEC9A+ dendritic cell severe IFITM3 0.957 0.687 3.785714286 0.722891566 1.473902363 7.86E-49 1.39E-44 38Plasmacytoid dendritic cell severe IFITM3 0.971 0.718 5.621359223 1.632299928 1.330803521 1.29E-59 2.27E-55 8Effector CD8+ memory T (Tem) cell severe IFITM3 0.969 0.753 4.368556701 1.787755102 0.945430453 4.87E-63 8.59E-59 16CD8+ T cell severe IFITM3 0.902 0.544 2.889361702 0.868852459 1.057380732 2.08E-66 3.66E-62 17CD4+ T cell severe IFITM3 0.989 0.528 5.296089385 0.656410256 1.926395982 3.44E-83 6.06E-79 27Megakaryocyte progenitor cell severe IFITM3 0.851 0.381 2.273291925 0.456730769 1.168008008 3.89E-87 6.86E-83 19CD141+CLEC9A+ dendritic cell severe IFITM3 0.895 0.565 2.484090909 0.894917582 0.878647167 1.52E-107 2.68E-103 6CD8+ T cell severe IFITM3 0.932 0.532 3.365853659 0.823142051 1.259836799 5.40E-110 9.52E-106 12Megakaryocyte progenitor cell severe IFITM3 0.887 0.435 2.776237624 0.72769409 1.128101758 9.66E-115 1.71E-110 10CD8+ T cell severe IFITM3 0.914 0.539 3.031331593 0.853794643 1.120775019 1.35E-119 2.38E-115 11CD4+ T cell severe IFITM3 1 1 56.74358974 17.65207877 1.63032437 1.59E-125 2.80E-121 21CD1C-CD141- dendritic cell severe IFITM3 0.939 0.61 3.349829352 1.147107438 1.01856442 1.35E-133 2.38E-129 7CD4+ T cell severe IFITM3 0.964 0.76 4.089977221 1.782033426 0.871519446 1.83E-138 3.22E-134 3Effector CD8+ memory T (Tem) cell severe IFITM3 1 0.775 4.323076923 1.086345382 1.351282408 1.30E-141 2.29E-137 18CD4+ T helper severe IFITM3 0.907 0.343 2.926027397 0.483833718 1.403740811 3.32E-152 5.86E-148 13CD141+CLEC9A+ dendritic cell severe IFITM3 0.995 0.837 8.15904936 2.676470588 1.316876422 1.24E-200 2.20E-196 4Effector CD8+ memory T (Tem) cell severe IFITM3 0.997 0.919 11.60127592 4.02238806 1.327124409 3.74E-221 6.61E-217 5Effector CD8+ memory T (Tem) cell severe IFITM3 0.897 0.529 2.73822563 0.805898123 1.049637141 9.84E-243 1.74E-238 2CD4+ T cell severe IFITM3 0.871 0.48 2.54005168 0.719571231 1.041721543 0 0 1Naive CD4+ T cell severe IFITM3 1 0.923 47.392 4.742324561 3.075061785 0 0 9CD1C+_B dendritic cell severe IFITM3 1 0.888 13.77 1.134533898 2.790676847 0 0 14Megakaryocyte progenitor cell severe IFITM3 1 0.872 40.97153025 3.341176471 3.273253089 0 0 15CD1C+_B dendritic cell severe IFITM3 0.935 0.211 2.935483871 0.210526316 1.700906585 0 0 46B cell severe IRF1 0.594 0.806 0.811594203 2.279069767 -0.85602677 8.16E-12 1.44E-07 35Effector CD8+ memory T (Tem) cell severe IRF2 0.363 0.138 1.061452514 0.235897436 0.738102206 4.75E-11 8.38E-07 27Megakaryocyte progenitor cell severe IRF2BP2 0.532 0.212 0.878205128 0.242888403 0.595657871 3.63E-25 6.41E-21 21CD1C-CD141- dendritic cell severe IRF7 0.909 0.308 2.818181818 0.4 1.447458977 2.11E-09 3.72E-05 39CD141+CLEC9A+ dendritic cell severe IRF7 0.871 0.211 2.129032258 0.236842105 1.339055194 1.04E-10 1.84E-06 46B cell severe IRF7 0.676 0.105 1 0.118421053 0.838536577 1.60E-12 2.83E-08 36CD8+ T cell severe IRF7 0.818 0.14 1.409090909 0.14953271 1.067441317 2.69E-13 4.75E-09 40CD8+ T cell severe IRF7 0.62 0.191 1.314814815 0.226086957 0.916835481 3.63E-16 6.41E-12 33Plasmacytoid dendritic cell severe IRF7 0.757 0.107 1.432432432 0.114285714 1.126280529 4.68E-19 8.27E-15 37CD8+ T cell severe IRF7 0.929 0.169 2.142857143 0.397590361 1.169135133 1.80E-22 3.17E-18 38Plasmacytoid dendritic cell severe IRF7 0.826 0.202 1.869565217 0.240310078 1.210131324 1.51E-22 2.66E-18 35Effector CD8+ memory T (Tem) cell severe IRF7 0.822 0.118 1.666666667 0.137254902 1.229481846 3.88E-25 6.85E-21 32Naive CD8+ T cell severe IRF7 0.714 0.092 1.214285714 0.099009901 1.010637005 1.71E-29 3.02E-25 29CD8+ T cell severe IRF7 0.633 0.095 1.322222222 0.103550296 1.073353652 4.54E-34 8.02E-30 26 T cell severe IRF7 0.797 0.065 1.231884058 0.085034014 1.040521815 9.12E-35 1.61E-30 28CD1C+_B dendritic cell severe IRF7 0.889 0.115 1.668341709 0.212389381 1.13809031 1.66E-43 2.93E-39 30CD1C-CD141- dendritic cell severe IRF7 0.675 0.067 1.3 0.075376884 1.096791495 5.27E-44 9.30E-40 20CD141+CLEC9A+ dendritic cell severe IRF7 0.797 0.081 1.533834586 0.086705202 1.221361722 1.01E-44 1.79E-40 31CD8 cytoxict cells severe IRF7 0.809 0.167 1.832369942 0.209150327 1.228016094 2.53E-54 4.47E-50 24T cell(Activated T cell) severe IRF7 0.725 0.092 1.490196078 0.094594595 1.185862708 2.56E-56 4.52E-52 25Megakaryocyte progenitor cell severe IRF7 0.695 0.082 1.4921875 0.088607595 1.194928607 1.58E-60 2.78E-56 22CD8+ T cell severe IRF7 0.923 0.44 2.974358974 0.606126915 1.307136289 1.57E-72 2.78E-68 21CD1C-CD141- dendritic cell severe IRF7 0.894 0.01 1.111731844 0.015384615 1.056400341 1.44E-79 2.53E-75 27Megakaryocyte progenitor cell severe IRF7 0.748 0.097 1.504854369 0.106705119 1.17845586 5.70E-85 1.00E-80 8Effector CD8+ memory T (Tem) cell severe IRF7 0.723 0.089 1.280851064 0.096721311 1.056375276 3.23E-88 5.70E-84 17CD4+ T cell severe IRF7 0.894 0.296 2.614906832 0.383012821 1.386143934 5.96E-89 1.05E-84 19CD141+CLEC9A+ dendritic cell severe IRF7 0.779 0.141 1.597864769 0.194771242 1.120591916 3.59E-94 6.33E-90 15CD1C+_B dendritic cell severe IRF7 0.746 0.087 1.463414634 0.09219191 1.173433103 1.87E-120 3.30E-116 12Megakaryocyte progenitor cell severe IRF7 0.715 0.094 1.35770235 0.113839286 1.081840512 1.29E-121 2.27E-117 11CD4+ T cell severe IRF7 0.83 0.09 1.860824742 0.108163265 1.36826067 5.00E-131 8.82E-127 16CD8+ T cell severe IRF7 0.85 0.336 1.856 0.423245614 1.004811326 1.02E-131 1.81E-127 9CD1C+_B dendritic cell severe IRF7 0.735 0.098 1.455445545 0.120509849 1.131829497 2.87E-147 5.06E-143 10CD8+ T cell severe IRF7 0.833 0.193 2.287671233 0.241339492 1.405168307 1.95E-149 3.44E-145 13CD141+CLEC9A+ dendritic cell severe IRF7 0.963 0.054 1.790769231 0.106425703 1.334756256 1.36E-179 2.40E-175 18CD4+ T helper severe IRF7 0.684 0.096 1.175767918 0.102479339 0.980773058 4.51E-183 7.96E-179 7CD4+ T cell severe IRF7 0.755 0.095 1.311363636 0.100961538 1.06998018 5.73E-211 1.01E-206 6CD8+ T cell severe IRF7 0.985 0.004 1.405 0.01059322 1.250834487 1.64E-213 2.90E-209 14Megakaryocyte progenitor cell severe IRF7 0.866 0.215 2.224880383 0.264925373 1.350193376 4.09E-253 7.21E-249 5Effector CD8+ memory T (Tem) cell severe IRF7 0.837 0.145 2.029250457 0.174632353 1.366751585 9.01E-261 1.59E-256 4Effector CD8+ memory T (Tem) cell severe IRF7 0.725 0.102 1.39211391 0.114745308 1.101571963 9.12E-298 1.61E-293 2CD4+ T cell severe IRF7 0.751 0.077 1.538724374 0.084958217 1.226464287 2.76E-299 4.86E-295 3Effector CD8+ memory T (Tem) cell severe IRF7 0.722 0.089 1.465977606 0.097510373 1.167925122 0 0 1Naive CD4+ T cell severe IRF7 0.713 0.096 1.271276596 0.095774648 1.051552277 0 0 23CD4+ T cell severe IRF7 0.743 0.111 1.285714286 0.111111111 1.040641984 0 0 41Naive CD8+ T cell severe IRF7 0.417 0.084 0.666666667 0.084337349 0.620151929 0 0 42Megakaryocyte progenitor cell severe IRF7 0.8 0.091 1.6 0.090909091 1.252980741 0 0 47AXL+SIGLEC6+ dendritic cell severe ISG15 1 0.167 2.545454545 0.208333333 1.552952106 3.83E-11 6.76E-07 39CD141+CLEC9A+ dendritic cell severe ISG15 0.8 0.266 5.2 0.35678392 2.192077239 2.63E-11 4.65E-07 34CD8 cytoxict cells severe ISG15 0.792 0.12 2.375 0.144578313 1.560071325 8.94E-13 1.58E-08 42Megakaryocyte progenitor cell severe ISG15 0.853 0.217 4.029411765 0.239130435 2.021061616 4.80E-16 8.47E-12 44CD8 cytoxict cells severe ISG15 0.857 0.111 2.342857143 0.133333333 1.560509457 3.57E-18 6.30E-14 41Naive CD8+ T cell severe ISG15 0.978 0.328 6.2 0.606557377 2.1640244 1.88E-18 3.31E-14 43Plasmacytoid dendritic cell severe ISG15 0.811 0.1 1.972972973 0.114285714 1.415787146 6.36E-20 1.12E-15 37CD8+ T cell severe ISG15 0.955 0.178 3.954545455 0.224299065 2.016796691 6.04E-20 1.07E-15 40CD8+ T cell severe ISG15 0.913 0.302 3.739130435 0.465116279 1.6936072 4.00E-27 7.05E-23 35Effector CD8+ memory T (Tem) cell severe ISG15 0.822 0.147 2.755555556 0.171568627 1.680584874 1.20E-29 2.12E-25 32Naive CD8+ T cell severe ISG15 0.971 0.06 3.7 0.084337349 2.115847092 1.33E-35 2.34E-31 38Plasmacytoid dendritic cell severe ISG15 0.917 0.374 4.583333333 0.52173913 1.875405629 4.42E-36 7.79E-32 33Plasmacytoid dendritic cell severe ISG15 0.971 0.068 3.507246377 0.095238095 2.04100178 9.86E-59 1.74E-54 28CD1C+_B dendritic cell severe ISG15 0.822 0.133 2.7 0.147928994 1.688491865 3.67E-60 6.48E-56 26 T cell severe ISG15 0.955 0.145 4.112781955 0.161849711 2.137685037 1.77E-70 3.12E-66 31CD8 cytoxict cells severe ISG15 0.995 0.071 3.422110553 0.150442478 1.942546242 1.14E-72 2.01E-68 30CD1C-CD141- dendritic cell severe ISG15 0.982 0.178 5.321428571 0.194719472 2.403578724 1.39E-74 2.46E-70 29CD8+ T cell severe ISG15 0.925 0.184 3.2875 0.22278057 1.809971139 3.09E-79 5.45E-75 20CD141+CLEC9A+ dendritic cell severe ISG15 0.955 0.005 2.145251397 0.005128205 1.645795804 1.83E-94 3.23E-90 27Megakaryocyte progenitor cell severe ISG15 0.87 0.157 2.925465839 0.200320513 1.70944418 1.52E-96 2.68E-92 19CD141+CLEC9A+ dendritic cell severe ISG15 0.91 0.11 3.106382979 0.129577465 1.862084974 5.37E-97 9.47E-93 23CD4+ T cell severe ISG15 0.961 0.232 4.911764706 0.267567568 2.221526198 1.60E-99 2.82E-95 25Megakaryocyte progenitor cell severe ISG15 0.988 0.356 7.658959538 0.565359477 2.467699678 2.30E-104 4.06E-100 24T cell(Activated T cell) severe ISG15 0.938 0.219 4.3828125 0.251054852 2.105215127 1.94E-119 3.42E-115 22CD8+ T cell severe ISG15 0.974 0.44 8.987179487 0.67833698 2.573044887 2.46E-136 4.34E-132 21CD1C-CD141- dendritic cell severe ISG15 0.877 0.13 3 0.145901639 1.803516787 2.93E-138 5.16E-134 17CD4+ T cell severe ISG15 0.957 0.132 4.341637011 0.215686275 2.135510973 3.98E-179 7.03E-175 15CD1C+_B dendritic cell severe ISG15 0.878 0.126 3.146341463 0.139228598 1.863781663 1.97E-179 3.48E-175 12Megakaryocyte progenitor cell severe ISG15 0.961 0.201 4.40776699 0.22999279 2.136383131 5.95E-185 1.05E-180 8Effector CD8+ memory T (Tem) cell severe ISG15 0.88 0.151 3.360313316 0.191964286 1.871090796 5.55E-193 9.79E-189 11CD4+ T cell severe ISG15 0.83 0.104 2.657534247 0.114318707 1.714709455 2.32E-193 4.09E-189 13CD141+CLEC9A+ dendritic cell severe ISG15 0.997 0.04 2.609230769 0.064257028 1.761844773 1.03E-206 1.81E-202 18CD4+ T helper severe ISG15 0.964 0.194 4.81443299 0.228571429 2.242656772 6.23E-207 1.10E-202 16CD8+ T cell severe ISG15 1 0.004 2.57 0.01059322 1.820721668 8.96E-222 1.58E-217 14Megakaryocyte progenitor cell severe ISG15 0.907 0.22 3.908910891 0.282734647 1.936180221 4.12E-236 7.27E-232 10CD8+ T cell severe ISG15 0.823 0.136 2.322727273 0.149725275 1.53107871 1.49E-261 2.63E-257 6CD8+ T cell severe ISG15 0.992 0.326 5.9 0.557017544 2.147811162 2.54E-290 4.49E-286 9CD1C+_B dendritic cell severe ISG15 0.825 0.107 2.277347115 0.116182573 1.553955455 0 0 1Naive CD4+ T cell severe ISG15 0.897 0.15 3.43483023 0.177479893 1.913176454 0 0 2CD4+ T cell severe ISG15 0.967 0.228 4.87357631 0.268802228 2.210771991 0 0 3Effector CD8+ memory T (Tem) cell severe ISG15 0.982 0.261 5.65630713 0.338848039 2.31372978 0 0 4Effector CD8+ memory T (Tem) cell severe ISG15 0.96 0.313 5.534290271 0.385820896 2.23728973 0 0 5Effector CD8+ memory T (Tem) cell severe ISG15 0.945 0.182 3.902730375 0.211570248 2.016707367 0 0 7CD4+ T cell severe ISG15 0.757 0.151 2.135135135 0.151315789 1.445244031 0 0 36CD8+ T cell severe ISG15 0.913 0.035 3 0.035087719 1.950246965 0 0 45Plasmacytoid dendritic cell severe ISG15 0.871 0.053 2.967741935 0.052631579 1.914317614 0 0 46B cell severe ISG15 1 0.136 6 0.136363636 2.622930351 0 0 47AXL+SIGLEC6+ dendritic cell severe ISG20 1 0.432 3.8 0.577889447 1.605038277 3.41E-09 6.02E-05 34CD8 cytoxict cells severe ISG20 0.857 0.433 1.828571429 0.544444444 0.872985627 2.05E-10 3.61E-06 41Naive CD8+ T cell severe ISG20 0.911 0.431 1.8 0.612745098 0.795908395 1.23E-11 2.17E-07 32Naive CD8+ T cell severe ISG20 0.955 0.514 2.409090909 0.682242991 1.019000962 1.78E-12 3.13E-08 40CD8+ T cell severe ISG20 0.87 0.512 2.753623188 0.744186047 1.105729895 4.44E-19 7.83E-15 35Effector CD8+ memory T (Tem) cell severe ISG20 0.87 0.272 1.52173913 0.455782313 0.792624398 6.47E-20 1.14E-15 28CD1C+_B dendritic cell severe ISG20 0.986 0.289 2 0.56626506 0.937634119 2.36E-21 4.17E-17 38Plasmacytoid dendritic cell severe ISG20 0.857 0.475 2.678571429 0.689768977 1.122319589 7.49E-26 1.32E-21 29CD8+ T cell severe ISG20 0.902 0.451 2.984962406 0.774566474 1.167099496 1.27E-26 2.23E-22 31CD8 cytoxict cells severe ISG20 0.811 0.459 2 0.624260355 0.885179598 6.72E-27 1.19E-22 26 T cell severe ISG20 0.856 0.493 2.14893617 0.729577465 0.864444883 5.06E-35 8.93E-31 23CD4+ T cell severe ISG20 0.925 0.461 2.675 0.668341709 1.139329439 8.61E-41 1.52E-36 20CD141+CLEC9A+ dendritic cell severe ISG20 0.95 0.716 3.714285714 1.463141026 0.936539966 4.21E-41 7.43E-37 19CD141+CLEC9A+ dendritic cell severe ISG20 0.894 0.106 1.236180905 0.123893805 0.992531181 3.62E-46 6.39E-42 30CD1C-CD141- dendritic cell severe ISG20 0.912 0.443 2.774509804 0.613513514 1.226083633 2.86E-48 5.05E-44 25Megakaryocyte progenitor cell severe ISG20 0.922 0.473 2.708737864 0.735400144 1.095659947 1.56E-53 2.75E-49 8Effector CD8+ memory T (Tem) cell severe ISG20 0.796 0.515 2.063829787 0.719672131 0.83320262 2.54E-56 4.48E-52 17CD4+ T cell severe ISG20 0.977 0.683 5.248554913 1.349673203 1.411062462 5.88E-60 1.04E-55 24T cell(Activated T cell) severe ISG20 0.914 0.468 3.2890625 0.70464135 1.331194105 6.28E-62 1.11E-57 22CD8+ T cell severe ISG20 0.785 0.47 1.965853659 0.651928504 0.844296166 1.12E-64 1.98E-60 12Megakaryocyte progenitor cell severe ISG20 0.916 0.087 1.022346369 0.102564103 0.875167574 7.81E-65 1.38E-60 27Megakaryocyte progenitor cell severe ISG20 0.58 0.085 1.024911032 0.107189542 0.8709563 1.59E-65 2.81E-61 15CD1C+_B dendritic cell severe ISG20 0.464 0.059 0.81 0.065789474 0.764067208 8.16E-83 1.44E-78 9CD1C+_B dendritic cell severe ISG20 0.905 0.484 2.757731959 0.730612245 1.118579647 8.81E-85 1.55E-80 16CD8+ T cell severe ISG20 0.932 0.674 3.871232877 1.400692841 1.020836127 7.77E-85 1.37E-80 13CD141+CLEC9A+ dendritic cell severe ISG20 0.825 0.481 2.146214099 0.690848214 0.895869693 1.44E-85 2.54E-81 11CD4+ T cell severe ISG20 0.853 0.088 2.256410256 0.098468271 1.567789269 2.91E-89 5.13E-85 21CD1C-CD141- dendritic cell severe ISG20 0.923 0.599 3.421782178 1.074159907 1.092100835 1.44E-113 2.53E-109 10CD8+ T cell severe ISG20 0.875 0.512 2.059090909 0.706730769 0.841867485 2.47E-126 4.36E-122 6CD8+ T cell severe ISG20 0.994 0.191 1.566153846 0.337349398 0.940231231 3.15E-141 5.55E-137 18CD4+ T helper severe ISG20 0.99 0.044 1.185 0.0625 1.040170438 1.94E-176 3.43E-172 14Megakaryocyte progenitor cell severe ISG20 0.904 0.524 2.558020478 0.737190083 1.034319192 1.29E-177 2.28E-173 7CD4+ T cell severe ISG20 0.92 0.52 3.195612431 0.851715686 1.180018812 6.21E-183 1.10E-178 4Effector CD8+ memory T (Tem) cell severe ISG20 0.898 0.542 3.208931419 0.869402985 1.1708764 8.39E-184 1.48E-179 5Effector CD8+ memory T (Tem) cell severe ISG20 0.737 0.436 1.522825151 0.5802213 0.674913608 1.57E-189 2.77E-185 1Naive CD4+ T cell severe ISG20 0.864 0.513 2.412924425 0.738873995 0.972855075 1.15E-230 2.03E-226 2CD4+ T cell severe ISG20 0.878 0.429 2.627562642 0.619777159 1.16320518 4.20E-233 7.42E-229 3Effector CD8+ memory T (Tem) cell severe ISG20 0.545 0.058 1.454545455 0.058333333 1.213661792 0 0 39CD141+CLEC9A+ dendritic cell severe ISG20 0.826 0.193 1.913043478 0.192982456 1.287954407 0 0 45Plasmacytoid dendritic cell severe MT2A 0.8 0.25 6 0.272727273 2.459431619 5.48E-09 9.67E-05 47AXL+SIGLEC6+ dendritic cell severe MT2A 0.686 0.2 2.057142857 0.244444444 1.296682144 2.89E-12 5.10E-08 41Naive CD8+ T cell severe MT2A 0.909 0.28 2.227272727 0.373831776 1.232110142 7.98E-13 1.41E-08 40CD8+ T cell severe MT2A 0.644 0.216 1.955555556 0.308823529 1.175158749 5.93E-13 1.05E-08 32Naive CD8+ T cell severe MT2A 0.902 0.561 4.187969925 1.716763006 0.933281397 6.64E-16 1.17E-11 31CD8 cytoxict cells severe MT2A 0.865 0.293 2.432432432 0.4 1.293804494 6.62E-16 1.17E-11 37CD8+ T cell severe MT2A 0.744 0.293 2.111111111 0.461538462 1.089942125 4.70E-21 8.29E-17 26 T cell severe MT2A 0.893 0.561 4.232142857 1.01980198 1.373188073 2.13E-25 3.76E-21 29CD8+ T cell severe MT2A 0.453 0.138 0.782608696 0.166666667 0.611597627 1.08E-25 1.90E-21 19CD141+CLEC9A+ dendritic cell severe MT2A 0.855 0.238 3.507246377 0.56122449 1.529568315 6.63E-26 1.17E-21 28CD1C+_B dendritic cell severe MT2A 0.745 0.338 2.132978723 0.58028169 0.987353226 8.48E-27 1.50E-22 23CD4+ T cell severe MT2A 0.9 0.012 1.157142857 0.012048193 1.091843731 4.46E-32 7.88E-28 38Plasmacytoid dendritic cell severe MT2A 0.898 0.542 3.703125 1.158227848 1.123772496 4.37E-33 7.71E-29 22CD8+ T cell severe MT2A 0.728 0.313 2.234042553 0.537704918 1.072559982 9.36E-42 1.65E-37 17CD4+ T cell severe MT2A 0.902 0.535 4.343137255 0.937837838 1.46323923 1.38E-42 2.43E-38 25Megakaryocyte progenitor cell severe MT2A 0.981 0.751 10.25 3.284463895 1.392738402 2.97E-43 5.25E-39 21CD1C-CD141- dendritic cell severe MT2A 0.925 0.529 5.005780347 1.124183007 1.499443646 7.57E-44 1.34E-39 24T cell(Activated T cell) severe MT2A 0.95 0.142 1.763819095 0.274336283 1.116917149 3.05E-50 5.38E-46 30CD1C-CD141- dendritic cell severe MT2A 0.893 0.518 4.339805825 1.028839221 1.39613274 1.52E-54 2.68E-50 8Effector CD8+ memory T (Tem) cell severe MT2A 0.933 0.588 4.206185567 1.2 1.242723212 2.60E-75 4.58E-71 16CD8+ T cell severe MT2A 0.761 0.275 2.32195122 0.395108184 1.251653888 1.46E-76 2.58E-72 12Megakaryocyte progenitor cell severe MT2A 0.901 0.523 4.324752475 1.435689455 1.128384257 5.70E-77 1.01E-72 10CD8+ T cell severe MT2A 0.762 0.306 2.313315927 0.496651786 1.146537172 1.73E-79 3.04E-75 11CD4+ T cell severe MT2A 0.916 0.026 1.217877095 0.066666667 1.056070015 8.62E-82 1.52E-77 27Megakaryocyte progenitor cell severe MT2A 0.944 0.637 6.184 1.980263158 1.269347623 5.12E-95 9.04E-91 9CD1C+_B dendritic cell severe MT2A 0.943 0.371 5.441281139 0.956862745 1.718805093 1.78E-100 3.14E-96 15CD1C+_B dendritic cell severe MT2A 0.817 0.334 2.749146758 0.665289256 1.170789509 3.11E-113 5.49E-109 7CD4+ T cell severe MT2A 0.848 0.451 3.511961722 0.870895522 1.270025833 7.89E-133 1.39E-128 5Effector CD8+ memory T (Tem) cell severe MT2A 0.827 0.353 2.111363636 0.488324176 1.06385822 5.53E-139 9.77E-135 6CD8+ T cell severe MT2A 0.901 0.539 4.57952468 1.198529412 1.343603391 4.58E-149 8.08E-145 4Effector CD8+ memory T (Tem) cell severe MT2A 0.991 0.106 1.723076923 0.263052209 1.108323462 1.93E-169 3.40E-165 18CD4+ T helper severe MT2A 0.995 0.02 1.72 0.05190678 1.370599793 1.30E-202 2.29E-198 14Megakaryocyte progenitor cell severe MT2A 0.903 0.519 4.123006834 1.002089136 1.355484609 1.01E-207 1.79E-203 3Effector CD8+ memory T (Tem) cell severe MT2A 0.806 0.343 2.682365827 0.541018767 1.256748528 6.06E-224 1.07E-219 2CD4+ T cell severe MT2A 0.657 0.257 1.622739018 0.343706777 0.964855907 4.94E-242 8.71E-238 1Naive CD4+ T cell severe MX1 0.75 0.133 1.875 0.168674699 1.298688545 3.08E-09 5.44E-05 42Megakaryocyte progenitor cell severe MX1 1 0.509 4.217391304 1.01754386 1.370728603 1.34E-09 2.37E-05 45Plasmacytoid dendritic cell severe MX1 1 0.208 3.909090909 0.391666667 1.818642187 5.03E-10 8.87E-06 39CD141+CLEC9A+ dendritic cell severe MX1 0.968 0.132 2.548387097 0.157894737 1.615659298 1.14E-14 2.02E-10 46B cell severe MX1 0.757 0.125 1.567567568 0.144736842 1.16538626 2.01E-17 3.55E-13 36CD8+ T cell severe MX1 0.971 0.109 3.529411765 0.130434783 2.002445937 5.03E-18 8.88E-14 44CD8 cytoxict cells severe MX1 1 0.084 2.454545455 0.093457944 1.659598162 1.52E-21 2.68E-17 40CD8+ T cell severe MX1 0.986 0.205 3.157142857 0.554216867 1.419404502 2.50E-26 4.42E-22 38Plasmacytoid dendritic cell severe MX1 0.911 0.088 2.733333333 0.117647059 1.739999654 1.01E-30 1.78E-26 32Naive CD8+ T cell severe MX1 0.899 0.101 2.637681159 0.131782946 1.684421794 1.27E-33 2.23E-29 35Effector CD8+ memory T (Tem) cell severe MX1 0.907 0.157 3.638888889 0.234782609 1.909522222 2.06E-36 3.63E-32 33Plasmacytoid dendritic cell severe MX1 0.946 0.059 3.053571429 0.066006601 1.926977194 1.88E-54 3.31E-50 29CD8+ T cell severe MX1 0.971 0.048 2.637681159 0.071428571 1.763483424 1.89E-57 3.34E-53 28CD1C+_B dendritic cell severe MX1 0.844 0.115 2.744444444 0.133136095 1.724430539 5.63E-59 9.93E-55 26 T cell severe MX1 0.838 0.077 2.2875 0.092127303 1.589849861 6.74E-62 1.19E-57 20CD141+CLEC9A+ dendritic cell severe MX1 1 0.062 3.376884422 0.123893805 1.961398564 2.67E-76 4.71E-72 30CD1C-CD141- dendritic cell severe MX1 0.954 0.206 5.092485549 0.352941176 2.170931809 1.42E-84 2.50E-80 24T cell(Activated T cell) severe MX1 0.919 0.296 3.48447205 0.461538462 1.617450353 5.03E-86 8.88E-82 19CD141+CLEC9A+ dendritic cell severe MX1 0.867 0.107 2.606382979 0.126760563 1.678371636 2.02E-87 3.57E-83 23CD4+ T cell severe MX1 0.933 0.01 1.776536313 0.015384615 1.451259958 1.59E-87 2.81E-83 27Megakaryocyte progenitor cell severe MX1 0.962 0.204 4.301282051 0.332603939 1.992093237 6.29E-93 1.11E-88 21CD1C-CD141- dendritic cell severe MX1 0.891 0.063 2.921875 0.071729958 1.871602116 2.19E-94 3.87E-90 22CD8+ T cell severe MX1 0.913 0.046 2.640776699 0.054794521 1.787284276 2.66E-113 4.69E-109 8Effector CD8+ memory T (Tem) cell severe MX1 0.855 0.093 2.574468085 0.103278689 1.695931309 2.46E-129 4.34E-125 17CD4+ T cell severe MX1 0.839 0.092 2.351219512 0.106302916 1.598939726 8.53E-143 1.50E-138 12Megakaryocyte progenitor cell severe MX1 0.828 0.124 2.582245431 0.183035714 1.598370557 1.32E-154 2.33E-150 11CD4+ T cell severe MX1 0.954 0.127 3.992882562 0.247058824 2.001343455 1.09E-165 1.92E-161 15CD1C+_B dendritic cell severe MX1 0.907 0.043 2.695876289 0.051020408 1.814125783 9.33E-180 1.65E-175 16CD8+ T cell severe MX1 0.907 0.193 3.065753425 0.252886836 1.69826661 1.67E-188 2.94E-184 13CD141+CLEC9A+ dendritic cell severe MX1 0.997 0.062 3.313846154 0.138554217 1.921771733 1.99E-194 3.50E-190 18CD4+ T helper severe MX1 0.995 0.001 2.17 0.001059322 1.662955371 3.02E-223 5.32E-219 14Megakaryocyte progenitor cell severe MX1 0.834 0.111 2.075 0.128434066 1.446264286 1.02E-235 1.80E-231 6CD8+ T cell severe MX1 0.978 0.227 4.08 0.42872807 1.830097143 9.65E-239 1.70E-234 9CD1C+_B dendritic cell severe MX1 0.893 0.101 3.106930693 0.118192352 1.876892218 2.29E-250 4.03E-246 10CD8+ T cell severe MX1 0.842 0.098 2.300602929 0.113070539 1.568184564 0 0 1Naive CD4+ T cell severe MX1 0.903 0.117 2.9550931 0.136193029 1.799503698 0 0 2CD4+ T cell severe MX1 0.917 0.036 2.822323462 0.04178273 1.875395445 0 0 3Effector CD8+ memory T (Tem) cell severe MX1 0.903 0.05 2.97440585 0.066789216 1.897464057 0 0 4Effector CD8+ memory T (Tem) cell severe MX1 0.888 0.08 3.118022329 0.105223881 1.897613013 0 0 5Effector CD8+ memory T (Tem) cell severe MX1 0.884 0.115 2.703071672 0.123966942 1.720122869 0 0 7CD4+ T cell severe MX1 0.902 0.035 2.931372549 0.035135135 1.925213963 0 0 25Megakaryocyte progenitor cell severe MX1 0.895 0.035 3.210526316 0.034682081 2.024813032 0 0 31CD8 cytoxict cells severe MX1 0.892 0.093 2.162162162 0.092857143 1.532806528 0 0 37CD8+ T cell severe MX1 0.857 0.122 2.228571429 0.122222222 1.524537559 0 0 41Naive CD8+ T cell severe MX2 0.417 0.124 1.226130653 0.256637168 0.824970111 5.49E-09 9.68E-05 30CD1C-CD141- dendritic cell severe MX2 0.406 0.058 0.869565217 0.078231293 0.794036113 7.15E-13 1.26E-08 28CD1C+_B dendritic cell severe MX2 0.429 0.046 0.642857143 0.04950495 0.646498062 4.13E-15 7.29E-11 29CD8+ T cell severe MX2 0.237 0.054 0.661538462 0.098393574 0.597124598 4.58E-19 8.08E-15 18CD4+ T helper severe MX2 0.412 0.035 0.588235294 0.037837838 0.613843621 6.23E-22 1.10E-17 25Megakaryocyte progenitor cell severe MX2 0.475 0.06 0.6875 0.063651591 0.665861842 2.29E-27 4.04E-23 20CD141+CLEC9A+ dendritic cell severe MX2 0.522 0.119 0.850931677 0.137820513 0.701978647 2.04E-32 3.60E-28 19CD141+CLEC9A+ dendritic cell severe MX2 0.659 0.134 1.179190751 0.156862745 0.913574778 3.44E-38 6.06E-34 24T cell(Activated T cell) severe MX2 0.428 0.059 0.628865979 0.067346939 0.609838709 3.97E-42 7.01E-38 16CD8+ T cell severe MX2 0.548 0.085 0.803191489 0.087323944 0.729770789 2.69E-42 4.74E-38 23CD4+ T cell severe MX2 0.731 0.337 1.538461538 0.402625821 0.85582421 7.04E-45 1.24E-40 21CD1C-CD141- dendritic cell severe MX2 0.605 0.14 1.177935943 0.203921569 0.855220114 1.38E-51 2.43E-47 15CD1C+_B dendritic cell severe MX2 0.486 0.122 0.759791123 0.142857143 0.622759121 4.14E-53 7.30E-49 11CD4+ T cell severe MX2 0.553 0.093 0.90212766 0.1 0.790110551 6.75E-60 1.19E-55 17CD4+ T cell severe MX2 0.477 0.08 0.871232877 0.092378753 0.776515956 6.04E-64 1.07E-59 13CD141+CLEC9A+ dendritic cell severe MX2 0.507 0.087 0.775609756 0.090310442 0.703575571 1.71E-69 3.01E-65 12Megakaryocyte progenitor cell severe MX2 0.471 0.088 0.784158416 0.092699884 0.707346507 5.20E-87 9.18E-83 10CD8+ T cell severe MX2 0.746 0.266 1.42 0.327850877 0.865913912 3.69E-100 6.51E-96 9CD1C+_B dendritic cell severe MX2 0.441 0.045 0.692870201 0.050245098 0.688745308 6.27E-111 1.11E-106 4Effector CD8+ memory T (Tem) cell severe MX2 0.408 0.045 0.63667426 0.050139276 0.640186537 9.59E-120 1.69E-115 3Effector CD8+ memory T (Tem) cell severe MX2 0.567 0.091 0.836177474 0.099173554 0.74028631 3.77E-122 6.65E-118 7CD4+ T cell severe MX2 0.459 0.046 0.722488038 0.047014925 0.718211956 2.87E-132 5.06E-128 5Effector CD8+ memory T (Tem) cell severe MX2 0.554 0.108 0.927710843 0.117426273 0.786709016 1.19E-187 2.10E-183 2CD4+ T cell severe MX2 0.499 0.098 0.738156761 0.109266943 0.647951613 1.25E-200 2.21E-196 1Naive CD4+ T cell severe MX2 0.484 0.04 0.796875 0.040084388 0.788789463 0 0 22CD8+ T cell severe MX2 0.556 0.127 0.844444444 0.127218935 0.710418584 0 0 26 T cell severe MX2 0.526 0.058 0.834586466 0.057803468 0.794383291 0 0 31CD8 cytoxict cells severe MX2 0.4 0.02 1.2 0.020100503 1.108792227 0 0 34CD8 cytoxict cells severe MX2 0.419 0.053 0.580645161 0.052631579 0.586512952 0 0 46B cell severe OAS1 0.429 0 0.742857143 0 0.801454321 1.56E-09 2.76E-05 41Naive CD8+ T cell severe OAS1 0.432 0.014 0.567567568 0.021428571 0.61793931 1.07E-09 1.89E-05 37CD8+ T cell severe OAS1 0.667 0 1.166666667 0 1.115477217 6.71E-13 1.18E-08 42Megakaryocyte progenitor cell severe OAS1 0.757 0.12 1.057142857 0.240963855 0.729180889 5.92E-16 1.04E-11 38Plasmacytoid dendritic cell severe OAS1 0.71 0.07 1.275362319 0.07751938 1.078382475 2.08E-22 3.66E-18 35Effector CD8+ memory T (Tem) cell severe OAS1 0.668 0.097 0.929648241 0.14159292 0.757289587 7.30E-23 1.29E-18 30CD1C-CD141- dendritic cell severe OAS1 0.633 0.03 1.177777778 0.035502959 1.072525072 1.05E-36 1.85E-32 26 T cell severe OAS1 0.727 0.221 1.50310559 0.315705128 0.927882957 1.02E-38 1.80E-34 19CD141+CLEC9A+ dendritic cell severe OAS1 0.575 0.028 1.15 0.031825796 1.05913724 2.11E-39 3.72E-35 20CD141+CLEC9A+ dendritic cell severe OAS1 0.681 0.003 1.014492754 0.010204082 0.99576984 1.06E-39 1.87E-35 28CD1C+_B dendritic cell severe OAS1 0.704 0.005 0.720670391 0.005128205 0.775591233 1.32E-52 2.32E-48 27Megakaryocyte progenitor cell severe OAS1 0.633 0.141 1.199288256 0.197385621 0.877148857 2.78E-58 4.91E-54 15CD1C+_B dendritic cell severe OAS1 0.68 0.039 1.291262136 0.041816871 1.137040817 7.22E-76 1.27E-71 8Effector CD8+ memory T (Tem) cell severe OAS1 0.867 0.101 2.791907514 0.12745098 1.749859068 2.51E-76 4.44E-72 24T cell(Activated T cell) severe OAS1 0.668 0.118 1.383561644 0.147806005 1.05424011 1.02E-98 1.80E-94 13CD141+CLEC9A+ dendritic cell severe OAS1 0.706 0.028 1.276595745 0.029508197 1.144922818 1.63E-103 2.87E-99 17CD4+ T cell severe OAS1 0.673 0.047 1.262886598 0.048979592 1.109177677 3.04E-105 5.37E-101 16CD8+ T cell severe OAS1 0.86 0.338 1.786 0.432017544 0.960146091 2.31E-124 4.08E-120 9CD1C+_B dendritic cell severe OAS1 0.477 0.017 0.645454545 0.017857143 0.692951081 1.58E-128 2.78E-124 6CD8+ T cell severe OAS1 0.661 0.03 1.18537859 0.045758929 1.063332915 9.20E-133 1.62E-128 11CD4+ T cell severe OAS1 0.651 0.057 1.324752475 0.06373117 1.127943521 2.16E-141 3.82E-137 10CD8+ T cell severe OAS1 0.846 0.008 1.166153846 0.014056225 1.094998065 3.59E-158 6.34E-154 18CD4+ T helper severe OAS1 0.94 0.005 1.01 0.012711864 0.988971743 6.17E-204 1.09E-199 14Megakaryocyte progenitor cell severe OAS1 0.683 0.034 1.26109215 0.038842975 1.122042188 1.19E-206 2.10E-202 7CD4+ T cell severe OAS1 0.676 0.062 1.524680073 0.071078431 1.237036454 1.96E-214 3.45E-210 4Effector CD8+ memory T (Tem) cell severe OAS1 0.74 0.069 1.529505582 0.078358209 1.230018931 6.56E-237 1.16E-232 5Effector CD8+ memory T (Tem) cell severe OAS1 0.7 0.045 1.390660592 0.046657382 1.191620062 1.27E-302 2.23E-298 3Effector CD8+ memory T (Tem) cell severe OAS1 0.583 0.018 0.968992248 0.021438451 0.946855158 0 0 1Naive CD4+ T cell severe OAS1 0.696 0.034 1.354874042 0.039678284 1.179512722 0 0 2CD4+ T cell severe OAS1 0.624 0.018 1.102439024 0.017873942 1.046505057 0 0 12Megakaryocyte progenitor cell severe OAS1 0.625 0.034 1.171875 0.033755274 1.071046383 0 0 22CD8+ T cell severe OAS1 0.686 0.028 1.29787234 0.028169014 1.160221211 0 0 23CD4+ T cell severe OAS1 0.657 0.049 1.294117647 0.048648649 1.129407996 0 0 25Megakaryocyte progenitor cell severe OAS1 0.625 0.036 1.589285714 0.03630363 1.321107403 0 0 29CD8+ T cell severe OAS1 0.714 0.04 1.526315789 0.040462428 1.279810119 0 0 31CD8 cytoxict cells severe OAS1 0.6 0.029 0.888888889 0.029411765 0.875717664 0 0 32Naive CD8+ T cell severe OAS1 0.541 0.013 0.756756757 0.013157895 0.79405542 0 0 36CD8+ T cell severe OAS1 0.773 0.019 1.227272727 0.018691589 1.128560887 0 0 40CD8+ T cell severe OAS1 0.71 0.053 1.064516129 0.052631579 0.971803108 0 0 46B cell severe OAS2 0.48 0.073 0.62745098 0.078378378 0.593750614 9.39E-22 1.66E-17 25Megakaryocyte progenitor cell severe OAS2 0.518 0.109 0.839285714 0.112211221 0.725714807 3.27E-24 5.77E-20 29CD8+ T cell severe OAS2 0.532 0.131 0.838150289 0.147058824 0.68031535 1.88E-26 3.32E-22 24T cell(Activated T cell) severe OAS2 0.427 0.055 0.612099644 0.070588235 0.590537216 1.17E-42 2.07E-38 15CD1C+_B dendritic cell severe OAS2 0.618 0.178 0.932 0.198464912 0.688907423 3.70E-84 6.52E-80 9CD1C+_B dendritic cell severe OAS2 0.6 0.068 1 0.068181818 0.904842767 0 0 47AXL+SIGLEC6+ dendritic cell severe OAS3 0.459 0 0.567567568 0 0.648527629 3.74E-13 6.60E-09 37CD8+ T cell severe OAS3 0.564 0.155 0.961538462 0.177242888 0.736573616 7.99E-31 1.41E-26 21CD1C-CD141- dendritic cell severe OAS3 0.402 0.026 0.56227758 0.036601307 0.591789691 9.36E-51 1.65E-46 15CD1C+_B dendritic cell severe OAS3 0.654 0.13 1.022 0.149122807 0.81525001 3.90E-103 6.88E-99 9CD1C+_B dendritic cell severe OAS3 0.4 0.03 0.8 0.030150754 0.805141428 0 0 34CD8 cytoxict cells severe OAS3 0.318 0.019 0.590909091 0.018691589 0.64313406 0 0 40CD8+ T cell severe OASL 0.589 0.125 0.964285714 0.138613861 0.786726223 1.81E-17 3.19E-13 29CD8+ T cell severe OASL 0.496 0.081 0.729323308 0.086705202 0.670246991 1.20E-18 2.12E-14 31CD8 cytoxict cells severe OASL 0.52 0.089 0.81372549 0.1 0.721452595 1.62E-22 2.86E-18 25Megakaryocyte progenitor cell severe OASL 0.601 0.052 0.965317919 0.078431373 0.865828337 2.44E-39 4.31E-35 24T cell(Activated T cell) severe OASL 0.446 0.043 0.662371134 0.046938776 0.667065432 2.85E-52 5.04E-48 16CD8+ T cell severe OASL 0.473 0.035 0.758007117 0.044444444 0.751205156 1.78E-60 3.14E-56 15CD1C+_B dendritic cell severe OASL 0.516 0.15 0.811700183 0.193627451 0.601991604 9.45E-67 1.67E-62 4Effector CD8+ memory T (Tem) cell severe OASL 0.483 0.059 0.736842105 0.074626866 0.692630795 1.08E-103 1.90E-99 5Effector CD8+ memory T (Tem) cell severe OASL 0.547 0.146 0.839407745 0.171309192 0.651119364 1.10E-109 1.94E-105 3Effector CD8+ memory T (Tem) cell severe OASL 0.62 0.065 0.908 0.077850877 0.823903579 6.81E-116 1.20E-111 9CD1C+_B dendritic cell severe OASL 0.705 0.081 1.435897436 0.080962801 1.172136513 0 0 21CD1C-CD141- dendritic cell severe PLSCR1 0.638 0.186 1.173913043 0.240310078 0.809593394 5.31E-11 9.37E-07 35Effector CD8+ memory T (Tem) cell severe PLSCR1 0.377 0.034 0.695652174 0.040816327 0.704124765 3.95E-14 6.98E-10 28CD1C+_B dendritic cell severe PLSCR1 0.318 0.01 0.675977654 0.015384615 0.722976607 2.07E-17 3.65E-13 27Megakaryocyte progenitor cell severe PLSCR1 0.586 0.075 0.992481203 0.092485549 0.866951917 8.18E-23 1.44E-18 31CD8 cytoxict cells severe PLSCR1 0.769 0.243 1.592592593 0.27826087 1.020213221 3.35E-23 5.90E-19 33Plasmacytoid dendritic cell severe PLSCR1 0.393 0.085 0.734104046 0.091503268 0.667874013 3.49E-24 6.16E-20 24T cell(Activated T cell) severe PLSCR1 0.539 0.076 0.901960784 0.086486486 0.80781727 5.98E-26 1.06E-21 25Megakaryocyte progenitor cell severe PLSCR1 0.528 0.131 0.838509317 0.147435897 0.680122929 1.57E-34 2.77E-30 19CD141+CLEC9A+ dendritic cell severe PLSCR1 0.648 0.256 1.295373665 0.383006536 0.730921056 1.22E-36 2.15E-32 15CD1C+_B dendritic cell severe PLSCR1 0.379 0.036 0.612765957 0.039344262 0.633863494 1.08E-39 1.90E-35 17CD4+ T cell severe PLSCR1 0.5 0.087 0.8625 0.088777219 0.774531639 4.28E-44 7.55E-40 20CD141+CLEC9A+ dendritic cell severe PLSCR1 0.415 0.045 0.653658537 0.04985889 0.655465933 9.45E-50 1.67E-45 12Megakaryocyte progenitor cell severe PLSCR1 0.515 0.096 1.058252427 0.107426099 0.894209499 1.46E-50 2.58E-46 8Effector CD8+ memory T (Tem) cell severe PLSCR1 0.769 0.309 1.961538462 0.396061269 1.084984564 1.44E-51 2.54E-47 21CD1C-CD141- dendritic cell severe PLSCR1 0.38 0.01 0.645 0.021186441 0.687841297 1.45E-54 2.57E-50 14Megakaryocyte progenitor cell severe PLSCR1 0.828 0.501 1.656 0.697368421 0.645955405 2.38E-64 4.20E-60 9CD1C+_B dendritic cell severe PLSCR1 0.572 0.08 0.907216495 0.089795918 0.807410626 9.96E-66 1.76E-61 16CD8+ T cell severe PLSCR1 0.444 0.039 0.652741514 0.042410714 0.66493729 1.07E-73 1.89E-69 11CD4+ T cell severe PLSCR1 0.43 0.054 0.593181818 0.055631868 0.593804111 2.32E-102 4.10E-98 6CD8+ T cell severe PLSCR1 0.595 0.083 1.112328767 0.08891455 0.95594365 8.10E-104 1.43E-99 13CD141+CLEC9A+ dendritic cell severe PLSCR1 0.541 0.088 0.976237624 0.092699884 0.854859216 6.78E-109 1.20E-104 10CD8+ T cell severe PLSCR1 0.436 0.056 0.709748083 0.05844504 0.691837413 1.58E-171 2.79E-167 2CD4+ T cell severe PLSCR1 0.525 0.061 0.928246014 0.066852368 0.85392858 1.35E-172 2.39E-168 3Effector CD8+ memory T (Tem) cell severe PLSCR1 0.618 0.075 1.265082267 0.087622549 1.058385482 1.42E-173 2.51E-169 4Effector CD8+ memory T (Tem) cell severe PLSCR1 0.716 0.144 1.488038278 0.168656716 1.090157469 2.96E-189 5.21E-185 5Effector CD8+ memory T (Tem) cell severe PLSCR1 0.539 0.07 0.859375 0.069620253 0.797719075 0 0 22CD8+ T cell severe PLSCR1 0.5 0.036 0.892857143 0.03630363 0.869118767 0 0 29CD8+ T cell severe PLSCR1 0.568 0.057 0.837837838 0.057142857 0.797839127 0 0 37CD8+ T cell severe PLSCR1 0.545 0.019 0.954545455 0.018691589 0.940115798 0 0 40CD8+ T cell severe PLSCR1 0.457 0.078 0.685714286 0.077777778 0.645300287 0 0 41Naive CD8+ T cell severe PLSCR1 0.471 0.065 0.911764706 0.065217391 0.843757084 0 0 44CD8 cytoxict cells severe PLSCR1 0.522 0.246 0.869565217 0.245614035 0.585845693 0 0 45Plasmacytoid dendritic cell severe RSAD2 0.335 0.005 0.905027933 0.01025641 0.915090646 2.62E-19 4.62E-15 27Megakaryocyte progenitor cell severe RSAD2 0.425 0.018 0.6375 0.021775544 0.680416595 8.39E-25 1.48E-20 20CD141+CLEC9A+ dendritic cell severe RSAD2 0.387 0.016 0.612716763 0.029411765 0.647672908 1.19E-26 2.10E-22 24T cell(Activated T cell) severe RSAD2 0.235 0.001 0.71 0.003177966 0.769418759 7.16E-35 1.26E-30 14Megakaryocyte progenitor cell severe RSAD2 0.41 0.044 0.833333333 0.04595186 0.809652665 2.33E-35 4.10E-31 21CD1C-CD141- dendritic cell severe RSAD2 0.41 0.012 0.574742268 0.016326531 0.631751735 7.15E-56 1.26E-51 16CD8+ T cell severe RSAD2 0.423 0.017 0.639553429 0.018656716 0.686634966 2.21E-125 3.91E-121 5Effector CD8+ memory T (Tem) cell severe RSAD2 0.393 0.012 0.654478976 0.012254902 0.70880433 3.13E-126 5.52E-122 4Effector CD8+ memory T (Tem) cell severe RSAD2 0.419 0.006 0.617312073 0.006963788 0.683586282 8.06E-165 1.42E-160 3Effector CD8+ memory T (Tem) cell severe RSAD2 0.353 0.005 0.617647059 0.005405405 0.686119522 0 0 25Megakaryocyte progenitor cell severe RSAD2 0.393 0.007 0.535714286 0.00660066 0.609418384 0 0 29CD8+ T cell severe RSAD2 0.216 0.027 0.56281407 0.026548673 0.606344117 0 0 30CD1C-CD141- dendritic cell severe RSAD2 0.398 0.012 0.62406015 0.011560694 0.683022182 0 0 31CD8 cytoxict cells severe RSAD2 0.315 0.017 0.527777778 0.017391304 0.586560043 0 0 33Plasmacytoid dendritic cell severe SAMD9L 0.526 0.139 0.804511278 0.156069364 0.642380198 8.21E-16 1.45E-11 31CD8 cytoxict cells severe SAMD9L 0.447 0.156 0.825242718 0.179524153 0.629883364 1.12E-32 1.97E-28 8Effector CD8+ memory T (Tem) cell severe SAMD9L 0.624 0.15 1.098265896 0.169934641 0.842769576 1.09E-34 1.92E-30 24T cell(Activated T cell) severe SAMD9L 0.584 0.146 0.968944099 0.171474359 0.749096775 1.23E-36 2.18E-32 19CD141+CLEC9A+ dendritic cell severe SAMD9L 0.505 0.136 0.76039604 0.15179606 0.612014739 9.67E-66 1.71E-61 10CD8+ T cell severe SAMD9L 0.611 0.064 1.054794521 0.073903002 0.93613044 2.40E-98 4.24E-94 13CD141+CLEC9A+ dendritic cell severe SAMD9L 0.501 0.124 0.730068337 0.142061281 0.599188959 3.54E-104 6.25E-100 3Effector CD8+ memory T (Tem) cell severe SAMD9L 0.583 0.143 0.936014625 0.156862745 0.742872144 7.94E-131 1.40E-126 4Effector CD8+ memory T (Tem) cell severe SAMD9L 0.405 0.057 0.621621622 0.057142857 0.617266881 0 0 37CD8+ T cell severe SAMD9L 0.4 0.159 1 0.159090909 0.787006277 0 0 47AXL+SIGLEC6+ dendritic cell severe SP110 0.667 0.319 1.222222222 0.387254902 0.679770193 3.75E-10 6.62E-06 32Naive CD8+ T cell severe SP110 0.609 0.177 0.913043478 0.25170068 0.611980051 4.63E-11 8.17E-07 28CD1C+_B dendritic cell severe SP110 0.667 0.233 1.246376812 0.263565891 0.83009905 1.27E-15 2.24E-11 35Effector CD8+ memory T (Tem) cell severe SP110 0.628 0.159 1.115577889 0.353982301 0.643842922 3.50E-16 6.17E-12 30CD1C-CD141- dendritic cell severe SP110 0.654 0.266 1.248120301 0.335260116 0.751598425 1.70E-17 3.00E-13 31CD8 cytoxict cells severe SP110 0.654 0.279 1.058510638 0.34084507 0.618458356 1.26E-22 2.23E-18 23CD4+ T cell severe SP110 0.733 0.281 1.3 0.334319527 0.785529674 3.09E-23 5.46E-19 26 T cell severe SP110 0.686 0.249 1.31372549 0.316216216 0.813821206 2.67E-23 4.72E-19 25Megakaryocyte progenitor cell severe SP110 0.631 0.296 1.038834951 0.357606345 0.586679778 5.83E-24 1.03E-19 8Effector CD8+ memory T (Tem) cell severe SP110 0.672 0.268 1.1640625 0.324894515 0.707864666 2.74E-26 4.84E-22 22CD8+ T cell severe SP110 0.746 0.317 1.479768786 0.392156863 0.832883832 9.96E-32 1.76E-27 24T cell(Activated T cell) severe SP110 0.863 0.548 2.105590062 0.815705128 0.77433748 8.81E-38 1.55E-33 19CD141+CLEC9A+ dendritic cell severe SP110 0.66 0.304 1.175257732 0.379591837 0.656944849 1.83E-41 3.22E-37 16CD8+ T cell severe SP110 0.637 0.021 0.759776536 0.035897436 0.764511072 1.02E-42 1.79E-38 27Megakaryocyte progenitor cell severe SP110 0.63 0.301 1.132673267 0.411355736 0.595581288 4.27E-44 7.53E-40 10CD8+ T cell severe SP110 0.621 0.298 1.057441253 0.3671875 0.589640126 3.63E-46 6.41E-42 11CD4+ T cell severe SP110 0.775 0.408 1.953424658 0.599307159 0.884941763 1.50E-69 2.65E-65 13CD141+CLEC9A+ dendritic cell severe SP110 0.772 0.149 1.215384615 0.295180723 0.77440377 5.15E-83 9.08E-79 18CD4+ T helper severe SP110 0.718 0.29 1.255183413 0.355223881 0.73471357 1.96E-109 3.45E-105 5Effector CD8+ memory T (Tem) cell severe SP110 0.653 0.286 1.171981777 0.355153203 0.680556038 2.95E-112 5.20E-108 3Effector CD8+ memory T (Tem) cell severe SP110 0.698 0.248 1.28702011 0.31495098 0.798460033 8.16E-116 1.44E-111 4Effector CD8+ memory T (Tem) cell severe SP110 0.905 0.01 1.135 0.023305085 1.06099974 1.36E-178 2.40E-174 14Megakaryocyte progenitor cell severe TRIM22 0.696 0.24 1.347826087 0.379844961 0.766819371 2.47E-09 4.35E-05 35Effector CD8+ memory T (Tem) cell severe TRIM22 0.622 0.358 1.244444444 0.426470588 0.653908385 6.12E-11 1.08E-06 32Naive CD8+ T cell severe TRIM22 0.679 0.267 1.142857143 0.333333333 0.684498174 2.09E-11 3.69E-07 29CD8+ T cell severe TRIM22 0.649 0.236 1.297297297 0.271428571 0.853487156 3.07E-12 5.42E-08 37CD8+ T cell severe TRIM22 0.829 0.289 1.742857143 0.759036145 0.640894356 2.31E-13 4.08E-09 38Plasmacytoid dendritic cell severe TRIM22 0.595 0.368 1.135135135 0.407894737 0.60078791 1.33E-13 2.34E-09 36CD8+ T cell severe TRIM22 0.667 0.29 1.155555556 0.366863905 0.657190141 1.99E-14 3.51E-10 26 T cell severe TRIM22 0.722 0.272 1.406015038 0.346820809 0.837087742 1.23E-21 2.18E-17 31CD8 cytoxict cells severe TRIM22 0.739 0.105 1.304347826 0.163265306 0.986178328 2.24E-24 3.96E-20 28CD1C+_B dendritic cell severe TRIM22 0.7 0.28 1.375 0.350083752 0.814878606 6.25E-25 1.10E-20 20CD141+CLEC9A+ dendritic cell severe TRIM22 0.667 0.311 1.274509804 0.364864865 0.736797536 4.14E-25 7.30E-21 25Megakaryocyte progenitor cell severe TRIM22 0.692 0.33 1.230769231 0.411378556 0.660436282 1.49E-26 2.62E-22 21CD1C-CD141- dendritic cell severe TRIM22 0.707 0.315 1.303191489 0.402816901 0.715307645 2.13E-28 3.76E-24 23CD4+ T cell severe TRIM22 0.827 0.363 2.063583815 0.558823529 0.974762709 5.69E-32 1.00E-27 24T cell(Activated T cell) severe TRIM22 0.859 0.186 1.869346734 0.318584071 1.121732757 4.45E-33 7.85E-29 30CD1C-CD141- dendritic cell severe TRIM22 0.699 0.311 1.40776699 0.387166547 0.795554772 3.35E-40 5.91E-36 8Effector CD8+ memory T (Tem) cell severe TRIM22 0.672 0.305 1.208510638 0.368852459 0.690106827 1.07E-40 1.89E-36 17CD4+ T cell severe TRIM22 0.711 0.287 1.609375 0.345991561 0.955034928 8.29E-43 1.46E-38 22CD8+ T cell severe TRIM22 0.726 0.442 1.649315068 0.663972286 0.67098802 4.63E-43 8.18E-39 13CD141+CLEC9A+ dendritic cell severe TRIM22 0.673 0.3 1.391752577 0.406122449 0.766345919 2.93E-43 5.17E-39 16CD8+ T cell severe TRIM22 0.64 0.288 1.19843342 0.378348214 0.673535437 5.79E-49 1.02E-44 11CD4+ T cell severe TRIM22 0.668 0.288 1.2 0.3565381 0.697573956 9.33E-50 1.65E-45 12Megakaryocyte progenitor cell severe TRIM22 0.623 0.281 1.025 0.341346154 0.594240314 1.57E-64 2.76E-60 6CD8+ T cell severe TRIM22 0.713 0.307 1.643564356 0.397450753 0.919687006 5.03E-96 8.88E-92 10CD8+ T cell severe TRIM22 0.754 0.431 1.716108453 0.607462687 0.756755838 6.47E-97 1.14E-92 5Effector CD8+ memory T (Tem) cell severe TRIM22 0.755 0.346 1.683729433 0.486519608 0.852300737 1.15E-108 2.02E-104 4Effector CD8+ memory T (Tem) cell severe TRIM22 0.908 0.191 1.886153846 0.391566265 1.052438595 3.39E-111 5.98E-107 18CD4+ T helper severe TRIM22 0.72 0.328 1.358361775 0.397520661 0.754915434 3.71E-113 6.54E-109 7CD4+ T cell severe TRIM22 0.71 0.263 1.382687927 0.332172702 0.838808882 2.76E-146 4.87E-142 3Effector CD8+ memory T (Tem) cell severe TRIM22 0.694 0.293 1.300109529 0.373190349 0.74417094 4.42E-148 7.81E-144 2CD4+ T cell severe TRIM22 0.591 0.281 1.066322136 0.346127248 0.618250393 1.07E-155 1.89E-151 1Naive CD4+ T cell severe TRIM22 0.94 0.007 1.085 0.014830508 1.038808587 1.05E-192 1.86E-188 14Megakaryocyte progenitor cell severe TRIM22 0.715 0.01 0.804469274 0.01025641 0.836853072 0 0 27Megakaryocyte progenitor cell severe TRIM22 0.8 0.114 1 0.113636364 0.844721775 0 0 47AXL+SIGLEC6+ dendritic cell severe USP18 0.696 0.018 0.956521739 0.01754386 0.943200159 4.40E-09 7.76E-05 45Plasmacytoid dendritic cell severe USP18 0.457 0.023 0.612716763 0.026143791 0.652260178 3.74E-32 6.60E-28 24T cell(Activated T cell) severe USP18 0.481 0.061 0.648148148 0.060869565 0.635598642 0 0 33Plasmacytoid dendritic cell severe USP18 0.4 0.02 1 0.020100503 0.971288703 0 0 34CD8 cytoxict cells severe USP18 0.455 0.025 0.636363636 0.025 0.674869473 0 0 39CD141+CLEC9A+ dendritic cell severe XAF1 0.783 0.088 1.391304348 0.105263158 1.113407848 3.72E-09 6.56E-05 45Plasmacytoid dendritic cell severe XAF1 0.833 0.12 1.875 0.144578313 1.328745779 8.92E-12 1.57E-07 42Megakaryocyte progenitor cell severe XAF1 0.935 0.184 4.258064516 0.289473684 2.027749513 1.07E-12 1.89E-08 46B cell severe XAF1 0.912 0.304 2.264705882 0.326086957 1.299777644 4.62E-15 8.16E-11 44CD8 cytoxict cells severe XAF1 0.955 0.168 1.954545455 0.205607477 1.293175925 4.21E-15 7.43E-11 40CD8+ T cell severe XAF1 0.593 0.183 1.203703704 0.2 0.876895855 7.90E-16 1.39E-11 33Plasmacytoid dendritic cell severe XAF1 0.811 0.093 2.027027027 0.121428571 1.432563824 6.08E-19 1.07E-14 37CD8+ T cell severe XAF1 0.838 0.099 2.243243243 0.125 1.527512229 5.99E-22 1.06E-17 36CD8+ T cell severe XAF1 0.822 0.132 2.2 0.166666667 1.455679484 1.13E-24 2.00E-20 32Naive CD8+ T cell severe XAF1 0.929 0.096 2.342857143 0.228915663 1.443695792 7.62E-27 1.34E-22 38Plasmacytoid dendritic cell severe XAF1 0.971 0.217 2.985507246 0.379844961 1.530257176 1.22E-29 2.15E-25 35Effector CD8+ memory T (Tem) cell severe XAF1 0.875 0.185 2.321428571 0.237623762 1.424231087 1.53E-33 2.69E-29 29CD8+ T cell severe XAF1 0.873 0.184 1.911764706 0.243243243 1.227785188 1.04E-46 1.83E-42 25Megakaryocyte progenitor cell severe XAF1 0.942 0.085 2.550724638 0.115646259 1.670233822 1.91E-51 3.36E-47 28CD1C+_B dendritic cell severe XAF1 0.811 0.151 2.577777778 0.177514793 1.603318598 4.14E-52 7.31E-48 26 T cell severe XAF1 0.925 0.191 2.789473684 0.219653179 1.635526527 2.65E-57 4.68E-53 31CD8 cytoxict cells severe XAF1 0.965 0.097 2.020100503 0.168141593 1.370381403 8.65E-59 1.53E-54 30CD1C-CD141- dendritic cell severe XAF1 0.938 0.178 2.675 0.221105528 1.589556367 3.51E-70 6.19E-66 20CD141+CLEC9A+ dendritic cell severe XAF1 0.872 0.291 1.929487179 0.334792123 1.134033059 7.51E-76 1.33E-71 21CD1C-CD141- dendritic cell severe XAF1 0.931 0.239 2.924855491 0.31372549 1.578975688 1.08E-76 1.91E-72 24T cell(Activated T cell) severe XAF1 0.891 0.186 2.6875 0.219409283 1.596460616 2.01E-81 3.55E-77 22CD8+ T cell severe XAF1 0.888 0.149 2.35106383 0.174647887 1.512390808 5.36E-87 9.46E-83 23CD4+ T cell severe XAF1 0.794 0.182 1.829181495 0.261437908 1.165315535 2.48E-89 4.37E-85 15CD1C+_B dendritic cell severe XAF1 0.794 0.355 1.672 0.468201754 0.863869777 2.33E-98 4.12E-94 9CD1C+_B dendritic cell severe XAF1 0.883 0.206 2.40776699 0.250901226 1.445858818 1.45E-106 2.57E-102 8Effector CD8+ memory T (Tem) cell severe XAF1 0.843 0.164 2.242553191 0.190163934 1.445969935 8.23E-113 1.45E-108 17CD4+ T cell severe XAF1 0.839 0.168 2.073170732 0.203198495 1.352853252 8.07E-125 1.42E-120 12Megakaryocyte progenitor cell severe XAF1 0.957 0.125 3.236024845 0.149038462 1.882283961 7.75E-130 1.37E-125 19CD141+CLEC9A+ dendritic cell severe XAF1 0.869 0.196 2.283505155 0.22244898 1.425462466 1.08E-137 1.91E-133 16CD8+ T cell severe XAF1 0.843 0.122 2.219321149 0.145089286 1.491296409 1.94E-181 3.43E-177 11CD4+ T cell severe XAF1 0.855 0.191 2.415841584 0.242178447 1.459368628 4.35E-190 7.68E-186 10CD8+ T cell severe XAF1 0.997 0.064 2.458461538 0.112449799 1.636390178 5.53E-197 9.75E-193 18CD4+ T helper severe XAF1 1 0.001 1.38 0.003177966 1.246384007 4.36E-227 7.69E-223 14Megakaryocyte progenitor cell severe XAF1 0.934 0.133 3.482191781 0.159353349 1.95088404 1.54E-229 2.72E-225 13CD141+CLEC9A+ dendritic cell severe XAF1 0.857 0.144 1.920454545 0.163461538 1.327769411 1.77E-242 3.12E-238 6CD8+ T cell severe XAF1 0.903 0.249 2.312599681 0.323880597 1.323190859 8.84E-252 1.56E-247 5Effector CD8+ memory T (Tem) cell severe XAF1 0.877 0.173 2.098976109 0.198347107 1.37074578 8.64E-266 1.52E-261 7CD4+ T cell severe XAF1 0.894 0.201 2.482632541 0.245098039 1.483918915 1.01E-296 1.79E-292 4Effector CD8+ memory T (Tem) cell severe XAF1 0.863 0.137 2.321274763 0.161825726 1.515343399 0 0 1Naive CD4+ T cell severe XAF1 0.885 0.157 2.415115005 0.187131367 1.524454571 0 0 2CD4+ T cell severe XAF1 0.933 0.01 1.173184358 0.020512821 1.090516261 0 0 27Megakaryocyte progenitor cell severe XAF1 0.829 0.133 2 0.133333333 1.404390255 0 0 41Naive CD8+ T cell moderate BST2 0.602 0.279 1.070532915 0.355191257 0.611505665 8.88E-21 1.65E-16 37CD8+ T cell moderate BST2 0.601 0.092 1.015317287 0.18487395 0.766273402 7.53E-27 1.40E-22 33CD1C+_B dendritic cell moderate BST2 0.803 0.508 1.974580336 0.836065574 0.696068558 5.54E-100 1.03E-95 16Effector CD8+ memory T (Tem) cell moderate BST2 0.857 0.61 2.268122677 1.037148594 0.681910922 3.34E-107 6.22E-103 12Plasmacytoid dendritic cell moderate BST2 0.773 0.471 1.732150227 0.691368078 0.691846157 3.67E-133 6.82E-129 7Plasmacytoid dendritic cell moderate EPSTI1 0.291 0.066 0.715662651 0.094890511 0.647979297 1.66E-11 3.09E-07 26CD1C-CD141- dendritic cell moderate EPSTI1 0.376 0.04 0.876201923 0.083333333 0.792337886 2.29E-31 4.25E-27 31Megakaryocyte progenitor cell moderate EPSTI1 0.733 0.309 1.357262104 0.409547739 0.74187984 1.28E-49 2.38E-45 34CD1C-CD141- dendritic cell moderate EPSTI1 0.768 0.271 1.372717508 0.356589147 0.806556489 5.12E-52 9.52E-48 28CD141+CLEC9A+ dendritic cell moderate EPSTI1 0.491 0.089 0.904381085 0.117728532 0.768752368 2.84E-106 5.28E-102 8CD1C+_B dendritic cell moderate EPSTI1 0.707 0.246 1.230971129 0.335266821 0.740543784 8.03E-140 1.49E-135 6CD1C+_B dendritic cell moderate IFI27 0.333 0 0.68627451 0 0.753839413 5.57E-11 1.04E-06 47Plasmacytoid dendritic cell moderate IFI27 0.364 0 2.30529595 0 1.724779454 1.17E-11 2.17E-07 43Plasmacytoid dendritic cell moderate IFI27 0.271 0.036 1.236272879 0.043165468 1.100128225 3.29E-13 6.12E-09 39Plasmacytoid dendritic cell moderate IFI27 0.329 0 2.892778993 0 1.96080044 5.35E-19 9.94E-15 33CD1C+_B dendritic cell moderate IFI27 0.539 0 1.086474501 0 1.061067289 7.51E-23 1.40E-18 40Megakaryocyte progenitor cell moderate IFI27 0.394 0 1.451405622 0 1.29360922 1.38E-27 2.56E-23 26CD1C-CD141- dendritic cell moderate IFI27 0.693 0.015 3.438972163 0.044117647 2.087941383 5.33E-60 9.91E-56 20Megakaryocyte progenitor cell moderate IFI27 0.488 0.013 1.235915493 0.019480519 1.133031454 3.13E-64 5.83E-60 30Megakaryocyte progenitor cell moderate IFI27 0.56 0.012 12.13748657 0.031007752 3.671562205 2.49E-73 4.62E-69 28CD141+CLEC9A+ dendritic cell moderate IFI27 0.673 0 3.460336538 0 2.157152568 1.22E-104 2.28E-100 31Megakaryocyte progenitor cell moderate IFI27 0.693 0.003 16.27378965 0.002512563 4.106892406 7.34E-132 1.37E-127 34CD1C-CD141- dendritic cell moderate IFI27 0.519 0.001 5.35605007 0.002770083 2.664139629 7.91E-192 1.47E-187 8CD1C+_B dendritic cell moderate IFI27 0.474 0.007 1.018393393 0.023341523 0.979919688 6.02E-192 1.12E-187 4Megakaryocyte progenitor cell moderate IFI27 0.645 0.006 14.19717848 0.018561485 3.899198521 2.71E-307 5.05E-303 6CD1C+_B dendritic cell moderate IFI27 0.811 0.006 8.778201866 0.01285347 3.271143715 0 0 14Megakaryocyte progenitor cell moderate IFI27 0.439 0.009 1.068340307 0.009259259 1.035176751 0 0 36T cell moderate IFI27 0.15 0.011 0.626959248 0.010928962 0.686496492 0 0 37CD8+ T cell moderate IFI44L 0.687 0.056 1.445783133 0.138888889 1.102669483 5.17E-10 9.61E-06 49AXL+SIGLEC6+ dendritic cell moderate IFI44L 0.488 0.02 0.90234375 0.030612245 0.884276323 5.19E-19 9.65E-15 45CD8+ T cell moderate IFI44L 0.519 0.013 0.898004435 0.012987013 0.905867685 4.21E-19 7.82E-15 40Megakaryocyte progenitor cell moderate IFI44L 0.399 0.017 0.68380744 0.025210084 0.715807587 2.39E-20 4.45E-16 33CD1C+_B dendritic cell moderate IFI44L 0.657 0.053 2.058823529 0.105263158 1.468586968 5.74E-21 1.07E-16 47Plasmacytoid dendritic cell moderate IFI44L 0.726 0.09 1.457943925 0.134328358 1.11561368 8.80E-22 1.64E-17 43Plasmacytoid dendritic cell moderate IFI44L 0.538 0.008 0.897097625 0.008403361 0.91172109 9.12E-30 1.70E-25 41CD8+ T cell moderate IFI44L 0.586 0.066 1.887550201 0.138686131 1.342475892 5.36E-34 9.97E-30 26CD1C-CD141- dendritic cell moderate IFI44L 0.538 0.037 0.935828877 0.048128342 0.885136043 2.41E-39 4.48E-35 38CD8+ T cell moderate IFI44L 0.354 0.011 0.591709845 0.014285714 0.650113266 2.42E-47 4.51E-43 27Effector CD8+ memory T (Tem) cell moderate IFI44L 0.43 0 0.75 0 0.807354922 7.01E-61 1.30E-56 30Megakaryocyte progenitor cell moderate IFI44L 0.472 0.039 0.832126399 0.041666667 0.81462535 7.41E-73 1.38E-68 22CD1C-CD141- dendritic cell moderate IFI44L 0.608 0.078 1.01836394 0.092964824 0.884939366 2.74E-74 5.10E-70 34CD1C-CD141- dendritic cell moderate IFI44L 0.543 0.029 0.956953642 0.058651026 0.886382483 3.75E-78 6.98E-74 24Naive CD8+ T cell moderate IFI44L 0.718 0.078 1.327604726 0.093023256 1.090521984 2.00E-84 3.72E-80 28CD141+CLEC9A+ dendritic cell moderate IFI44L 0.52 0.048 0.973421927 0.051975052 0.907598953 1.66E-94 3.09E-90 23CD4+ T cell moderate IFI44L 0.53 0.036 0.925274725 0.040925267 0.88719783 4.39E-104 8.16E-100 25CD8+ T cell moderate IFI44L 0.509 0.008 1.401785714 0.020449898 1.23490209 1.66E-114 3.08E-110 21T cell (Activated T cell) moderate IFI44L 0.514 0.038 0.919500646 0.048929664 0.871813105 3.77E-132 7.02E-128 18CD8+ T cell moderate IFI44L 0.313 0.011 0.517952951 0.011400651 0.585772462 1.77E-136 3.30E-132 7Plasmacytoid dendritic cell moderate IFI44L 0.441 0.023 0.819642857 0.025470653 0.827369113 4.01E-153 7.46E-149 13CD8+ T cell moderate IFI44L 0.531 0.022 1.022885958 0.028213166 0.976275598 2.61E-153 4.85E-149 10CD8+ T cell moderate IFI44L 0.553 0.053 1.094228095 0.077562327 0.958647265 9.95E-155 1.85E-150 8CD1C+_B dendritic cell moderate IFI44L 0.557 0.033 0.992775181 0.037202381 0.942081535 2.57E-163 4.79E-159 17CD4+ T cell moderate IFI44L 0.499 0.025 0.957314149 0.032786885 0.922332741 1.13E-184 2.11E-180 16Effector CD8+ memory T (Tem) cell moderate IFI44L 0.476 0.012 0.82527881 0.017068273 0.843700325 3.30E-191 6.13E-187 12Plasmacytoid dendritic cell moderate IFI44L 0.558 0.037 1.051046025 0.044792833 0.97314296 8.19E-200 1.52E-195 9CD4+ T cell moderate IFI44L 0.542 0.015 0.963963964 0.018427518 0.947425151 5.45E-223 1.01E-218 4Megakaryocyte progenitor cell moderate IFI44L 0.768 0.137 1.532480315 0.196055684 1.082266497 3.17E-264 5.90E-260 6CD1C+_B dendritic cell moderate IFI44L 0.493 0.027 0.833229362 0.033293221 0.827137587 0 0 1CD8+ T cell moderate IFI44L 0.555 0.058 1.040734487 0.071602533 0.929318594 0 0 2Activated CD4+ T cell moderate IFI44L 0.53 0.018 0.884184545 0.018467852 0.887539833 0 0 3CD8+ T cell moderate IFI44L 0.63 0.049 1.343686502 0.061882818 1.142155035 0 0 5CD141+CLEC9A+ dendritic cell moderate IFI44L 0.433 0.022 0.620985011 0.022058824 0.665392519 0 0 20Megakaryocyte progenitor cell moderate IFI44L 0.336 0.008 0.552447552 0.008474576 0.622369816 0 0 42CD8+ T cell moderate IFI44L 0.499 0.019 0.828451883 0.018518519 0.84415045 0 0 36T cell moderate IFI44L 0.433 0.016 0.808777429 0.016393443 0.831555922 0 0 37CD8+ T cell moderate IFI44L 0.513 0.027 0.822541966 0.027027027 0.827477887 0 0 41CD8+ T cell moderate IFI44L 0.548 0.041 0.921708185 0.04109589 0.884286322 0 0 44CD8+ T cell moderate IFI44L 0.508 0.017 0.811518325 0.016949153 0.832951853 0 0 46CD8+ T cell moderate IFI6 0.88 0.333 3.457831325 0.444444444 1.625827312 3.40E-13 6.33E-09 49AXL+SIGLEC6+ dendritic cell moderate IFI6 0.53 0.235 1.064263323 0.289617486 0.678683805 7.96E-21 1.48E-16 37CD8+ T cell moderate IFI6 0.458 0.066 0.84261242 0.080882353 0.769543139 2.43E-22 4.53E-18 20Megakaryocyte progenitor cell moderate IFI6 0.604 0.165 1.475873544 0.194244604 1.051839272 3.07E-28 5.71E-24 39Plasmacytoid dendritic cell moderate IFI6 0.484 0.036 0.953413655 0.065693431 0.874205011 1.49E-28 2.78E-24 26CD1C-CD141- dendritic cell moderate IFI6 0.485 0.148 0.863319386 0.157407407 0.686978201 1.54E-32 2.87E-28 36T cell moderate IFI6 0.659 0.345 1.384318766 0.395939086 0.772341138 2.01E-37 3.74E-33 35Plasmacytoid dendritic cell moderate IFI6 0.639 0.042 1.303063457 0.067226891 1.109687239 2.50E-38 4.66E-34 33CD1C+_B dendritic cell moderate IFI6 0.512 0.203 0.905594406 0.224576271 0.63795845 5.14E-53 9.57E-49 42CD8+ T cell moderate IFI6 0.463 0.011 0.737980769 0.018115942 0.771510255 7.96E-55 1.48E-50 31Megakaryocyte progenitor cell moderate IFI6 0.604 0.169 1.257042254 0.188311688 0.92552013 8.90E-59 1.66E-54 30Megakaryocyte progenitor cell moderate IFI6 0.448 0.146 0.73255814 0.151767152 0.589054683 3.99E-64 7.42E-60 23CD4+ T cell moderate IFI6 0.487 0.15 0.820921223 0.185015291 0.619762835 7.33E-66 1.36E-61 18CD8+ T cell moderate IFI6 0.484 0.045 0.853708791 0.077709611 0.782446125 1.35E-83 2.52E-79 21T cell (Activated T cell) moderate IFI6 0.5 0.187 1.027678571 0.236987818 0.712997681 2.53E-87 4.71E-83 13CD8+ T cell moderate IFI6 0.456 0.15 0.787029289 0.166853303 0.614940083 2.10E-95 3.91E-91 9CD4+ T cell moderate IFI6 0.895 0.374 2.819699499 0.540201005 1.310340501 5.16E-104 9.60E-100 34CD1C-CD141- dendritic cell moderate IFI6 0.492 0.138 0.793168168 0.151105651 0.639490541 1.27E-118 2.35E-114 4Megakaryocyte progenitor cell moderate IFI6 0.518 0.158 0.946313529 0.177251185 0.725321956 8.93E-124 1.66E-119 19Effector CD8+ memory T (Tem) cell moderate IFI6 0.936 0.205 3.948442535 0.279069767 1.951879566 2.08E-149 3.87E-145 28CD141+CLEC9A+ dendritic cell moderate IFI6 0.56 0.167 1.081902894 0.190564292 0.806257248 4.13E-159 7.67E-155 15Effector CD8+ memory T (Tem) cell moderate IFI6 0.596 0.152 1.350119904 0.18647541 0.986052165 2.50E-159 4.66E-155 16Effector CD8+ memory T (Tem) cell moderate IFI6 0.535 0.165 0.999499249 0.182732607 0.757514794 2.49E-165 4.63E-161 11CD8+ T cell moderate IFI6 0.691 0.173 1.665892193 0.209839357 1.139802941 2.18E-216 4.06E-212 12Plasmacytoid dendritic cell moderate IFI6 0.512 0.161 0.92971718 0.196785192 0.689225191 1.18E-216 2.19E-212 2Activated CD4+ T cell moderate IFI6 0.678 0.175 1.577383409 0.201140065 1.101502773 7.38E-265 1.37E-260 7Plasmacytoid dendritic cell moderate IFI6 0.792 0.119 2.23922114 0.177285319 1.46018296 1.70E-272 3.15E-268 8CD1C+_B dendritic cell moderate IFI6 0.715 0.019 1.523324852 0.061696658 1.248954324 6.19E-295 1.15E-290 14Megakaryocyte progenitor cell moderate IFI6 0.968 0.362 4.396653543 0.636890951 1.721106858 0 0 6CD1C+_B dendritic cell moderate IFI6 0.434 0.136 0.716981132 0.136363636 0.595449614 0 0 48T cell moderate IFIT3 0.591 0.196 1.135225376 0.253768844 0.768116971 4.87E-43 9.07E-39 34CD1C-CD141- dendritic cell moderate IFIT3 0.367 0.027 0.550943396 0.032916392 0.586422552 2.44E-178 4.54E-174 5CD141+CLEC9A+ dendritic cell moderate IFITM1 0.783 0.083 2.771084337 0.166666667 1.692586994 2.10E-12 3.90E-08 49AXL+SIGLEC6+ dendritic cell moderate IFITM1 0.732 0.396 3.212978369 1.158273381 0.964962891 1.63E-14 3.03E-10 39Plasmacytoid dendritic cell moderate IFITM1 1 0.986 9.494661922 4.890410959 0.833215496 1.94E-20 3.60E-16 44CD8+ T cell moderate IFITM1 0.995 0.974 3.759803922 1.526315789 0.913867156 1.06E-21 1.97E-17 47Plasmacytoid dendritic cell moderate IFITM1 0.996 0.961 9.33037694 4.454545455 0.921362015 7.31E-23 1.36E-18 40Megakaryocyte progenitor cell moderate IFITM1 0.996 0.98 10.4140625 5.142857143 0.89383063 5.64E-23 1.05E-18 45CD8+ T cell moderate IFITM1 0.992 0.942 4.001606426 2.051094891 0.713064488 5.91E-24 1.10E-19 26CD1C-CD141- dendritic cell moderate IFITM1 1 0.986 10.32613909 5.081081081 0.897256421 2.77E-26 5.16E-22 41CD8+ T cell moderate IFITM1 1 0.975 9.963350785 4.762711864 0.927869012 5.58E-27 1.04E-22 46CD8+ T cell moderate IFITM1 0.999 0.981 11.28870293 5.837962963 0.845694134 8.01E-43 1.49E-38 36T cell moderate IFITM1 0.995 0.966 10.58311346 4.588235294 1.051558419 1.96E-50 3.65E-46 41CD8+ T cell moderate IFITM1 1 0.968 10.10338681 4.764705882 0.945680894 3.95E-54 7.36E-50 38CD8+ T cell moderate IFITM1 0.998 0.956 14.03134796 6.114754098 1.079088591 2.19E-54 4.08E-50 37CD8+ T cell moderate IFITM1 1 0.987 15.40492958 8.204545455 0.833711016 2.14E-54 3.97E-50 30Megakaryocyte progenitor cell moderate IFITM1 1 0.987 14.55769231 7.588983051 0.85706885 3.68E-82 6.85E-78 42CD8+ T cell moderate IFITM1 0.998 0.962 10.65149007 5.214076246 0.906902619 1.61E-89 3.00E-85 24Naive CD8+ T cell moderate IFITM1 0.998 0.937 10.8746114 4.671428571 1.066096216 9.73E-96 1.81E-91 27Effector CD8+ memory T (Tem) cell moderate IFITM1 0.998 0.984 10.42637363 5.355871886 0.84620566 2.24E-99 4.17E-95 25CD8+ T cell moderate IFITM1 0.828 0.151 5.272824919 0.348837209 2.217399056 2.83E-100 5.27E-96 28CD141+CLEC9A+ dendritic cell moderate IFITM1 0.999 0.965 10.9269103 5.126819127 0.961010191 3.52E-117 6.54E-113 23CD4+ T cell moderate IFITM1 0.998 0.959 9.174553918 4.821316614 0.805548153 3.46E-139 6.44E-135 10CD8+ T cell moderate IFITM1 0.999 0.973 10.19379516 5.364583333 0.814561278 1.93E-165 3.59E-161 17CD4+ T cell moderate IFITM1 0.999 0.983 11.80068876 5.706422018 0.932606263 2.70E-166 5.02E-162 18CD8+ T cell moderate IFITM1 0.988 0.992 3.779474131 2.084832905 0.631659547 7.33E-191 1.36E-186 14Megakaryocyte progenitor cell moderate IFITM1 0.993 0.407 10.91652755 1.105527638 2.50071018 2.95E-196 5.48E-192 34CD1C-CD141- dendritic cell moderate IFITM1 0.997 0.911 10.40092166 3.510416667 1.337817839 8.44E-197 1.57E-192 22CD1C-CD141- dendritic cell moderate IFITM1 0.999 0.994 14.57909807 7.188625592 0.927918482 1.65E-203 3.06E-199 19Effector CD8+ memory T (Tem) cell moderate IFITM1 0.639 0.092 3.247703412 0.226218097 1.792467434 5.93E-206 1.10E-201 6CD1C+_B dendritic cell moderate IFITM1 0.88 0.618 5.376564673 1.117728532 1.590261728 5.86E-206 1.09E-201 8CD1C+_B dendritic cell moderate IFITM1 0.997 0.972 10.91338912 5.473684211 0.879924993 2.61E-208 4.86E-204 9CD4+ T cell moderate IFITM1 0.998 0.969 9.289602102 4.63022113 0.869923703 2.89E-229 5.38E-225 4Megakaryocyte progenitor cell moderate IFITM1 1 0.997 20.44604317 10.48463115 0.90100697 3.37E-235 6.27E-231 16Effector CD8+ memory T (Tem) cell moderate IFITM1 1 0.997 15.07511267 7.696563286 0.886311556 6.08E-249 1.13E-244 11CD8+ T cell moderate IFITM1 1 0.947 11.91607143 4.936877076 1.121391177 2.98E-256 5.55E-252 13CD8+ T cell moderate IFITM1 1 0.999 24.0464684 13.41666667 0.796869563 4.54E-258 8.45E-254 12Plasmacytoid dendritic cell moderate IFITM1 1 0.995 18.35905902 10.23289902 0.785278518 5.69E-259 1.06E-254 7Plasmacytoid dendritic cell moderate IFITM1 1 0.996 17.17410495 8.650323774 0.913235064 2.24E-262 4.17E-258 15Effector CD8+ memory T (Tem) cell moderate IFITM1 0.998 0.976 9.999584113 5.019253911 0.869792397 0 0 1CD8+ T cell moderate IFITM1 0.999 0.972 13.13381173 6.411592791 0.931295073 0 0 2Activated CD4+ T cell moderate IFITM1 0.999 0.963 9.974558572 4.76880985 0.927817296 0 0 3CD8+ T cell moderate IFITM1 0.938 0.362 4.95820029 0.540487163 1.951489962 0 0 5CD141+CLEC9A+ dendritic cell moderate IFITM2 0.738 0.299 2.271028037 0.71641791 0.930343265 2.19E-10 4.07E-06 43Plasmacytoid dendritic cell moderate IFITM2 0.872 0.701 2.718235681 1.4609375 0.5954102 3.24E-33 6.02E-29 22CD1C-CD141- dendritic cell moderate IFITM2 0.981 0.698 6.10311493 1.972868217 1.256596317 6.09E-85 1.13E-80 28CD141+CLEC9A+ dendritic cell moderate IFITM2 0.975 0.87 6.042767733 2.994459834 0.818142082 2.62E-107 4.88E-103 8CD1C+_B dendritic cell moderate IFITM2 0.884 0.977 2.379983036 1.244215938 0.590804507 6.45E-202 1.20E-197 14Megakaryocyte progenitor cell moderate IFITM2 0.971 0.718 5.417979003 1.8387471 1.176864743 1.95E-245 3.63E-241 6CD1C+_B dendritic cell moderate IFITM3 0.62 0.224 3.236760125 0.462686567 1.534340795 3.21E-10 5.97E-06 43Plasmacytoid dendritic cell moderate IFITM3 0.844 0.757 2.582441113 1.264705882 0.661619291 3.36E-15 6.25E-11 20Megakaryocyte progenitor cell moderate IFITM3 0.72 0.574 2.39888424 1.12037037 0.680744941 5.64E-16 1.05E-11 36T cell moderate IFITM3 0.893 0.779 3.875586854 2.178571429 0.617197372 1.21E-19 2.26E-15 30Megakaryocyte progenitor cell moderate IFITM3 0.945 0.759 3.720481928 1.569343066 0.87753462 1.57E-21 2.92E-17 26CD1C-CD141- dendritic cell moderate IFITM3 0.988 0.924 12.81619256 4 1.466360095 2.63E-25 4.90E-21 33CD1C+_B dendritic cell moderate IFITM3 0.827 0.557 2.106735751 1.068571429 0.586764761 1.01E-27 1.88E-23 27Effector CD8+ memory T (Tem) cell moderate IFITM3 0.814 0.763 1.808823529 0.815789474 0.629369043 1.01E-29 1.87E-25 47Plasmacytoid dendritic cell moderate IFITM3 0.783 0.521 1.807768269 0.822916667 0.623175261 1.59E-39 2.96E-35 22CD1C-CD141- dendritic cell moderate IFITM3 0.91 0.807 3.716037273 2.114708603 0.598477923 6.20E-73 1.15E-68 15Effector CD8+ memory T (Tem) cell moderate IFITM3 0.856 0.663 2.975961538 0.804347826 1.139826326 9.52E-83 1.77E-78 31Megakaryocyte progenitor cell moderate IFITM3 0.953 0.84 4.720594305 2.666123779 0.641909538 6.75E-95 1.25E-90 7Plasmacytoid dendritic cell moderate IFITM3 0.976 0.852 6.468105516 3.316598361 0.790847448 8.44E-122 1.57E-117 16Effector CD8+ memory T (Tem) cell moderate IFITM3 0.99 0.909 7.37732342 3.947791165 0.759704764 9.62E-138 1.79E-133 12Plasmacytoid dendritic cell moderate IFITM3 1 1 39.19532554 18.08291457 1.074746201 1.11E-164 2.06E-160 34CD1C-CD141- dendritic cell moderate IFITM3 0.998 0.837 28.27067669 5.197674419 2.239657226 1.35E-241 2.52E-237 28CD141+CLEC9A+ dendritic cell moderate IFITM3 1 0.923 23.31856955 4.738979118 2.08319234 0 0 6CD1C+_B dendritic cell moderate IFITM3 1 0.87 20.15924896 3.44598338 2.25071396 0 0 8CD1C+_B dendritic cell moderate IFITM3 0.976 0.874 6.541560645 1.086118252 1.854042165 0 0 14Megakaryocyte progenitor cell moderate IRF1 0.558 0.741 1.068585132 2.200819672 -0.629797068 1.06E-71 1.97E-67 16Effector CD8+ memory T (Tem) cell moderate IRF7 0.499 0.134 0.769706975 0.157166124 0.612914507 5.42E-130 1.01E-125 7Plasmacytoid dendritic cell moderate ISG15 0.445 0.11 0.717277487 0.127118644 0.60748379 9.76E-11 1.82E-06 46CD8+ T cell moderate ISG15 0.352 0.058 0.950200803 0.131386861 0.785530357 3.80E-15 7.06E-11 26CD1C-CD141- dendritic cell moderate ISG15 0.548 0.118 1.273522976 0.201680672 0.91987601 8.70E-21 1.62E-16 33CD1C+_B dendritic cell moderate ISG15 0.505 0.162 0.947001395 0.203703704 0.693773607 4.35E-24 8.08E-20 36T cell moderate ISG15 0.684 0.252 2.018302829 0.402877698 1.105348319 1.92E-24 3.58E-20 39Plasmacytoid dendritic cell moderate ISG15 0.695 0.406 1.672236504 0.558375635 0.778004672 3.24E-27 6.02E-23 35Plasmacytoid dendritic cell moderate ISG15 0.463 0.139 0.757575758 0.144385027 0.619014349 1.77E-27 3.30E-23 38CD8+ T cell moderate ISG15 0.577 0.153 1.25862069 0.169398907 0.949674858 3.20E-36 5.96E-32 37CD8+ T cell moderate ISG15 0.493 0.114 0.849337748 0.134897361 0.704446904 2.28E-44 4.24E-40 24Naive CD8+ T cell moderate ISG15 0.515 0.161 0.909150757 0.197916667 0.67240348 3.06E-46 5.68E-42 22CD1C-CD141- dendritic cell moderate ISG15 0.48 0.158 0.865448505 0.187110187 0.652068684 1.05E-49 1.96E-45 23CD4+ T cell moderate ISG15 0.603 0.218 1.376760563 0.25 0.927068478 4.29E-55 7.98E-51 30Megakaryocyte progenitor cell moderate ISG15 0.456 0.125 0.847252747 0.142348754 0.693378107 2.03E-57 3.78E-53 25CD8+ T cell moderate ISG15 0.376 0.031 0.717032967 0.051124744 0.707983845 3.12E-61 5.80E-57 21T cell (Activated T cell) moderate ISG15 0.624 0.231 1.188811189 0.262711864 0.793622039 1.50E-68 2.79E-64 42CD8+ T cell moderate ISG15 0.445 0.119 0.728856779 0.136904762 0.604706953 2.49E-70 4.63E-66 17CD4+ T cell moderate ISG15 0.404 0.105 0.693948798 0.114420063 0.604097132 1.27E-73 2.36E-69 10CD8+ T cell moderate ISG15 0.799 0.24 2.148227712 0.317829457 1.256376214 7.23E-74 1.34E-69 28CD141+CLEC9A+ dendritic cell moderate ISG15 0.486 0.171 0.900129143 0.20030581 0.662695457 1.19E-75 2.22E-71 18CD8+ T cell moderate ISG15 0.495 0.148 0.90125523 0.188129899 0.678259641 4.92E-91 9.16E-87 9CD4+ T cell moderate ISG15 0.518 0.206 1.220089286 0.263565891 0.8131168 5.81E-99 1.08E-94 13CD8+ T cell moderate ISG15 0.49 0.209 0.887616321 0.23507109 0.611971465 4.69E-102 8.72E-98 19Effector CD8+ memory T (Tem) cell moderate ISG15 0.893 0.455 3.732888147 0.683417085 1.491328162 1.89E-103 3.52E-99 34CD1C-CD141- dendritic cell moderate ISG15 0.47 0.123 0.791478979 0.136363636 0.656726544 1.61E-113 2.99E-109 4Megakaryocyte progenitor cell moderate ISG15 0.366 0.005 0.527989822 0.01285347 0.593209459 4.22E-121 7.84E-117 14Megakaryocyte progenitor cell moderate ISG15 0.636 0.245 1.558752998 0.336065574 0.937450071 1.98E-131 3.68E-127 16Effector CD8+ memory T (Tem) cell moderate ISG15 0.579 0.23 1.179499755 0.277520814 0.770650245 2.32E-138 4.32E-134 15Effector CD8+ memory T (Tem) cell moderate ISG15 0.623 0.143 1.729137691 0.234072022 1.145018589 1.22E-138 2.26E-134 8CD1C+_B dendritic cell moderate ISG15 0.56 0.216 1.15122684 0.257334451 0.774791203 1.18E-145 2.19E-141 11CD8+ T cell moderate ISG15 0.455 0.125 0.843251089 0.148782093 0.682147442 1.99E-156 3.70E-152 5CD141+CLEC9A+ dendritic cell moderate ISG15 0.779 0.313 2.333661417 0.555684455 1.099558122 2.75E-166 5.12E-162 6CD1C+_B dendritic cell moderate ISG15 0.727 0.313 1.875 0.375502008 1.06360371 1.30E-216 2.42E-212 12Plasmacytoid dendritic cell moderate ISG15 0.706 0.268 1.713165497 0.339576547 1.018200028 5.06E-223 9.40E-219 7Plasmacytoid dendritic cell moderate ISG15 0.586 0.213 1.282608696 0.271310278 0.844367382 1.71E-265 3.19E-261 2Activated CD4+ T cell moderate ISG15 0.412 0.097 0.671033479 0.104292018 0.597618911 2.77E-268 5.16E-264 1CD8+ T cell moderate ISG15 0.451 0.068 0.712230216 0.067567568 0.681549308 0 0 41CD8+ T cell moderate ISG15 0.474 0.06 0.881619938 0.059701493 0.828317323 0 0 43Plasmacytoid dendritic cell moderate ISG15 0.505 0.11 0.832740214 0.109589041 0.723976858 0 0 44CD8+ T cell moderate ISG20 0.702 0.443 1.63322884 0.743169399 0.595120128 2.00E-13 3.72E-09 37CD8+ T cell moderate MT2A 0.685 0.566 3.254564984 1.546511628 0.740489323 2.16E-12 4.02E-08 28CD141+CLEC9A+ dendritic cell moderate MT2A 0.917 0.764 7.532554257 3.48241206 0.928702404 1.87E-28 3.47E-24 34CD1C-CD141- dendritic cell moderate MT2A 0.485 0.521 0.917050691 2.0546875 -0.672136312 3.44E-50 6.41E-46 22CD1C-CD141- dendritic cell moderate MT2A 0.812 0.626 4.17191601 1.953596288 0.808226202 1.76E-56 3.28E-52 6CD1C+_B dendritic cell moderate MT2A 0.736 0.373 3.472878999 0.965373961 1.186399884 1.10E-95 2.05E-91 8CD1C+_B dendritic cell moderate MT2A 0.484 0.015 0.595419847 0.038560411 0.619350993 7.77E-169 1.45E-164 14Megakaryocyte progenitor cell moderate MX1 0.333 0.05 0.741794311 0.100840336 0.661969027 6.17E-12 1.15E-07 33CD1C+_B dendritic cell moderate MX1 0.375 0.044 1.095582329 0.094890511 0.936564594 8.19E-18 1.52E-13 26CD1C-CD141- dendritic cell moderate MX1 0.421 0.065 0.644351464 0.074074074 0.614425201 2.89E-27 5.38E-23 36T cell moderate MX1 0.531 0.096 0.998714653 0.101522843 0.859573107 2.06E-39 3.83E-35 35Plasmacytoid dendritic cell moderate MX1 0.653 0.211 1.273789649 0.33919598 0.763731693 3.40E-44 6.32E-40 34CD1C-CD141- dendritic cell moderate MX1 0.67 0.167 1.276047261 0.282945736 0.827070363 1.73E-47 3.21E-43 28CD141+CLEC9A+ dendritic cell moderate MX1 0.38 0.057 1.004807692 0.122699387 0.836492171 1.53E-49 2.84E-45 21T cell (Activated T cell) moderate MX1 0.43 0.082 0.641758242 0.088967972 0.592280175 3.73E-56 6.93E-52 25CD8+ T cell moderate MX1 0.565 0.134 1.252086231 0.263157895 0.834227081 2.43E-103 4.52E-99 8CD1C+_B dendritic cell moderate MX1 0.462 0.104 0.911607143 0.127353267 0.761846395 2.32E-107 4.32E-103 13CD8+ T cell moderate MX1 0.698 0.231 1.42355643 0.440835267 0.750220276 1.29E-135 2.39E-131 6CD1C+_B dendritic cell moderate MX1 0.492 0.061 0.891606715 0.094262295 0.789653574 1.32E-139 2.46E-135 16Effector CD8+ memory T (Tem) cell moderate MX1 0.405 0.042 0.640961442 0.046102263 0.649517449 1.25E-142 2.33E-138 11CD8+ T cell moderate MX1 0.505 0.076 0.87035316 0.096385542 0.770555496 2.94E-145 5.46E-141 12Plasmacytoid dendritic cell moderate MX1 0.453 0.047 0.743293438 0.061074919 0.716288907 3.53E-166 6.56E-162 7Plasmacytoid dendritic cell moderate MX1 0.474 0.135 0.831785564 0.171456405 0.644947359 7.44E-193 1.38E-188 2Activated CD4+ T cell moderate MX1 0.404 0.036 0.616197183 0.035714286 0.641977151 0 0 30Megakaryocyte progenitor cell moderate MX1 0.445 0.033 0.896551724 0.032786885 0.876836132 0 0 37CD8+ T cell moderate PLSCR1 0.334 0.025 0.777899344 0.042016807 0.770795101 6.83E-15 1.27E-10 33CD1C+_B dendritic cell moderate PLSCR1 0.666 0.307 1.228714524 0.394472362 0.676492493 8.95E-41 1.66E-36 34CD1C-CD141- dendritic cell moderate XAF1 0.449 0.09 0.763239875 0.104477612 0.674864581 4.90E-09 9.12E-05 43Plasmacytoid dendritic cell moderate XAF1 0.52 0.164 0.768683274 0.178082192 0.586235526 6.79E-10 1.26E-05 44CD8+ T cell moderate XAF1 0.484 0.068 0.738609113 0.081081081 0.685458882 2.77E-12 5.15E-08 41CD8+ T cell moderate XAF1 0.508 0.093 0.764397906 0.110169492 0.668396001 1.13E-14 2.10E-10 46CD8+ T cell moderate XAF1 0.435 0.073 1.034538153 0.138686131 0.837331199 3.66E-18 6.81E-14 26CD1C-CD141- dendritic cell moderate XAF1 0.501 0.084 0.90809628 0.12605042 0.760862543 1.11E-19 2.07E-15 33CD1C+_B dendritic cell moderate XAF1 0.534 0.18 0.865203762 0.213114754 0.620617216 4.18E-22 7.78E-18 37CD8+ T cell moderate XAF1 0.505 0.157 0.873082287 0.199074074 0.643493495 6.26E-23 1.16E-18 36T cell moderate XAF1 0.547 0.091 0.868092692 0.112299465 0.748020783 2.06E-31 3.83E-27 38CD8+ T cell moderate XAF1 0.547 0.234 0.917098446 0.271428571 0.592474009 1.39E-37 2.59E-33 27Effector CD8+ memory T (Tem) cell moderate XAF1 0.523 0.197 0.853146853 0.230932203 0.590225909 3.19E-38 5.94E-34 42CD8+ T cell moderate XAF1 0.561 0.179 0.968309859 0.220779221 0.689155042 1.54E-38 2.86E-34 30Megakaryocyte progenitor cell moderate XAF1 0.522 0.167 0.872284398 0.213541667 0.625575951 9.32E-43 1.73E-38 22CD1C-CD141- dendritic cell moderate XAF1 0.515 0.141 0.814569536 0.161290323 0.643898653 1.98E-44 3.69E-40 24Naive CD8+ T cell moderate XAF1 0.672 0.252 1.026852846 0.282945736 0.659781199 1.50E-44 2.80E-40 28CD141+CLEC9A+ dendritic cell moderate XAF1 0.504 0.154 0.82807309 0.180873181 0.630469717 1.45E-53 2.69E-49 23CD4+ T cell moderate XAF1 0.669 0.302 1.118530885 0.341708543 0.65899285 5.52E-54 1.03E-49 34CD1C-CD141- dendritic cell moderate XAF1 0.461 0.08 1.096153846 0.130879346 0.890299591 3.36E-64 6.25E-60 21T cell (Activated T cell) moderate XAF1 0.535 0.17 0.982962448 0.253462604 0.661738402 3.82E-77 7.11E-73 8CD1C+_B dendritic cell moderate XAF1 0.518 0.167 0.838570814 0.19266055 0.624401256 4.94E-79 9.19E-75 18CD8+ T cell moderate XAF1 0.492 0.125 0.869666408 0.155172414 0.694672687 5.48E-80 1.02E-75 10CD8+ T cell moderate XAF1 0.524 0.144 0.831704207 0.171130952 0.645284146 1.02E-87 1.90E-83 17CD4+ T cell moderate XAF1 0.555 0.212 0.900501074 0.262559242 0.590028757 2.91E-89 5.42E-85 19Effector CD8+ memory T (Tem) cell moderate XAF1 0.528 0.198 0.922767857 0.244739756 0.627340449 1.53E-89 2.84E-85 13CD8+ T cell moderate XAF1 0.537 0.19 0.888670917 0.234042553 0.613979204 3.27E-101 6.08E-97 15Effector CD8+ memory T (Tem) cell moderate XAF1 0.534 0.188 0.915873811 0.235540654 0.63286006 1.12E-107 2.08E-103 11CD8+ T cell moderate XAF1 0.523 0.119 0.848535565 0.139977604 0.69737732 5.07E-122 9.42E-118 9CD4+ T cell moderate XAF1 0.651 0.255 1.243494424 0.330321285 0.753972886 1.68E-126 3.12E-122 12Plasmacytoid dendritic cell moderate XAF1 0.637 0.206 1.229256595 0.268442623 0.813504423 3.05E-138 5.67E-134 16Effector CD8+ memory T (Tem) cell moderate XAF1 0.622 0.199 1.098638052 0.241042345 0.757901027 7.35E-169 1.37E-164 7Plasmacytoid dendritic cell moderate XAF1 0.513 0.146 0.797607746 0.170998632 0.618338856 2.77E-178 5.16E-174 3CD8+ T cell moderate XAF1 0.475 0.143 0.764608027 0.168872844 0.594229758 7.66E-235 1.42E-230 1CD8+ T cell moderate XAF1 0.558 0.181 0.905445336 0.218217243 0.64535679 9.88E-236 1.84E-231 2Activated CD4+ T cell cured BST2 0.721 0.331 1.23255814 0.43236715 0.640296409 4.06E-09 7.13E-05 25CD8+ T cell cured BST2 0.654 0.231 2.012345679 0.444444444 1.060372618 1.00E-09 1.76E-05 34CD1C-CD141- dendritic cell cured BST2 0.93 0.716 2.253521127 1.106382979 0.627234154 1.83E-10 3.21E-06 30CD141+CLEC9A+ dendritic cell cured BST2 0.659 0.28 1.068181818 0.359756098 0.605015126 1.45E-10 2.54E-06 27CD8+ T cell cured BST2 0.814 0.433 1.617647059 0.605769231 0.705006015 9.61E-11 1.69E-06 31Plasmacytoid dendritic cell cured BST2 0.646 0.348 1.307692308 0.442622951 0.677756596 4.76E-13 8.35E-09 26CD8+ T cell cured BST2 0.5 0.033 0.65625 0.04111986 0.669784285 3.47E-13 6.09E-09 13Megakaryocyte progenitor cell cured BST2 0.71 0.353 1.483870968 0.43438914 0.79215376 2.21E-13 3.88E-09 28CD8+ T cell cured BST2 0.725 0.393 1.431372549 0.51988218 0.677811477 9.18E-14 1.61E-09 19CD4+ cytotoxic T cell cured BST2 0.937 0.775 2.742138365 1.4 0.640828497 1.99E-24 3.50E-20 22CD1C-CD141- dendritic cell cured BST2 0.658 0.345 1.222088836 0.452008929 0.61386617 4.85E-97 8.52E-93 3Effector CD8+ memory T (Tem) cell cured BST2 0.773 0.493 1.727508651 0.759950249 0.632049126 4.77E-98 8.37E-94 2Effector CD8+ memory T (Tem) cell cured BST2 0.861 0.583 2.288389513 0.984967788 0.728265602 9.72E-99 1.71E-94 6Effector CD8+ memory T (Tem) cell cured BST2 0.596 0.259 1.038461538 0.259259259 0.694905397 0 0 39CD8+ T cell cured EPSTI1 0.831 0.234 1.478873239 0.304964539 0.925673895 5.78E-18 1.01E-13 30CD141+CLEC9A+ dendritic cell cured EPSTI1 0.598 0.227 1.042735043 0.301136364 0.650729919 5.18E-27 9.10E-23 18Memory B cell cured EPSTI1 0.811 0.302 1.635220126 0.395454545 0.917188347 3.70E-41 6.49E-37 22CD1C-CD141- dendritic cell cured EPSTI1 0.589 0.226 1 0.304958678 0.615995876 4.70E-59 8.24E-55 9CD1C+_B dendritic cell cured EPSTI1 0.536 0.103 0.785714286 0.103448276 0.694482263 0 0 40Plasmacytoid dendritic cell cured IFI27 0.132 0.006 1.170940171 0.011363636 1.102018155 7.10E-14 1.25E-09 18Memory B cell cured IFI27 0.265 0 1.451162791 0 1.293466302 9.31E-31 1.63E-26 20CD1C+_B dendritic cell cured IFI27 0.237 0.006 2.422697368 0.017355372 1.750310022 2.77E-65 4.87E-61 9CD1C+_B dendritic cell cured IFI27 0.61 0.005 15.3081761 0.009090909 4.014467383 6.82E-68 1.20E-63 22CD1C-CD141- dendritic cell cured IFI27 0.4 0.045 3.551515152 0.045454545 2.122216546 0 0 29Plasmacytoid dendritic cell cured IFI44L 0.786 0.121 1.928571429 0.172413793 1.320715236 2.29E-09 4.02E-05 40Plasmacytoid dendritic cell cured IFI44L 0.429 0.05 0.761904762 0.066115702 0.724771925 3.44E-10 6.03E-06 32Effector CD8+ memory T (Tem) cell cured IFI44L 0.556 0.083 1.864197531 0.175925926 1.284333808 1.26E-12 2.21E-08 34CD1C-CD141- dendritic cell cured IFI44L 0.648 0.064 1.521126761 0.070921986 1.235215271 2.43E-22 4.26E-18 30CD141+CLEC9A+ dendritic cell cured IFI44L 0.415 0.061 0.769230769 0.085227273 0.705125029 1.80E-30 3.16E-26 18Memory B cell cured IFI44L 0.251 0.01 0.644028103 0.023904382 0.683153965 2.32E-32 4.07E-28 17T cell (Activated T cell) cured IFI44L 0.616 0.082 1.062893082 0.095454545 0.913139427 5.64E-45 9.90E-41 22CD1C-CD141- dendritic cell cured IFI44L 0.456 0.053 0.763326226 0.057142857 0.738129058 1.79E-61 3.15E-57 16CD141+CLEC9A+ dendritic cell cured IFI44L 0.415 0.058 0.680379747 0.068389058 0.653350197 2.69E-105 4.73E-101 4CD4+ T cell cured IFI44L 0.485 0.045 0.865403789 0.061538462 0.813331309 4.86E-122 8.53E-118 8CD141+CLEC9A+ dendritic cell cured IFI44L 0.418 0.016 0.662921348 0.022906228 0.701046039 6.77E-137 1.19E-132 6Effector CD8+ memory T (Tem) cell cured IFI44L 0.681 0.117 1.434210526 0.16446281 1.063789383 5.42E-147 9.52E-143 9CD1C+_B dendritic cell cured IFI44L 0.5 0.176 1.166666667 0.176470588 0.881011964 0 0 45CD1C-CD141- dendritic cell cured IFI6 0.6 0.258 1.224242424 0.303030303 0.771443403 3.72E-09 6.53E-05 29Plasmacytoid dendritic cell cured IFI6 0.395 0.037 1.024691358 0.055555556 0.93969949 5.75E-10 1.01E-05 34CD1C-CD141- dendritic cell cured IFI6 0.5 0.212 0.931372549 0.230769231 0.650066196 6.12E-12 1.07E-07 31Plasmacytoid dendritic cell cured IFI6 0.293 0.06 0.827906977 0.101293103 0.730994167 4.39E-20 7.71E-16 20CD1C+_B dendritic cell cured IFI6 0.803 0.113 1.774647887 0.14893617 1.272006049 1.06E-24 1.86E-20 30CD141+CLEC9A+ dendritic cell cured IFI6 0.786 0.373 1.805031447 0.543181818 0.862108894 7.41E-29 1.30E-24 22CD1C-CD141- dendritic cell cured IFI6 0.788 0.324 2.069078947 0.542975207 0.992090877 1.63E-106 2.86E-102 9CD1C+_B dendritic cell cured IFIT1 0.484 0.059 0.874213836 0.068181818 0.811128332 8.28E-33 1.45E-28 22CD1C-CD141- dendritic cell cured IFIT2 0.604 0.175 0.874213836 0.213636364 0.626949347 3.55E-23 6.24E-19 22CD1C-CD141- dendritic cell cured IFIT3 0.73 0.184 1.314465409 0.236363636 0.904575873 5.81E-39 1.02E-34 22CD1C-CD141- dendritic cell cured IFIT3 0.408 0.043 0.605633803 0.042553191 0.623021902 0 0 30CD141+CLEC9A+ dendritic cell cured IFITM1 0.636 0.273 2.715151515 0.515151515 1.293958979 4.83E-09 8.48E-05 29Plasmacytoid dendritic cell cured IFITM1 1 1 13.8 8.809836066 0.593296243 1.83E-09 3.22E-05 26CD8+ T cell cured IFITM1 1 0.902 11.52941176 4.12195122 1.290553266 1.52E-11 2.67E-07 42CD8+ T cell cured IFITM1 1 0.998 13.79069767 7.966183575 0.722124163 5.07E-12 8.90E-08 25CD8+ T cell cured IFITM1 0.648 0.156 2.521126761 0.418439716 1.311732328 4.55E-12 7.98E-08 30CD141+CLEC9A+ dendritic cell cured IFITM1 1 0.991 16.21568627 8.877761414 0.801467665 4.81E-13 8.44E-09 19CD4+ cytotoxic T cell cured IFITM1 0.979 0.936 3.371134021 1.474358974 0.820952794 3.00E-14 5.27E-10 36CD141+CLEC9A+ dendritic cell cured IFITM1 1 0.967 7.78125 4.618905473 0.64413719 3.82E-15 6.71E-11 14Megakaryocyte progenitor cell cured IFITM1 1 0.951 11.65909091 6.109756098 0.83230183 1.28E-16 2.25E-12 27CD8+ T cell cured IFITM1 1 0.969 9.25 5.238636364 0.716321284 1.08E-16 1.89E-12 24T cell cured IFITM1 1 0.978 3.90625 2.045494313 0.687944338 1.96E-18 3.44E-14 13Megakaryocyte progenitor cell cured IFITM1 0.996 0.965 9.697478992 5.279538905 0.768540312 9.69E-27 1.70E-22 23CD4+ T cell cured IFITM1 0.997 0.98 9.184210526 5.334289813 0.685079366 6.27E-31 1.10E-26 15CD4+ T cell cured IFITM1 1 0.904 10.56862745 3.520477816 1.355670528 1.50E-31 2.63E-27 21Plasmacytoid dendritic cell cured IFITM1 1 0.993 13.16216216 7.043657331 0.816118013 1.48E-33 2.60E-29 10Effector CD8+ memory T (Tem) cell cured IFITM1 0.995 0.823 3.009302326 1.55387931 0.650660861 2.62E-34 4.60E-30 20CD1C+_B dendritic cell cured IFITM1 0.987 0.941 15.48717949 7.659090909 0.92905714 1.21E-35 2.12E-31 18Memory B cell cured IFITM1 0.997 0.975 9.709273183 5.547749726 0.709789487 1.23E-47 2.15E-43 11CD4+ T cell cured IFITM1 1 1 8.276346604 4.125498008 0.855864539 7.93E-48 1.39E-43 17T cell (Activated T cell) cured IFITM1 0.516 0.137 1.103618421 0.279338843 0.717474611 5.61E-63 9.85E-59 9CD1C+_B dendritic cell cured IFITM1 0.74 0.328 2.031982942 0.47047619 1.043978212 4.21E-65 7.39E-61 16CD141+CLEC9A+ dendritic cell cured IFITM1 0.988 0.968 8.521212121 4.847994825 0.703203216 1.94E-67 3.41E-63 7CD8+ T cell cured IFITM1 0.994 0.943 9.532212885 4.558787879 0.921966352 1.45E-68 2.54E-64 12CD8+ T cell cured IFITM1 0.956 0.389 8.264150943 1.070454545 2.161711229 8.59E-79 1.51E-74 22CD1C-CD141- dendritic cell cured IFITM1 0.997 0.982 9.564176245 5.467569494 0.70788472 3.70E-101 6.50E-97 5Naive CD8+ T cell cured IFITM1 1 0.994 13.46698679 7.689732143 0.735380854 1.61E-143 2.83E-139 3Effector CD8+ memory T (Tem) cell cured IFITM1 1 0.976 11.34968354 5.58662614 0.906862504 9.63E-148 1.69E-143 4CD4+ T cell cured IFITM1 1 0.999 21.7690387 12.84896206 0.717295528 6.07E-153 1.06E-148 6Effector CD8+ memory T (Tem) cell cured IFITM1 0.853 0.387 2.91226321 0.592820513 1.29641973 4.61E-187 8.09E-183 8CD141+CLEC9A+ dendritic cell cured IFITM2 0.867 0.634 2.390625 1.21875 0.611804113 2.34E-13 4.10E-09 24T cell cured IFITM2 0.915 0.638 4.070422535 1.446808511 1.051204778 1.05E-13 1.84E-09 30CD141+CLEC9A+ dendritic cell cured IFITM2 0.941 0.703 3.843137255 1.511945392 0.947136788 8.79E-16 1.54E-11 21Plasmacytoid dendritic cell cured IFITM2 0.932 0.714 3.41025641 1.767045455 0.672516192 3.20E-22 5.62E-18 18Memory B cell cured IFITM2 0.994 0.991 17.39622642 9.029545455 0.875153636 7.09E-32 1.24E-27 22CD1C-CD141- dendritic cell cured IFITM2 0.885 0.621 2.901960784 1.317575758 0.75158278 2.78E-41 4.87E-37 12CD8+ T cell cured IFITM2 0.933 0.737 3.411184211 1.938842975 0.585917732 3.82E-44 6.70E-40 9CD1C+_B dendritic cell cured IFITM2 0.907 0.724 2.939873418 1.560283688 0.621845604 4.31E-66 7.56E-62 4CD4+ T cell cured IFITM3 0.975 0.75 4.728395062 1.805555556 1.029844511 2.44E-10 4.28E-06 34CD1C-CD141- dendritic cell cured IFITM3 0.969 0.825 2.1875 1.052493438 0.635047732 6.31E-17 1.11E-12 13Megakaryocyte progenitor cell cured IFITM3 0.782 0.547 2.200854701 1.020833333 0.663506847 6.21E-23 1.09E-18 18Memory B cell cured IFITM3 0.995 0.834 7.097674419 3.346982759 0.897493265 2.73E-30 4.79E-26 20CD1C+_B dendritic cell cured IFITM3 0.958 0.745 15.49295775 2.666666667 2.169309123 2.41E-31 4.23E-27 30CD141+CLEC9A+ dendritic cell cured IFITM3 1 1 43.21383648 17.86363636 1.228890111 2.47E-65 4.34E-61 22CD1C-CD141- dendritic cell cured IFITM3 0.998 0.927 10.98684211 4.538842975 1.113795091 5.94E-127 1.04E-122 9CD1C+_B dendritic cell cured IRF1 0.831 0.475 1.784615385 0.744262295 0.674861071 9.09E-10 1.60E-05 26CD8+ T cell cured IRF1 0.767 0.372 2 0.560386473 0.943059104 5.42E-13 9.51E-09 25CD8+ T cell cured IRF1 0.843 0.487 2.607843137 0.826215022 0.982279973 1.54E-17 2.71E-13 19CD4+ cytotoxic T cell cured IRF1 0.774 0.423 1.889555822 0.702566964 0.763136199 3.08E-103 5.40E-99 3Effector CD8+ memory T (Tem) cell cured IRF7 0.42 0.085 0.647727273 0.091463415 0.594213699 4.08E-12 7.16E-08 27CD8+ T cell cured IRF7 0.581 0.09 0.967741935 0.099547511 0.839631083 3.29E-13 5.77E-09 28CD8+ T cell cured IRF7 0.718 0.291 1.535211268 0.368794326 0.889200292 1.41E-13 2.48E-09 30CD141+CLEC9A+ dendritic cell cured IRF7 0.471 0.061 0.666666667 0.071672355 0.6371017 9.77E-15 1.71E-10 21Plasmacytoid dendritic cell cured IRF7 0.529 0.091 0.784313725 0.103092784 0.693815154 5.51E-16 9.68E-12 19CD4+ cytotoxic T cell cured IRF7 0.465 0.08 0.720930233 0.084541063 0.666103934 1.60E-16 2.81E-12 25CD8+ T cell cured IRF7 0.508 0.095 0.753846154 0.101639344 0.670870211 4.83E-18 8.47E-14 26CD8+ T cell cured IRF7 0.792 0.455 1.748427673 0.627272727 0.75615045 7.89E-29 1.39E-24 22CD1C-CD141- dendritic cell cured IRF7 0.603 0.309 1.119402985 0.401904762 0.596269586 2.79E-34 4.89E-30 16CD141+CLEC9A+ dendritic cell cured IRF7 0.542 0.197 0.93220339 0.247179487 0.63157786 1.82E-75 3.19E-71 8CD141+CLEC9A+ dendritic cell cured IRF7 0.624 0.21 1.146067416 0.256979241 0.771734573 1.17E-120 2.05E-116 6Effector CD8+ memory T (Tem) cell cured IRF7 0.457 0.08 0.667466987 0.08984375 0.613536887 3.86E-124 6.78E-120 3Effector CD8+ memory T (Tem) cell cured IRF7 0.557 0.145 0.930795848 0.175373134 0.716076801 2.28E-142 4.00E-138 2Effector CD8+ memory T (Tem) cell cured ISG15 0.569 0.179 0.921568627 0.216723549 0.65928309 2.67E-12 4.69E-08 21Plasmacytoid dendritic cell cured ISG15 0.677 0.281 2 0.366515837 1.134460321 1.24E-13 2.18E-09 28CD8+ T cell cured ISG15 0.667 0.365 1.81372549 0.471153846 0.93553346 1.06E-14 1.87E-10 31Plasmacytoid dendritic cell cured ISG15 0.523 0.134 0.920454545 0.152439024 0.736757398 8.38E-15 1.47E-10 27CD8+ T cell cured ISG15 0.377 0.095 0.879069767 0.170258621 0.68319124 1.12E-17 1.96E-13 20CD1C+_B dendritic cell cured ISG15 0.554 0.187 1.015384615 0.203278689 0.744084368 5.16E-21 9.05E-17 26CD8+ T cell cured ISG15 0.803 0.17 1.971830986 0.205673759 1.301512485 3.47E-24 6.10E-20 30CD141+CLEC9A+ dendritic cell cured ISG15 0.477 0.203 0.891891892 0.232289951 0.618487898 9.15E-36 1.61E-31 10Effector CD8+ memory T (Tem) cell cured ISG15 0.645 0.297 1.948717949 0.452651515 1.021399184 3.14E-37 5.51E-33 18Memory B cell cured ISG15 0.887 0.448 2.691823899 0.684090909 1.132363719 1.44E-44 2.52E-40 22CD1C-CD141- dendritic cell cured ISG15 0.651 0.293 1.75 0.495867769 0.878448969 8.84E-69 1.55E-64 9CD1C+_B dendritic cell cured ISG15 0.554 0.272 1.051903114 0.353233831 0.600551462 1.40E-89 2.46E-85 2Effector CD8+ memory T (Tem) cell cured ISG15 0.642 0.296 1.329588015 0.367931281 0.768079081 2.37E-123 4.15E-119 6Effector CD8+ memory T (Tem) cell cured ISG15 0.601 0.214 1.111644658 0.254464286 0.751295684 2.76E-146 4.85E-142 3Effector CD8+ memory T (Tem) cell cured ISG15 0.357 0.034 0.642857143 0.034482759 0.667297434 0 0 40Plasmacytoid dendritic cell cured ISG15 0.559 0.22 1.205882353 0.219512195 0.855051664 0 0 42CD8+ T cell cured ISG15 0.882 0.113 1 0.113207547 0.845277405 0 0 43AXL+SIGLEC6+ dendritic cell cured ISG20 0.784 0.454 1.745098039 0.658703072 0.726802026 1.45E-11 2.55E-07 21Plasmacytoid dendritic cell cured ISG20 0.903 0.484 2.322580645 0.674208145 0.988825316 1.30E-13 2.28E-09 28CD8+ T cell cured ISG20 0.781 0.055 0.96875 0.074365704 0.873794766 1.09E-22 1.92E-18 13Megakaryocyte progenitor cell cured ISG20 0.765 0.151 1.823529412 0.150943396 1.294682776 0 0 43AXL+SIGLEC6+ dendritic cell cured ISG20 0.833 0.294 1.666666667 0.294117647 1.043068722 0 0 45CD1C-CD141- dendritic cell cured MT2A 0.662 0.542 2.512820513 1.238636364 0.650009663 2.63E-11 4.62E-07 18Memory B cell cured MT2A 0.406 0.023 0.875 0.055993001 0.828290323 1.99E-13 3.50E-09 13Megakaryocyte progenitor cell cured MX1 0.732 0.213 1.887323944 0.368794326 1.076827295 2.02E-13 3.54E-09 30CD141+CLEC9A+ dendritic cell cured MX1 0.667 0.163 2.029411765 0.25 1.277109591 2.42E-15 4.25E-11 31Plasmacytoid dendritic cell cured MX1 0.629 0.207 1.150943396 0.336363636 0.686656928 2.06E-20 3.61E-16 22CD1C-CD141- dendritic cell cured MX1 0.316 0.06 0.906323185 0.12749004 0.757678036 1.64E-25 2.88E-21 17T cell (Activated T cell) cured MX1 0.603 0.182 1.491452991 0.297348485 0.941421295 2.37E-32 4.16E-28 18Memory B cell cured MX1 0.71 0.312 1.601279318 0.497142857 0.79700943 1.57E-43 2.75E-39 16CD141+CLEC9A+ dendritic cell cured MX1 0.434 0.096 0.736842105 0.106169297 0.650894402 7.73E-44 1.36E-39 15CD4+ T cell cured MX1 0.633 0.212 1.470394737 0.403305785 0.815912173 3.14E-72 5.51E-68 9CD1C+_B dendritic cell cured MX1 0.568 0.197 1.182452642 0.261538462 0.790766157 2.08E-88 3.65E-84 8CD141+CLEC9A+ dendritic cell cured MX1 0.474 0.077 0.797752809 0.100930565 0.707471181 2.28E-106 4.01E-102 6Effector CD8+ memory T (Tem) cell cured MX1 0.381 0.049 0.618512111 0.065298507 0.603410416 3.50E-112 6.15E-108 2Effector CD8+ memory T (Tem) cell cured MX1 0.487 0.119 0.767405063 0.130192503 0.645064199 2.01E-123 3.53E-119 4CD4+ T cell cured MX1 0.435 0.091 0.75862069 0.099073414 0.678156591 4.67E-125 8.21E-121 5Naive CD8+ T cell cured MX1 0.341 0.03 0.659090909 0.030487805 0.687065509 0 0 27CD8+ T cell cured MX1 0.351 0.094 0.648648649 0.094202899 0.591403689 0 0 35CD8+ T cell cured MX2 0.493 0.135 0.732394366 0.14893617 0.592468735 5.89E-10 1.03E-05 30CD141+CLEC9A+ dendritic cell cured OAS1 0.648 0.199 1 0.226950355 0.704923125 3.42E-12 6.00E-08 30CD141+CLEC9A+ dendritic cell cured OAS1 0.333 0.027 0.568627451 0.030716724 0.605854868 1.27E-13 2.23E-09 21Plasmacytoid dendritic cell cured OAS1 0.471 0.043 0.647058824 0.045655376 0.655484631 3.83E-20 6.72E-16 19CD4+ cytotoxic T cell cured OAS1 0.899 0.752 3.333333333 1.645454545 0.711961588 2.31E-20 4.05E-16 22CD1C-CD141- dendritic cell cured OAS1 0.588 0.236 1.044776119 0.337142857 0.612789285 4.56E-32 8.00E-28 16CD141+CLEC9A+ dendritic cell cured OAS1 0.487 0.087 0.923076923 0.113636364 0.788138246 3.63E-36 6.36E-32 18Memory B cell cured OAS1 0.476 0.119 0.758723829 0.151794872 0.610645151 2.73E-75 4.79E-71 8CD141+CLEC9A+ dendritic cell cured OAS1 0.453 0.069 0.669163546 0.078740157 0.629777921 2.17E-109 3.80E-105 6Effector CD8+ memory T (Tem) cell cured OAS1 0.512 0.039 0.76744186 0.038647343 0.766956867 0 0 25CD8+ T cell cured OAS2 0.333 0.053 1 0.052631579 0.925999419 0 0 41Megakaryocyte progenitor cell cured OASL 0.492 0.118 0.707692308 0.131147541 0.594260934 1.52E-12 2.67E-08 26CD8+ T cell cured PLSCR1 0.516 0.054 0.709677419 0.063348416 0.685109757 2.02E-09 3.54E-05 28CD8+ T cell cured PLSCR1 0.755 0.311 1.427672956 0.397727273 0.796491195 3.23E-34 5.68E-30 22CD1C-CD141- dendritic cell cured PLSCR1 0.667 0.013 0.666666667 0.026315789 0.699490889 0 0 41Megakaryocyte progenitor cell cured TRIM22 0.667 0.314 1.098039216 0.393225331 0.590613035 2.77E-09 4.86E-05 19CD4+ cytotoxic T cell cured TRIM22 0.765 0.094 0.823529412 0.094339623 0.736672929 0 0 43AXL+SIGLEC6+ dendritic cell cured XAF1 0.516 0.19 0.935483871 0.212669683 0.674507654 1.26E-11 2.21E-07 28CD8+ T cell cured XAF1 0.577 0.184 1.028169014 0.205673759 0.750338298 6.00E-14 1.05E-09 30CD141+CLEC9A+ dendritic cell cured XAF1 0.353 0.114 0.869767442 0.200431034 0.639306319 8.69E-16 1.53E-11 20CD1C+_B dendritic cell cured XAF1 0.648 0.298 1.081761006 0.340909091 0.634593021 3.08E-32 5.40E-28 22CD1C-CD141- dendritic cell cured XAF1 0.5 0.294 1 0.294117647 0.628031223 0 0 45CD1C-CD141- dendritic cell Table S8 The differential expression of MAPK signal genes in each cell (sub)types of COVID-19 patients with normals

Disease Symbol pct.1 pct.2 case_Mean_UMI_Countscontrol_Mean_UMI_CountsLog2_Fold_ChangePvalue AdjustPvalue ClusterCell (sub)type condition critical DUSP1 0.961 0.393 4.87254902 0.715360139 1.77547535 0 0 1CD4+ T cell critical DDIT4 0.903 0.105 3.161290323 0.193473193 1.801864783 2.68E-24 4.65E-20 22CD1C-CD141- dendritic cell critical DDIT4 0.734 0.138 2.560229446 0.27954779 1.476336189 2.69E-128 4.67E-124 8CD1C+_B dendritic cell critical DUSP1 0.929 0.651 5.5 1.349056604 1.468358241 1.70E-09 2.94E-05 39CD4+ T cell critical DUSP1 1 0.549 6 1.15037594 1.702766021 3.20E-10 5.55E-06 31CD8+ T cell critical DUSP1 0.838 0.264 5.459459459 0.67816092 1.944532379 2.50E-11 4.33E-07 33CD1C-CD141- dendritic cell critical DUSP1 0.663 0.754 4.891089109 2.856201976 0.611353758 2.38E-12 4.12E-08 14CD8+ T cell critical DUSP1 0.85 0.626 3.29 1.538654934 0.756913337 9.15E-14 1.59E-09 5CD4+ cytotoxic T cell critical DUSP1 1 0.614 4.244897959 1.6069869 1.008531372 8.91E-14 1.54E-09 20CD4+ T helper critical DUSP1 0.964 0.632 5.196428571 1.75308642 1.170387033 5.58E-17 9.67E-13 21CD4+ cytotoxic T cell critical DUSP1 0.985 0.585 5.646153846 2.016200295 1.139787453 1.11E-18 1.93E-14 17CD4+ T cell critical DUSP1 0.991 0.927 6.174528302 2.701986755 0.95458425 4.30E-22 7.46E-18 25CD4+ cytotoxic T cell critical DUSP1 0.941 0.552 4.8 1.586894587 1.164831633 5.58E-24 9.67E-20 11Megakaryocyte progenitor cell critical DUSP1 0.982 0.333 6.98245614 1.533880903 1.655484004 2.69E-45 4.66E-41 18Megakaryocyte progenitor cell critical DUSP1 0.971 0.57 6.557971014 1.915621437 1.374195573 3.67E-49 6.37E-45 13CD4+ T helper critical DUSP1 0.921 0.49 4.619047619 1.114911081 1.409728619 2.39E-54 4.15E-50 6CD4+ T cell critical DUSP1 0.967 0.569 6.490196078 1.829850746 1.404277523 5.44E-57 9.43E-53 12Megakaryocyte progenitor cell critical DUSP1 0.987 0.326 7.562913907 1.47819063 1.788814652 1.71E-64 2.96E-60 16B cell critical DUSP1 0.96 0.789 7.634615385 3.382306477 0.978441534 3.93E-103 6.81E-99 2CD4+ cytotoxic T cell critical DUSP1 0.993 0.471 7.995024876 2.106164384 1.53399309 3.06E-127 5.30E-123 10B cell critical DUSP1 0.993 0.449 8.109339408 1.99702381 1.603815891 1.12E-148 1.94E-144 9Effector CD8+ memory T (Tem) cell critical FOS 0.98 0.57 3.408163265 1.681222707 0.717286601 6.59E-10 1.14E-05 20CD4+ T helper critical FOS 0.918 0.477 3.623529412 1.582146249 0.840423851 1.89E-16 3.28E-12 11Megakaryocyte progenitor cell critical FOS 0.826 0.441 4.731884058 2.462941847 0.727011267 8.50E-17 1.47E-12 13CD4+ T helper critical FOS 0.817 0.433 4.535947712 2.261691542 0.763209964 1.16E-18 2.01E-14 12Megakaryocyte progenitor cell critical FOS 0.667 0.17 3.219298246 0.540041068 1.454034246 6.63E-24 1.15E-19 18Megakaryocyte progenitor cell critical FOS 0.735 0.179 3.377483444 0.647819063 1.409543885 9.27E-37 1.61E-32 16B cell critical FOS 0.902 0.667 7.694230769 4.464770932 0.669897366 6.16E-39 1.07E-34 2CD4+ cytotoxic T cell critical FOS 0.841 0.337 3.801587302 0.866621067 1.363082325 3.88E-40 6.73E-36 6CD4+ T cell critical FOS 0.898 0.377 5.02238806 1.976027397 1.016947865 2.52E-74 4.36E-70 10B cell critical FOS 0.902 0.355 4.924829157 1.854166667 1.053703972 1.66E-89 2.88E-85 9Effector CD8+ memory T (Tem) cell critical FOS 0.824 0.281 3.225490196 0.4741105 1.519274043 1.09E-269 1.89E-265 1CD4+ T cell critical IER2 0.613 0.51 3.735849057 1.549668874 0.893313203 8.82E-11 1.53E-06 25CD4+ cytotoxic T cell critical IER2 0.507 0.777 0.993055556 3.05890139 -1.026107365 5.16E-37 8.94E-33 4CD8+ T cell critical IER2 0.414 0.646 0.665898618 1.602046617 -0.643346205 1.71E-60 2.96E-56 3CD4+ T cell critical JUN 0.923 0.695 8.292307692 3.110456554 1.176738281 5.74E-13 9.94E-09 17CD4+ T cell critical JUN 0.361 0.51 1.124282983 2.829393628 -0.850139999 3.60E-18 6.24E-14 8CD1C+_B dendritic cell critical JUN 0.83 0.699 5.677083333 9.701522171 -0.680526067 1.99E-19 3.45E-15 4CD8+ T cell critical JUN 0.942 0.648 7.652173913 3.374002281 0.984108692 6.22E-20 1.08E-15 13CD4+ T helper critical JUN 0.941 0.64 7.352941176 3.195024876 0.993604913 5.96E-23 1.03E-18 12Megakaryocyte progenitor cell critical JUN 0.905 0.492 4.801587302 1.819425445 1.041046479 1.37E-24 2.38E-20 6CD4+ T cell critical JUN 0.939 0.4 5.605263158 1.630390144 1.328339242 8.13E-30 1.41E-25 18Megakaryocyte progenitor cell critical JUN 0.94 0.404 5.947019868 1.765751212 1.328722836 2.14E-40 3.71E-36 16B cell critical JUN 0.94 0.767 9.490384615 5.219273302 0.754249651 1.68E-43 2.92E-39 2CD4+ cytotoxic T cell critical JUN 0.809 0.669 1.6171875 3.708563536 -0.847269712 4.28E-46 7.41E-42 15CD1C+_B dendritic cell critical JUN 0.973 0.55 7.957711443 3.207762557 1.090076897 7.44E-77 1.29E-72 10B cell critical JUN 0.97 0.533 7.876993166 3.084325397 1.119973277 7.57E-90 1.31E-85 9Effector CD8+ memory T (Tem) cell critical JUN 0.917 0.563 4.712418301 1.636679202 1.115379574 1.85E-134 3.21E-130 1CD4+ T cell critical JUNB 0.748 0.577 2.728476821 1.381260097 0.646861163 1.97E-09 3.41E-05 16B cell critical JUNB 0.75 0.644 0.75 1.815068493 -0.685815103 0 0 30Plasmacytoid dendritic cell critical JUND 0.622 0.057 2.72972973 0.287356322 1.534659665 8.26E-10 1.43E-05 33CD1C-CD141- dendritic cell critical NR4A1 0.161 0.566 0.161290323 1.104895105 -0.858019649 0 0 22CD1C-CD141- dendritic cell server ATF3 0.598 0.209 1.149466192 0.351633987 0.669273886 4.71E-31 8.31E-27 15CD1C+_B dendritic cell server ATF3 0.699 0.309 1.576923077 0.365426696 0.916297609 1.49E-48 2.63E-44 21CD1C-CD141- dendritic cell server ATF3 0.786 0.384 1.63 0.577850877 0.737101937 2.81E-62 4.96E-58 9CD1C+_B dendritic cell server DDIT4 0.389 0.189 1.166666667 0.295857988 0.741569594 3.67E-11 6.47E-07 26 T cell server DDIT4 0.116 0.395 0.115942029 0.713178295 -0.61841322 0 0 35Effector CD8+ memory T (Tem) cell server DUSP1 0.8 0.592 3.188888889 1.467455621 0.76354348 4.84E-09 8.54E-05 26 T cell server DUSP1 0.809 0.605 4.221276596 2.150819672 0.728675399 1.17E-13 2.06E-09 17CD4+ T cell server DUSP1 0.851 0.569 3.904255319 1.814084507 0.801368435 3.02E-14 5.33E-10 23CD4+ T cell server DUSP1 0.78 0.548 3.292682927 1.555973659 0.748006645 2.01E-17 3.54E-13 12Megakaryocyte progenitor cell server DUSP1 1 0.814 8.658291457 3.946902655 0.96524249 6.53E-18 1.15E-13 30CD1C-CD141- dendritic cell server DUSP1 0.914 0.277 5.8 0.710843373 1.990827058 1.79E-18 3.16E-14 38Plasmacytoid dendritic cell server DUSP1 0.944 0.759 2.039106145 0.907692308 0.671818567 1.01E-32 1.77E-28 27Megakaryocyte progenitor cell server DUSP1 0.849 0.557 4.720626632 1.850446429 1.004985299 9.42E-43 1.66E-38 11CD4+ T cell server DUSP1 0.994 0.631 3.987692308 1.68875502 0.891434154 5.84E-52 1.03E-47 18CD4+ T helper server DUSP1 0.925 0.332 7.52173913 1.528846154 1.752668617 6.59E-54 1.16E-49 19CD141+CLEC9A+ dendritic cell server DUSP1 0.894 0.727 4.408543264 2.307238606 0.709612936 2.77E-65 4.88E-61 2CD4+ T cell server DUSP1 0.579 0.597 1.614035088 4.637313433 -1.108729277 8.38E-66 1.48E-61 5Effector CD8+ memory T (Tem) cell server DUSP1 0.991 0.871 9.488054608 4.85785124 0.840303641 1.73E-73 3.05E-69 7CD4+ T cell server DUSP1 0.985 0.939 2.665 1.237288136 0.712062128 4.13E-83 7.29E-79 14Megakaryocyte progenitor cell server DUSP1 0.884 0.492 3.329545455 1.093406593 1.048363022 2.74E-87 4.83E-83 6CD8+ T cell server DUSP1 0.978 0.47 8.824657534 2.081986143 1.672546744 9.18E-119 1.62E-114 13CD141+CLEC9A+ dendritic cell server DUSP1 0.698 0.366 1.881998277 0.645919779 0.808175452 1.53E-132 2.69E-128 1Naive CD4+ T cell server DUSP2 0.45 0.782 0.8625 4.229480737 -1.489427275 1.22E-16 2.16E-12 20CD141+CLEC9A+ dendritic cell server DUSP2 0.211 0.578 0.330827068 2.358381503 -1.335443011 8.79E-18 1.55E-13 31CD8 cytoxict cells server DUSP2 0.533 0.154 1.033333333 0.183431953 0.780869988 1.04E-18 1.83E-14 26 T cell server DUSP2 0.349 0.651 0.712871287 2.609501738 -1.075382954 3.34E-43 5.90E-39 10CD8+ T cell server DUSP2 0.067 0.306 0.082934609 1.155970149 -0.993391072 5.72E-55 1.01E-50 5Effector CD8+ memory T (Tem) cell server DUSP2 0.422 0.188 0.959474261 0.269705094 0.625973172 2.13E-68 3.75E-64 2CD4+ T cell server FOS 0.77 0.493 4.072340426 2.367213115 0.59109654 5.17E-13 9.13E-09 17CD4+ T cell server FOS 0.785 0.471 3.136585366 1.523047977 0.713272715 4.19E-17 7.39E-13 12Megakaryocyte progenitor cell server FOS 1 0.77 26.2160804 13.85840708 0.873179851 1.93E-19 3.40E-15 30CD1C-CD141- dendritic cell server FOS 0.957 0.253 8.171428571 1.204819277 2.056486063 2.39E-21 4.22E-17 38Plasmacytoid dendritic cell server FOS 0.961 0.754 3.374301676 1.297435897 0.929028112 2.29E-26 4.05E-22 27Megakaryocyte progenitor cell server FOS 0.77 0.427 4.496083551 2.373883929 0.703993594 1.43E-28 2.52E-24 11CD4+ T cell server FOS 0.987 0.761 36.00641026 16.56236324 1.075288205 1.68E-35 2.96E-31 21CD1C-CD141- dendritic cell server FOS 0.739 0.184 3.068322981 0.671474359 1.283312995 4.17E-38 7.36E-34 19CD141+CLEC9A+ dendritic cell server FOS 0.72 0.339 2.320454545 0.840659341 0.851158104 1.25E-50 2.20E-46 6CD8+ T cell server FOS 0.585 0.516 1.435406699 3.424626866 -0.861393082 7.70E-60 1.36E-55 5Effector CD8+ memory T (Tem) cell server FOS 0.995 0.939 4.55 1.73940678 1.018624261 3.34E-62 5.89E-58 14Megakaryocyte progenitor cell server FOS 0.991 0.59 6.046153846 1.773092369 1.345340303 8.22E-68 1.45E-63 18CD4+ T helper server FOS 0.932 0.375 8.120547945 1.974595843 1.616426838 1.58E-91 2.79E-87 13CD141+CLEC9A+ dendritic cell server FOS 0.649 0.265 1.514211886 0.424965422 0.819179327 9.02E-149 1.59E-144 1Naive CD4+ T cell server FOS 0.2 0.033 1.511111111 0.032786885 1.28178328 0 0 43Plasmacytoid dendritic cell server FOSB 0.628 0.234 1.358974359 0.332603939 0.823911674 8.22E-26 1.45E-21 21CD1C-CD141- dendritic cell server FOSB 0.884 0.511 2.322 0.921052632 0.790155028 1.02E-68 1.81E-64 9CD1C+_B dendritic cell server FOSB 0.314 0.036 0.842857143 0.072289157 0.781250239 0 0 38Plasmacytoid dendritic cell server IER2 0.9 0.289 1.771428571 0.614457831 0.779580066 2.70E-15 4.76E-11 38Plasmacytoid dendritic cell server IER2 0.857 0.289 3.142857143 0.377777778 1.588282859 5.58E-16 9.84E-12 41Naive CD8+ T cell server IER2 0.733 0.363 3 0.593137255 1.328129434 7.23E-17 1.28E-12 32Naive CD8+ T cell server IER2 0.928 0.374 2.652173913 0.969387755 0.891008274 3.00E-17 5.30E-13 28CD1C+_B dendritic cell server IER2 0.897 0.742 5.269230769 2.312910284 0.920189301 2.18E-17 3.85E-13 21CD1C-CD141- dendritic cell server IER2 0.96 0.522 3.447236181 1.716814159 0.710993141 1.08E-20 1.90E-16 30CD1C-CD141- dendritic cell server IER2 0.932 0.692 5.395017794 3.014379085 0.671771514 5.45E-23 9.62E-19 15CD1C+_B dendritic cell server IER2 0.803 0.4 3.074468085 0.797183099 1.180874331 1.06E-30 1.87E-26 23CD4+ T cell server IER2 0.936 0.748 5.102 2.729166667 0.710428903 6.22E-34 1.10E-29 9CD1C+_B dendritic cell server IER2 0.822 0.37 3.322222222 0.547337278 1.481985549 1.96E-41 3.45E-37 26 T cell server IER2 0.922 0.179 1.430167598 0.271794872 0.934189817 8.04E-51 1.42E-46 27Megakaryocyte progenitor cell server IER2 0.611 0.319 1.504545455 0.465659341 0.772998974 1.40E-64 2.48E-60 6CD8+ T cell server IER2 0.776 0.363 2.824390244 0.595484478 1.261235172 3.45E-68 6.09E-64 12Megakaryocyte progenitor cell server IER2 0.791 0.384 3.753191489 0.655737705 1.521422379 1.79E-70 3.16E-66 17CD4+ T cell server IER2 0.768 0.398 3.27154047 0.763392857 1.27640253 4.71E-75 8.31E-71 11CD4+ T cell server IER2 0.652 0.76 1.108452951 2.752238806 -0.83156682 4.63E-78 8.18E-74 5Effector CD8+ memory T (Tem) cell server IER2 0.869 0.546 3.730375427 1.118181818 1.159128257 1.75E-107 3.09E-103 7CD4+ T cell server IER2 0.982 0.289 2.996923077 0.803212851 1.148320105 3.76E-111 6.64E-107 18CD4+ T helper server IER2 0.99 0.178 1.44 0.257415254 0.956419978 6.15E-115 1.08E-110 14Megakaryocyte progenitor cell server IER2 0.801 0.452 3.669222344 0.924932976 1.278374076 7.30E-162 1.29E-157 2CD4+ T cell server IER2 0.771 0.321 2.612403101 0.459543568 1.307441612 0 0 1Naive CD4+ T cell server JUN 1 0.543 9.108108108 2.1 1.705172879 5.34E-13 9.42E-09 37CD8+ T cell server JUN 0.986 0.823 6.202898551 2.411564626 1.078144039 7.80E-14 1.38E-09 28CD1C+_B dendritic cell server JUN 1 0.559 8.702702703 1.934210526 1.725414282 7.32E-16 1.29E-11 36CD8+ T cell server JUN 1 0.544 8.428571429 1.577777778 1.870911299 5.03E-16 8.88E-12 41Naive CD8+ T cell server JUN 0.978 0.471 6.733333333 1.382352941 1.698703238 1.39E-19 2.46E-15 32Naive CD8+ T cell server JUN 1 0.386 10.5 1.373493976 2.276549568 1.37E-23 2.43E-19 38Plasmacytoid dendritic cell server JUN 1 0.752 11.89447236 3.008849558 1.685492557 3.36E-24 5.93E-20 30CD1C-CD141- dendritic cell server JUN 0.957 0.682 8.462633452 3.864052288 0.960083004 1.73E-33 3.06E-29 15CD1C+_B dendritic cell server JUN 0.933 0.689 12.35555556 2.74260355 1.835325851 6.84E-36 1.21E-31 26 T cell server JUN 0.955 0.764 2.446927374 0.984615385 0.796451459 4.93E-41 8.70E-37 27Megakaryocyte progenitor cell server JUN 0.968 0.645 12.80319149 3.408450704 1.646658244 2.67E-43 4.70E-39 23CD4+ T cell server JUN 0.833 0.214 5.448717949 0.822757112 1.822890041 1.39E-46 2.46E-42 21CD1C-CD141- dendritic cell server JUN 0.844 0.488 6.956 2.734649123 1.091070571 1.77E-49 3.13E-45 9CD1C+_B dendritic cell server JUN 0.64 0.625 2.397129187 7.558208955 -1.332992822 4.86E-58 8.58E-54 5Effector CD8+ memory T (Tem) cell server JUN 0.938 0.402 10.40993789 1.761217949 2.046914266 4.35E-59 7.67E-55 19CD141+CLEC9A+ dendritic cell server JUN 0.983 0.703 12.58297872 3.316393443 1.653901616 7.05E-66 1.24E-61 17CD4+ T cell server JUN 0.997 0.606 7.590769231 2.604417671 1.253021122 4.83E-69 8.51E-65 18CD4+ T helper server JUN 0.966 0.661 10.93170732 2.647224835 1.709929451 1.70E-73 3.00E-69 12Megakaryocyte progenitor cell server JUN 0.981 0.762 15.4334471 5.845454545 1.263416887 6.56E-94 1.16E-89 7CD4+ T cell server JUN 0.969 0.637 12.34464752 3.302455357 1.633029071 2.75E-94 4.86E-90 11CD4+ T cell server JUN 0.989 0.554 15.22739726 3.236720554 1.937411743 2.65E-119 4.68E-115 13CD141+CLEC9A+ dendritic cell server JUN 0.995 0.94 3.06 1.217161017 0.872766181 1.97E-133 3.47E-129 14Megakaryocyte progenitor cell server JUN 0.957 0.49 8.922727273 1.78021978 1.835537767 1.74E-155 3.08E-151 6CD8+ T cell server JUN 0.973 0.79 14.68236583 4.908310992 1.408325548 3.30E-175 5.83E-171 2CD4+ T cell server JUN 0.96 0.547 8.274763135 1.523858921 1.877679169 0 0 1Naive CD4+ T cell server JUNB 0.946 0.671 7.486486486 2.185714286 1.4135505 7.47E-11 1.32E-06 37CD8+ T cell server JUNB 0.971 0.789 10.11428571 2.944444444 1.49452121 7.31E-12 1.29E-07 41Naive CD8+ T cell server JUNB 0.978 0.711 8.4 2.607843137 1.381524143 5.59E-13 9.86E-09 32Naive CD8+ T cell server JUNB 0.986 0.844 7.405797101 2.785714286 1.150819101 4.01E-13 7.08E-09 28CD1C+_B dendritic cell server JUNB 0.919 0.658 7.810810811 1.848684211 1.628979087 2.30E-14 4.05E-10 36CD8+ T cell server JUNB 1 0.788 4.381909548 2.309734513 0.701402647 1.21E-14 2.13E-10 30CD1C-CD141- dendritic cell server JUNB 0.971 0.373 3.271428571 0.927710843 1.147829994 4.06E-16 7.16E-12 38Plasmacytoid dendritic cell server JUNB 0.989 0.793 10.76666667 3.920118343 1.257940761 1.17E-22 2.07E-18 26 T cell server JUNB 0.984 0.797 11.54787234 5.033802817 1.056303301 3.21E-28 5.67E-24 23CD4+ T cell server JUNB 0.839 0.579 4.322981366 1.389423077 1.155572193 1.65E-30 2.92E-26 19CD141+CLEC9A+ dendritic cell server JUNB 0.95 0.8 2.184357542 1.025641026 0.652623802 2.31E-31 4.08E-27 27Megakaryocyte progenitor cell server JUNB 0.983 0.82 12.76170213 5.272131148 1.133631291 3.13E-36 5.52E-32 17CD4+ T cell server JUNB 0.956 0.776 10.0195122 3.789275635 1.202180987 3.37E-37 5.95E-33 12Megakaryocyte progenitor cell server JUNB 0.989 0.796 5.444839858 2.671895425 0.811619539 8.51E-45 1.50E-40 15CD1C+_B dendritic cell server JUNB 0.451 0.641 0.728867624 1.744776119 -0.666861071 5.13E-45 9.04E-41 5Effector CD8+ memory T (Tem) cell server JUNB 0.956 0.782 11.06266319 4.8046875 1.055258154 1.35E-46 2.38E-42 11CD4+ T cell server JUNB 0.994 0.653 4.836923077 1.977911647 0.970907105 2.68E-54 4.73E-50 18CD4+ T helper server JUNB 0.988 0.886 17.98122867 9.307438017 0.880887596 6.38E-61 1.13E-56 7CD4+ T cell server JUNB 0.954 0.872 11.73713034 5.808579088 0.903614624 1.34E-71 2.37E-67 2CD4+ T cell server JUNB 1 0.897 7.906 4.483552632 0.699666736 6.68E-74 1.18E-69 9CD1C+_B dendritic cell server JUNB 0.838 0.508 3.857534247 1.065819861 1.23350971 2.14E-78 3.78E-74 13CD141+CLEC9A+ dendritic cell server JUNB 0.99 0.948 2.49 1.224576271 0.649696473 9.08E-80 1.60E-75 14Megakaryocyte progenitor cell server JUNB 0.927 0.632 7.654545455 1.956043956 1.549790327 6.41E-126 1.13E-121 6CD8+ T cell server JUNB 0.957 0.713 8.786391042 2.404910097 1.523160225 0 0 1Naive CD4+ T cell server JUNB 0.378 0.049 1.288888889 0.049180328 1.125384768 0 0 43Plasmacytoid dendritic cell server JUND 0.744 0.422 1.583333333 0.58643326 0.70344698 1.40E-24 2.48E-20 21CD1C-CD141- dendritic cell server NR4A1 0.308 0.547 0.365384615 1.059080963 -0.592693156 9.38E-16 1.66E-11 21CD1C-CD141- dendritic cell moderate DUSP1 0.784 0.568 2.637889688 1.013513514 0.853386642 1.32E-09 2.45E-05 41CD8+ T cell moderate DUSP1 0.742 0.471 2.3885918 1.171122995 0.642244399 7.55E-12 1.40E-07 38CD8+ T cell moderate DUSP1 0.912 0.276 2.725490196 0.671052632 1.156673093 2.63E-24 4.90E-20 47Plasmacytoid dendritic cell moderate DUSP1 0.599 0.571 1.991635688 3.552208835 -0.605632245 5.81E-50 1.08E-45 12Plasmacytoid dendritic cell moderate DUSP1 0.783 0.512 2.80349345 1.274281806 0.741914091 5.56E-117 1.03E-112 3CD8+ T cell moderate DUSP1 0.833 0.415 3.85137881 1.843317972 0.770819387 5.87E-185 1.09E-180 5CD141+CLEC9A+ dendritic cell moderate DUSP2 0.445 0.579 0.937304075 2.530054645 -0.865640102 6.49E-19 1.21E-14 37CD8+ T cell moderate DUSP2 0.508 0.72 1.203108808 3.334285714 -0.976253509 1.70E-38 3.17E-34 27Effector CD8+ memory T (Tem) cell moderate DUSP2 0.425 0.643 0.971428571 2.512735327 -0.833353438 1.09E-62 2.03E-58 13CD8+ T cell moderate DUSP2 0.49 0.74 1.182356814 3.955729167 -1.183210345 5.53E-64 1.03E-59 22CD1C-CD141- dendritic cell moderate DUSP2 0.296 0.451 0.526618705 1.55942623 -0.745480651 6.51E-67 1.21E-62 16Effector CD8+ memory T (Tem) cell moderate FOS 0.5 0.339 1.671328671 0.779661017 0.585955023 6.28E-11 1.17E-06 42CD8+ T cell moderate FOS 0.98 0.891 11.75820569 5.512605042 0.970118801 5.49E-11 1.02E-06 33CD1C+_B dendritic cell moderate FOS 0.696 0.322 3.020942408 0.796610169 1.162256267 1.21E-11 2.26E-07 46CD8+ T cell moderate FOS 0.753 0.378 3.635491607 0.756756757 1.399807901 1.05E-13 1.95E-09 41CD8+ T cell moderate FOS 0.77 0.37 3.667546174 1.201680672 1.084059056 2.79E-15 5.19E-11 41CD8+ T cell moderate FOS 0.887 0.224 4.710784314 1.25 1.343763896 9.58E-25 1.78E-20 47Plasmacytoid dendritic cell moderate FOS 0.754 0.369 3.502673797 0.957219251 1.201976585 7.22E-25 1.34E-20 38CD8+ T cell moderate FOS 0.879 0.679 5.820654484 3.166666667 0.711016492 3.07E-43 5.71E-39 17CD4+ T cell moderate FOS 0.875 0.577 3.847527473 1.91002045 0.736219783 8.31E-45 1.55E-40 21T cell (Activated T cell) moderate FOS 0.62 0.303 2.893759071 1.421329822 0.685364009 1.40E-94 2.61E-90 5CD141+CLEC9A+ dendritic cell moderate FOS 0.525 0.278 1.468496569 0.456077016 0.761545974 7.25E-169 1.35E-164 1CD8+ T cell moderate FOS 0.755 0.37 3.676666034 1.205882353 1.084124559 6.17E-185 1.15E-180 3CD8+ T cell moderate FOSB 0.279 0.039 0.62745098 0.078947368 0.592989598 0 0 47Plasmacytoid dendritic cell moderate IER2 0.618 0.347 1.345549738 0.466101695 0.677940916 7.64E-11 1.42E-06 46CD8+ T cell moderate IER2 0.625 0.336 1.580474934 0.512605042 0.770601284 1.90E-11 3.53E-07 41CD8+ T cell moderate IER2 0.609 0.301 1.402135231 0.356164384 0.824785311 1.11E-12 2.07E-08 44CD8+ T cell moderate IER2 0.675 0.394 1.772663877 0.717592593 0.690884858 5.00E-17 9.31E-13 36T cell moderate IER2 0.604 0.332 1.454545455 0.481283422 0.728608177 2.53E-17 4.70E-13 38CD8+ T cell moderate IER2 0.882 0.316 2.450980392 0.644736842 1.069149505 4.34E-21 8.08E-17 47Plasmacytoid dendritic cell moderate IER2 0.65 0.413 1.986754967 0.815249267 0.718411214 2.92E-22 5.43E-18 24Naive CD8+ T cell moderate IER2 0.903 0.482 2.889959839 1.547445255 0.610704117 1.75E-30 3.25E-26 26CD1C-CD141- dendritic cell moderate IER2 0.784 0.265 1.187366167 0.441176471 0.601947746 4.38E-33 8.15E-29 20Megakaryocyte progenitor cell moderate IER2 0.659 0.374 1.949335548 0.719334719 0.778539533 2.84E-37 5.28E-33 23CD4+ T cell moderate IER2 0.625 0.372 1.68021978 0.610320285 0.735003646 3.43E-41 6.38E-37 25CD8+ T cell moderate IER2 0.554 0.315 1.269588829 0.503134796 0.594456563 7.49E-42 1.39E-37 10CD8+ T cell moderate IER2 0.65 0.403 1.922175732 0.776035834 0.71838225 8.00E-58 1.49E-53 9CD4+ T cell moderate IER2 0.691 0.13 0.991586538 0.213768116 0.714425341 1.42E-61 2.64E-57 31Megakaryocyte progenitor cell moderate IER2 0.589 0.344 1.50731982 0.56019656 0.684418233 6.75E-64 1.26E-59 4Megakaryocyte progenitor cell moderate IER2 0.811 0.527 3.560135997 1.251488095 1.018198001 1.39E-80 2.59E-76 17CD4+ T cell moderate IER2 0.847 0.321 1.986263736 0.901840491 0.650945334 7.99E-107 1.49E-102 21T cell (Activated T cell) moderate IER2 0.707 0.501 2.102363867 0.98343887 0.645363972 1.06E-116 1.98E-112 2Activated CD4+ T cell moderate IER2 0.612 0.331 1.548319727 0.499316005 0.765241811 4.87E-140 9.06E-136 3CD8+ T cell moderate IER2 0.576 0.413 1.964296081 0.658986175 0.837387691 2.58E-147 4.80E-143 5CD141+CLEC9A+ dendritic cell moderate IER2 0.57 0.322 1.321896444 0.456077016 0.673216965 8.01E-202 1.49E-197 1CD8+ T cell moderate IER2 0.827 0.203 1.000424088 0.287917738 0.635265434 3.71E-225 6.89E-221 14Megakaryocyte progenitor cell moderate IER2 0.696 0.286 2.027467811 0.285714286 1.235541541 0 0 29CD141+CLEC9A+ dendritic cell moderate JUN 0.855 0.592 4.6171875 1.653061224 1.082189992 6.58E-13 1.22E-08 45CD8+ T cell moderate JUN 0.892 0.63 5.802110818 2.403361345 0.999022176 2.26E-13 4.21E-09 41CD8+ T cell moderate JUN 0.911 0.521 6.014234875 2.109589041 1.173561812 1.14E-13 2.11E-09 44CD8+ T cell moderate JUN 0.885 0.559 5.54973822 1.915254237 1.167815541 6.57E-14 1.22E-09 46CD8+ T cell moderate JUN 0.911 0.554 6.112709832 2.337837838 1.091485443 1.16E-14 2.17E-10 41CD8+ T cell moderate JUN 0.964 0.883 15.10269914 9.697916667 0.589972663 1.19E-17 2.21E-13 22CD1C-CD141- dendritic cell moderate JUN 0.923 0.786 12.36476684 5.891428571 0.955559683 2.06E-24 3.83E-20 27Effector CD8+ memory T (Tem) cell moderate JUN 0.496 0.176 1.943238731 0.658291457 0.827706973 8.04E-25 1.49E-20 34CD1C-CD141- dendritic cell moderate JUN 0.872 0.669 6.161960133 3.338877339 0.723032687 5.64E-26 1.05E-21 23CD4+ T cell moderate JUN 0.961 0.342 4.200980392 1.381578947 1.126865225 5.09E-26 9.46E-22 47Plasmacytoid dendritic cell moderate JUN 0.907 0.545 5.934046346 2.096256684 1.163172401 9.40E-30 1.75E-25 38CD8+ T cell moderate JUN 0.741 0.745 5.624940048 10.40983607 -0.784298759 2.84E-32 5.29E-28 16Effector CD8+ memory T (Tem) cell moderate JUN 0.805 0.621 5.414459556 2.985781991 0.686464916 6.13E-34 1.14E-29 19Effector CD8+ memory T (Tem) cell moderate JUN 0.859 0.642 5.835564854 3.416573348 0.630133088 4.13E-44 7.68E-40 9CD4+ T cell moderate JUN 0.934 0.611 4.521978022 2.617586912 0.610157468 2.17E-60 4.04E-56 21T cell (Activated T cell) moderate JUN 0.847 0.494 5.511465893 2.614878209 0.849035325 8.03E-148 1.49E-143 5CD141+CLEC9A+ dendritic cell moderate JUN 0.827 0.573 4.148887503 1.651022864 0.957711636 3.18E-212 5.92E-208 1CD8+ T cell moderate JUN 0.908 0.521 6.314600342 2.066347469 1.254257852 2.16E-280 4.02E-276 3CD8+ T cell moderate JUNB 0.906 0.644 5.408376963 2.076271186 1.058776326 1.50E-12 2.79E-08 46CD8+ T cell moderate JUNB 0.911 0.562 5.480427046 1.753424658 1.234861754 4.08E-14 7.60E-10 44CD8+ T cell moderate JUNB 0.902 0.703 6.314148681 1.810810811 1.379703601 4.43E-17 8.25E-13 41CD8+ T cell moderate JUNB 0.926 0.714 6.464379947 2.571428571 1.063521156 2.89E-20 5.37E-16 41CD8+ T cell moderate JUNB 0.906 0.652 5.729055258 2.128342246 1.105005614 1.16E-25 2.16E-21 38CD8+ T cell moderate JUNB 0.971 0.382 2.985294118 0.855263158 1.103062361 1.32E-26 2.46E-22 47Plasmacytoid dendritic cell moderate JUNB 0.964 0.781 4.444367177 2.520775623 0.62887108 3.92E-73 7.30E-69 8CD1C+_B dendritic cell moderate JUNB 0.887 0.744 5.130172593 2.621339751 0.759404157 3.91E-146 7.27E-142 1CD8+ T cell moderate JUNB 0.837 0.538 3.627285922 1.202106649 1.071281905 2.15E-200 4.01E-196 5CD141+CLEC9A+ dendritic cell moderate JUNB 0.914 0.661 6.260869565 2.400136799 1.094549544 5.44E-217 1.01E-212 3CD8+ T cell moderate JUNB 0.434 0.083 1.518072289 0.083333333 1.216842483 0 0 49AXL+SIGLEC6+ dendritic cell moderate JUND 0.218 0.427 0.289208633 1.091188525 -0.697837375 5.47E-108 1.02E-103 16Effector CD8+ memory T (Tem) cell cured ATF3 0.01 0.364 0.009868421 0.555371901 -0.623092249 0 0 9CD1C+_B dendritic cell cured DDIT4 0.667 0.211 1.333333333 0.289473684 0.855610091 0 0 41Megakaryocyte progenitor cell cured DDIT4 0.775 0.422 3.07266436 0.789800995 1.186173737 2.63E-178 4.62E-174 2Effector CD8+ memory T (Tem) cell cured DDIT4 0.85 0.465 3.5443196 1.024337867 1.166614203 6.81E-135 1.20E-130 6Effector CD8+ memory T (Tem) cell cured DDIT4 0.577 0.235 1.284513806 0.348214286 0.760837344 1.54E-91 2.71E-87 3Effector CD8+ memory T (Tem) cell cured DDIT4 0.677 0.184 1.8 0.229508197 1.187345474 5.53E-25 9.70E-21 26CD8+ T cell cured DDIT4 0.568 0.275 1.198198198 0.403624382 0.647164557 1.45E-16 2.54E-12 10Effector CD8+ memory T (Tem) cell cured DDIT4 0.725 0.243 2.019607843 0.431516937 1.076816459 3.30E-14 5.79E-10 19CD4+ cytotoxic T cell cured DDIT4 0.651 0.372 2.093023256 0.623188406 0.930187216 4.54E-11 7.97E-07 25CD8+ T cell cured DDIT4 0.099 0.44 0.126760563 1.843971631 -1.335726099 7.12E-10 1.25E-05 30CD141+CLEC9A+ dendritic cell cured DUSP1 0.039 0.58 0.039473684 1.969870875 -1.514546972 0 0 15CD4+ T cell cured DUSP1 0.093 0.671 0.093023256 1.797101449 -1.355608484 0 0 25CD8+ T cell cured DUSP1 0.123 0.616 0.123076923 1.452459016 -1.126772282 0 0 26CD8+ T cell cured DUSP1 0.048 0.458 0.047619048 1.167741935 -1.049078822 0 0 33CD8+ T cell cured DUSP1 0.054 0.551 0.054054054 1.188405797 -1.053931429 0 0 35CD8+ T cell cured DUSP1 0.111 0.57 0.111111111 1.186915888 -0.97689464 0 0 37CD8+ T cell cured DUSP1 0.167 0.939 0.166666667 3.017391304 -1.783866569 0 0 38CD1C+_B dendritic cell cured DUSP1 0.38 0.791 0.574013158 8.236363636 -2.552877372 4.38E-274 7.70E-270 9CD1C+_B dendritic cell cured DUSP1 0.176 0.844 0.232594937 4.03698075 -2.030860447 2.06E-270 3.61E-266 4CD4+ T cell cured DUSP1 0.072 0.58 0.083910035 2.430970149 -1.662371557 1.86E-236 3.27E-232 2Effector CD8+ memory T (Tem) cell cured DUSP1 0.11 0.635 0.121098627 5.420186113 -2.517701918 2.05E-232 3.59E-228 6Effector CD8+ memory T (Tem) cell cured DUSP1 0.084 0.622 0.092911877 1.411974341 -1.14203748 1.02E-215 1.79E-211 5Naive CD8+ T cell cured DUSP1 0.104 0.635 0.118847539 1.599330357 -1.216126543 2.62E-190 4.60E-186 3Effector CD8+ memory T (Tem) cell cured DUSP1 0.087 0.458 0.093718843 2.046153846 -1.477746887 4.89E-155 8.58E-151 8CD141+CLEC9A+ dendritic cell cured DUSP1 0.058 0.346 0.059032717 0.59 -0.586279606 5.79E-155 1.02E-150 1Naive CD8+ T cell cured DUSP1 0.14 0.761 0.156862745 3.081212121 -1.818779989 9.83E-128 1.73E-123 12CD8+ T cell cured DUSP1 0.055 0.566 0.05764411 1.858397366 -1.434352237 1.78E-95 3.13E-91 11CD4+ T cell cured DUSP1 0.042 0.635 0.091334895 1.665338645 -1.288224962 1.15E-93 2.01E-89 17T cell (Activated T cell) cured DUSP1 0.089 0.5 0.098989899 1.141009056 -0.962112771 1.93E-86 3.39E-82 7CD8+ T cell cured DUSP1 0.074 0.752 0.134883721 4.943965517 -2.388881258 2.43E-76 4.27E-72 20CD1C+_B dendritic cell cured DUSP1 0.115 0.703 0.141025641 2.590909091 -1.654017917 3.01E-67 5.29E-63 18Memory B cell cured DUSP1 0.151 0.322 0.172707889 1.464761905 -1.071604594 3.53E-53 6.19E-49 16CD141+CLEC9A+ dendritic cell cured DUSP1 0.135 0.765 0.144144144 2.965403624 -1.7931989 1.85E-51 3.25E-47 10Effector CD8+ memory T (Tem) cell cured DUSP1 0.843 0.923 2.132075472 8.259090909 -1.563751575 9.33E-46 1.64E-41 22CD1C-CD141- dendritic cell cured DUSP1 0.08 0.565 0.092436975 1.827089337 -1.371767424 6.91E-45 1.21E-40 23CD4+ T cell cured DUSP1 0.216 0.949 0.31372549 9.563139932 -3.007302991 1.80E-44 3.17E-40 21Plasmacytoid dendritic cell cured DUSP1 0.078 0.608 0.1015625 1.565340909 -1.219599206 2.04E-29 3.58E-25 24T cell cured DUSP1 0.031 0.904 0.03125 1.170603675 -1.073702212 2.81E-27 4.93E-23 13Megakaryocyte progenitor cell cured DUSP1 0.073 0.548 0.083333333 1.59800995 -1.261929739 1.80E-23 3.17E-19 14Megakaryocyte progenitor cell cured DUSP1 0.114 0.652 0.136363636 2.786585366 -1.736472882 5.37E-22 9.43E-18 27CD8+ T cell cured DUSP1 0.535 0.738 0.85915493 4.695035461 -1.615057825 2.63E-20 4.62E-16 30CD141+CLEC9A+ dendritic cell cured DUSP1 0.078 0.722 0.117647059 2.309278351 -1.566051973 3.47E-20 6.09E-16 19CD4+ cytotoxic T cell cured DUSP1 0.155 0.636 0.226190476 3.694214876 -1.936700778 9.04E-19 1.59E-14 32Effector CD8+ memory T (Tem) cell cured DUSP1 0.321 0.824 0.703703704 3.925925926 -1.531720479 3.01E-16 5.28E-12 34CD1C-CD141- dendritic cell cured DUSP1 0.192 0.685 0.211538462 2.074074074 -1.343311724 5.99E-12 1.05E-07 39CD8+ T cell cured DUSP2 0.056 0.298 0.056338028 0.872340426 -0.825771196 0 0 30CD141+CLEC9A+ dendritic cell cured DUSP2 0.459 0.672 1.182072829 2.704242424 -0.763479265 1.47E-17 2.58E-13 12CD8+ T cell cured FOS 0.004 0.42 0.003601441 0.891741071 -0.914528189 0 0 3Effector CD8+ memory T (Tem) cell cured FOS 0.008 0.428 0.007662835 0.962223806 -0.961476608 0 0 5Naive CD8+ T cell cured FOS 0.002 0.368 0.001994018 1.940512821 -1.553193885 0 0 8CD141+CLEC9A+ dendritic cell cured FOS 0.005 0.436 0.005012531 2.34687157 -1.735599701 0 0 11CD4+ T cell cured FOS 0.01 0.469 0.009868421 2.195121951 -1.661703665 0 0 15CD4+ T cell cured FOS 0.005 0.588 0.009367681 1.733067729 -1.437069413 0 0 17T cell (Activated T cell) cured FOS 0.009 0.477 0.008547009 1.914772727 -1.531105067 0 0 18Memory B cell cured FOS 0.024 0.57 0.023809524 4.900826446 -2.526969695 0 0 32Effector CD8+ memory T (Tem) cell cured FOS 0.025 0.772 0.03164557 6.032928065 -2.769178055 6.49E-285 1.14E-280 4CD4+ T cell cured FOS 0.439 0.819 1.123355263 30.23719008 -3.878847006 3.98E-281 6.98E-277 9CD1C+_B dendritic cell cured FOS 0.01 0.567 0.012484395 4.340014316 -2.398943938 6.82E-197 1.20E-192 6Effector CD8+ memory T (Tem) cell cured FOS 0.008 0.318 0.008650519 1.044154229 -1.019077659 4.07E-126 7.14E-122 2Effector CD8+ memory T (Tem) cell cured FOS 0.177 0.774 0.362790698 24.99568966 -4.25363652 1.66E-98 2.91E-94 20CD1C+_B dendritic cell cured FOS 0 0.553 0 2.718787879 -1.894832458 1.88E-95 3.31E-91 12CD8+ T cell cured FOS 0.002 0.343 0.002020202 0.899094437 -0.922400053 6.52E-73 1.14E-68 7CD8+ T cell cured FOS 0.164 0.759 0.371069182 16.37954545 -3.664017076 2.30E-56 4.04E-52 22CD1C-CD141- dendritic cell cured FOS 0.004 0.493 0.008403361 2.642651297 -1.852916063 3.04E-46 5.33E-42 23CD4+ T cell cured FOS 0.039 0.875 0.176470588 10.41808874 -3.278784021 1.09E-35 1.92E-31 21Plasmacytoid dendritic cell cured FOS 0 0.53 0 1.654036244 -1.408188072 8.13E-34 1.43E-29 10Effector CD8+ memory T (Tem) cell cured FOS 0 0.903 0 1.631671041 -1.395979163 1.64E-30 2.88E-26 13Megakaryocyte progenitor cell cured FOS 0 0.479 0 1.583084577 -1.369094882 2.90E-25 5.10E-21 14Megakaryocyte progenitor cell cured FOS 0 0.409 0 1.278409091 -1.188026808 1.02E-23 1.79E-19 24T cell cured FOS 0.606 0.816 2 20.91489362 -2.86887727 2.42E-23 4.24E-19 30CD141+CLEC9A+ dendritic cell cured FOS 0.481 0.778 1.962962963 14.05555556 -2.345183447 1.74E-14 3.05E-10 34CD1C-CD141- dendritic cell cured FOS 0.015 0.479 0.030769231 1.137704918 -1.052341344 1.29E-13 2.26E-09 26CD8+ T cell cured FOS 0 0.372 0 1.823170732 -1.497316379 1.75E-13 3.08E-09 27CD8+ T cell cured FOS 0 0.965 0 5.756521739 -2.756280737 2.87E-13 5.04E-09 38CD1C+_B dendritic cell cured FOS 0.02 0.443 0.274509804 1.312223859 -0.859338608 1.03E-11 1.81E-07 19CD4+ cytotoxic T cell cured FOSB 0.01 0.527 0.011513158 1.010743802 -0.991214186 2.72E-136 4.77E-132 9CD1C+_B dendritic cell cured FOSB 0 0.336 0 0.831896552 -0.873338036 5.08E-30 8.91E-26 20CD1C+_B dendritic cell cured FOSB 0.012 0.454 0.012345679 1.740740741 -1.436863862 3.82E-13 6.70E-09 34CD1C-CD141- dendritic cell cured IER2 0.452 0.748 0.699013158 2.890082645 -1.19510378 1.70E-105 2.98E-101 9CD1C+_B dendritic cell cured IER2 0.739 0.785 1.515605493 3.023622047 -0.677589103 8.93E-69 1.57E-64 6Effector CD8+ memory T (Tem) cell cured IER2 0.372 0.64 0.613953488 2.747844828 -1.215462219 3.34E-31 5.86E-27 20CD1C+_B dendritic cell cured IER2 0.572 0.748 0.874213836 2.331818182 -0.830024109 7.34E-22 1.29E-17 22CD1C-CD141- dendritic cell cured IER2 0.437 0.66 0.492957746 1.737588652 -0.87473235 6.24E-17 1.10E-12 30CD141+CLEC9A+ dendritic cell cured JUN 0.017 0.523 0.017069701 1.408518519 -1.243727464 0 0 1Naive CD8+ T cell cured JUN 0.04 0.76 0.041187739 3.472558803 -2.102870222 0 0 5Naive CD8+ T cell cured JUN 0.046 0.497 0.046464646 1.851875809 -1.446387585 0 0 7CD8+ T cell cured JUN 0.025 0.644 0.025062657 3.295279912 -2.067040054 0 0 11CD4+ T cell cured JUN 0.009 0.707 0.018604651 3.700431034 -2.20619885 0 0 20CD1C+_B dendritic cell cured JUN 0.013 0.198 0.012578616 0.797727273 -0.828140248 0 0 22CD1C-CD141- dendritic cell cured JUN 0.023 0.693 0.0234375 2.556818182 -1.797164227 0 0 24T cell cured JUN 0.14 0.669 0.139534884 2.707729469 -1.702090893 0 0 25CD8+ T cell cured JUN 0.185 0.561 0.184615385 1.531147541 -1.095372877 0 0 26CD8+ T cell cured JUN 0.071 0.542 0.071428571 1.864516129 -1.418755788 0 0 33CD8+ T cell cured JUN 0.025 0.759 0.049382716 3.009259259 -1.933794779 0 0 34CD1C-CD141- dendritic cell cured JUN 0.111 0.636 0.111111111 2.252336449 -1.549473416 0 0 37CD8+ T cell cured JUN 0.115 0.778 0.115384615 5.518518519 -2.547002839 0 0 39CD8+ T cell cured JUN 0.041 0.777 0.047468354 5.641843972 -2.664677173 4.93E-282 8.65E-278 4CD4+ T cell cured JUN 0.185 0.671 0.225967541 9.665712241 -3.120987623 9.34E-237 1.64E-232 6Effector CD8+ memory T (Tem) cell cured JUN 0.16 0.593 0.192906574 3.332711443 -1.860789098 2.37E-233 4.16E-229 2Effector CD8+ memory T (Tem) cell cured JUN 0.116 0.595 0.139255702 1.965401786 -1.380135999 1.04E-168 1.83E-164 3Effector CD8+ memory T (Tem) cell cured JUN 0.2 0.539 0.25224327 3.131282051 -1.722074701 2.80E-167 4.92E-163 8CD141+CLEC9A+ dendritic cell cured JUN 0.078 0.794 0.100840336 5.528484848 -2.568142967 5.95E-144 1.04E-139 12CD8+ T cell cured JUN 0.038 0.534 0.039473684 3.09338843 -1.977442339 7.55E-138 1.33E-133 9CD1C+_B dendritic cell cured JUN 0.033 0.687 0.036184211 3.111908178 -1.988527543 2.15E-101 3.78E-97 15CD4+ T cell cured JUN 0.021 0.61 0.035128806 2.414342629 -1.72179754 5.95E-96 1.05E-91 17T cell (Activated T cell) cured JUN 0.034 0.693 0.047008547 4.365530303 -2.357447548 6.95E-77 1.22E-72 18Memory B cell cured JUN 0.029 0.66 0.037815126 3.432276657 -2.094498467 8.17E-65 1.43E-60 23CD4+ T cell cured JUN 0.217 0.396 0.292110874 1.628571429 -1.024549068 6.72E-42 1.18E-37 16CD141+CLEC9A+ dendritic cell cured JUN 0.099 0.651 0.108108108 3.298187809 -1.955629884 3.59E-38 6.29E-34 10Effector CD8+ memory T (Tem) cell cured JUN 0.042 0.67 0.0625 2.795024876 -1.836646501 5.17E-36 9.08E-32 14Megakaryocyte progenitor cell cured JUN 0.137 0.87 0.156862745 8.313993174 -3.009182117 1.16E-33 2.04E-29 21Plasmacytoid dendritic cell cured JUN 0 0.906 0 1.170603675 -1.118096332 7.65E-31 1.34E-26 13Megakaryocyte progenitor cell cured JUN 0.148 0.726 0.159090909 4.31097561 -2.195983181 2.40E-29 4.21E-25 27CD8+ T cell cured JUN 0.226 0.645 0.238095238 3.495867769 -1.860477309 1.70E-25 2.98E-21 32Effector CD8+ memory T (Tem) cell cured JUN 0 0.974 0 3.330434783 -2.114511881 6.61E-14 1.16E-09 38CD1C+_B dendritic cell cured JUN 0.147 0.878 0.176470588 5.268292683 -2.413607291 2.71E-13 4.75E-09 42CD8+ T cell cured JUN 0.118 0.595 0.176470588 2.17820324 -1.433746132 7.37E-12 1.29E-07 19CD4+ cytotoxic T cell cured JUN 0.352 0.621 0.660606061 2.727272727 -1.166410517 6.07E-10 1.07E-05 29Plasmacytoid dendritic cell cured JUN 0.206 0.577 0.333333333 1.798076923 -1.069398125 1.16E-09 2.04E-05 31Plasmacytoid dendritic cell cured JUNB 0.583 0.939 0.583333333 2.539130435 -1.160429921 0 0 38CD1C+_B dendritic cell cured JUNB 0.414 0.837 0.569923372 4.397719173 -1.7816557776.0271450351466e-309 1.06E-304 5Naive CD8+ T cell cured JUNB 0.345 0.704 0.421052632 2.254074074 -1.195287103 1.07E-304 1.87E-300 1Naive CD8+ T cell cured JUNB 0.519 0.886 0.743670886 7.958966565 -2.361204564 3.26E-286 5.71E-282 4CD4+ T cell cured JUNB 0.388 0.782 0.541353383 4.750823271 -1.899570839 4.71E-118 8.27E-114 11CD4+ T cell cured JUNB 0.459 0.855 0.703081232 5.099393939 -1.840518648 2.90E-113 5.09E-109 12CD8+ T cell cured JUNB 0.411 0.812 0.523026316 4.962697274 -1.969024223 3.75E-106 6.58E-102 15CD4+ T cell cured JUNB 0.676 0.885 1.345394737 4.112396694 -1.124169033 7.30E-106 1.28E-101 9CD1C+_B dendritic cell cured JUNB 0.406 0.641 0.509090909 2.069857697 -1.024492063 5.06E-98 8.89E-94 7CD8+ T cell cured JUNB 0.444 0.658 0.644194757 1.947029349 -0.84188023 4.15E-93 7.29E-89 6Effector CD8+ memory T (Tem) cell cured JUNB 0.543 0.847 0.799145299 6.84280303 -2.124057665 6.84E-89 1.20E-84 18Memory B cell cured JUNB 0.408 0.798 0.554621849 5.017291066 -1.952550447 1.51E-71 2.65E-67 23CD4+ T cell cured JUNB 0.173 0.659 0.37470726 2 -1.125838067 2.05E-71 3.61E-67 17T cell (Activated T cell) cured JUNB 0.205 0.761 0.493023256 2.278017241 -1.134586805 5.83E-46 1.02E-41 20CD1C+_B dendritic cell cured JUNB 0.453 0.798 0.5859375 3.900568182 -1.627613111 2.52E-41 4.42E-37 24T cell cured JUNB 0.427 0.775 0.541666667 3.995024876 -1.696000998 8.47E-35 1.49E-30 14Megakaryocyte progenitor cell cured JUNB 0.094 0.92 0.21875 1.185476815 -0.842545855 2.08E-27 3.66E-23 13Megakaryocyte progenitor cell cured JUNB 0.49 0.874 0.68627451 4.76109215 -1.772502922 2.30E-22 4.04E-18 21Plasmacytoid dendritic cell cured JUNB 0.67 0.774 1.102272727 3.902439024 -1.221549845 1.79E-17 3.15E-13 27CD8+ T cell cured JUNB 0.481 0.889 0.692307692 4.444444444 -1.685792942 1.35E-14 2.37E-10 39CD8+ T cell cured JUNB 0.412 0.652 0.450980392 1.71281296 -0.902761558 2.99E-12 5.24E-08 19CD4+ cytotoxic T cell cured JUNB 0.925 0.973 3.798742138 6.554545455 -0.654688662 8.41E-12 1.48E-07 22CD1C-CD141- dendritic cell cured JUNB 0.93 0.901 2.591549296 6.042553191 -0.971492238 6.96E-11 1.22E-06 30CD141+CLEC9A+ dendritic cell cured JUNB 0.452 0.658 0.523809524 1.858064516 -0.907355906 4.42E-10 7.76E-06 33CD8+ T cell cured JUNB 0.559 0.878 0.852941176 5.024390244 -1.700998145 5.17E-10 9.07E-06 42CD8+ T cell cured JUNB 0.369 0.628 0.547619048 1.842975207 -0.877351127 2.48E-09 4.35E-05 32Effector CD8+ memory T (Tem) cell cured JUND 0.094 0.4 0.106117353 0.956335004 -0.822648983 6.65E-88 1.17E-83 6Effector CD8+ memory T (Tem) cell cured JUND 0.102 0.427 0.186046512 1.153017241 -0.860199285 8.54E-21 1.50E-16 20CD1C+_B dendritic cell cured NR4A1 0.056 0.355 0.056338028 0.680851064 -0.670120326 0 0 30CD141+CLEC9A+ dendritic cell Table S9 List of the most enriched clone antibodies in each patient by TCR single cell transcriptome analysis.

TRA-CDR3-TRB-CDR3 TRA_v_gene TRA_j_gene TRA_c_geneTRB_v_gene TRB_d_geneTRB_j_gene TRB_c_gene Patient1Patient2Patient3Patient4Patient5Patient6Patient7Patient8Patient9 Patient10

CGTDADNNNDMRF-CASSLTSGRGEQYF TRAV30*01 TRAJ43*01 TRAC*01 TRBV28*01 TRBD2*02 TRBJ2-7*01 TRBC2*01 6 0 0 0 0 0 0 0 0 0

CAVTSGSRLTF-CASSLLPWRELFF TRAV39*01 TRAJ58*01 TRAC*01 TRBV11-2*01 TRBD2*02 TRBJ1-4*01 TRBC1*01 6 0 0 0 0 0 0 0 0 0

CVVNVGNGNKLVF-CASSPPEGGSSYNEQFF TRAV12-1*01 TRAJ47*01 TRAC*01 TRBV5-6*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 5 0 0 0 0 0 0 0 0 0

CALSDADMDTGRRALTF-CASSTEQGARSDTQYF TRAV19*01 TRAJ5*01 TRAC*01 TRBV5-1*01 TRBD1*01 TRBJ2-3*01 TRBC2*01 5 0 0 0 0 0 0 0 0 0

CALRSGGSYIPTF-CASSSLDSYEQYF TRAV19*01 TRAJ6*01 TRAC*01 TRBV11-3*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 5 0 0 0 0 0 0 0 0 0

CAIDLSSGSARQLTF-CASKGNSYEQYF TRAV14/DV4*01 TRAJ22*01 TRAC*01 TRBV28*01 None TRBJ2-7*01 TRBC2*01 0 0 182 0 0 0 0 0 0 0

CAVRTAGNKLTF-CASSDPVTQYF TRAV1-2*01 TRAJ17*01 TRAC*01 TRBV9*01 None TRBJ2-3*01 TRBC2*02 0 0 143 0 0 0 0 0 0 0

CAVKNAGNMLTF-CASQGPNTEAFF TRAV1-2*01 TRAJ39*01 TRAC*01 TRBV9*01 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 69 0 0 0 0 0 0 0

CVVNRDFQKLVF-CASRALGVSSGNYGYTF TRAV12-1*01 TRAJ8*01 TRAC*01 TRBV28*01 TRBD1*01 TRBJ1-2*01 TRBC1*01 0 0 44 0 0 0 0 0 0 0

CAVLAQANDYKLSF-CASSGNTGGSYEQYF TRAV13-2*01 TRAJ20*01 TRAC*01 TRBV9*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 0 36 0 0 0 0 0 0 0

CAVKGTYKYIF-CASSVGGTLSSYNEQFF TRAV8-1*01 TRAJ40*01 TRAC*01 TRBV10-2*01 TRBD2*01 TRBJ2-1*01 TRBC2*02 0 0 23 0 0 0 0 0 0 0

CAVRQAGNQFYF-CASSGNTGGSYEQYF TRAV1-2*01 TRAJ49*01 TRAC*01 TRBV9*01 TRBD1*01 TRBJ2-7*01 TRBC2*02 0 0 16 0 0 0 0 0 0 0

CAASANNARLMF-CSASVQRENDEQFF TRAV29/DV5*01 TRAJ31*01 TRAC*01 TRBV20-1*02 TRBD2*02 TRBJ2-1*01 TRBC2*02 0 0 15 0 0 0 0 0 0 0

CAFMGGSARQLTF-CASRERGGNTEAFF TRAV38-1*01 TRAJ22*01 TRAC*01 TRBV19*01 TRBD1*01 TRBJ1-1*01 TRBC2*02 0 0 15 0 0 0 0 0 0 0

CAGPRDLYNQGGKLIF-CAAKTATNEKLFF TRAV27*01 TRAJ23*01 TRAC*01 TRBV5-4*01 None TRBJ1-4*01 None 0 0 12 0 0 0 0 0 0 0

CVVSESGNTPLVF-CASSQDGGFGETQYF TRAV8-2*01 TRAJ29*01 TRAC*01 TRBV3-1*01 TRBD1*01 TRBJ2-5*01 TRBC2*01 0 0 12 0 0 0 0 0 0 0

CAGLNGSSNTGKLIF-CASSAHGRNNEQFF TRAV27*01 TRAJ37*02 TRAC*01 TRBV9*01 TRBD2*02 TRBJ2-1*01 TRBC2*01 0 0 12 0 0 0 0 0 0 0

CALRDTGFQKLVF-CASSPLLSDSYNEQFF TRAV13-2*01 TRAJ8*01 TRAC*01 TRBV7-7*01 None TRBJ2-1*01 TRBC2*02 0 0 11 0 0 0 0 0 0 0

CLVGHQTGANNLFF-CASSGRAVAGETQYF TRAV4*01 TRAJ36*01 TRAC*01 TRBV10-2*01 TRBD2*01 TRBJ2-5*01 TRBC2*01 0 0 11 0 0 0 0 0 0 0

CALSEAYSGGGADGLTF-CAISGTGGTIEQYF TRAV19*01 TRAJ45*01 TRAC*01 TRBV10-3*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 0 10 0 0 0 0 0 0 0

CAASRTGANNLFF-CASSHEDSRQETQYF TRAV13-1*01 TRAJ36*01 TRAC*01 TRBV5-1*01 TRBD1*01 TRBJ2-5*01 TRBC2*01 0 0 10 0 0 0 0 0 0 0

CAVKDSNYQLIW-CATSNRADGANVLTF TRAV1-2*01 TRAJ33*01 TRAC*01 TRBV24-1*01 TRBD1*01 TRBJ2-6*01 TRBC2*02 0 0 9 0 0 0 0 0 0 0

CAERISDGQKLLF-CASSGTGGSGANVLTF TRAV5*01 TRAJ16*01 TRAC*01 TRBV6-6*01 TRBD1*01 TRBJ2-6*01 TRBC2*01 0 0 8 0 0 0 0 0 0 0

CADSGGYNKLIF-CASRLLDRAAEQFF TRAV5*01 TRAJ4*01 TRAC*01 TRBV28*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 0 8 0 0 0 0 0 0 0 CAVSGRGGYNKLIF-CASSLSTASTDTQYF TRAV12-2*01 TRAJ4*01 TRAC*01 TRBV5-1*01 None TRBJ2-3*01 TRBC2*01 0 0 8 0 0 0 0 0 0 0

CAASLNAGNMLTF-CASSLKDRVTNTEAFF TRAV29/DV5*01 TRAJ39*01 TRAC*01 TRBV28*01 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 8 0 0 0 0 0 0 0

CAVRDFYQKVTF-CASSFRDRADEQFF TRAV3*01 TRAJ13*02 TRAC*01 TRBV11-1*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 0 8 0 0 0 0 0 0 0

CAFPRGGSNYKLTF-CSARDTQGAGHYEQYF TRAV24*01 TRAJ53*01 TRAC*01 TRBV20-1*02 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 0 7 0 0 0 0 0 0 0

CAVMDSNYQLIW-CSASHRDYDYNEQFF TRAV1-2*01 TRAJ33*01 TRAC*01 TRBV20-1*02 TRBD2*01 TRBJ2-1*01 TRBC2*02 0 0 7 0 0 0 0 0 0 0

CAGYTGFQKLVF-CASSSTRRGPLYEQYF TRAV21*01 TRAJ8*01 TRAC*01 TRBV13*01 TRBD2*01 TRBJ2-7*01 TRBC2*01 0 0 0 0 147 0 0 0 0 0

CLVDRNTGNQFYF-CASSRSGVITDTQYF TRAV4*01 TRAJ49*01 TRAC*01 TRBV5-4*01 TRBD2*01 TRBJ2-3*01 TRBC2*01 0 0 0 0 75 0 0 0 0 0

CAENNSQGGKLIF-CASSATGFPTEAFF TRAV13-2*01 TRAJ23*01 TRAC*01 TRBV9*01 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 0 34 0 0 0 0 0

CVVNSGGYQKVTF-CASSAPNFYEQYF TRAV12-1*01 TRAJ13*02 TRAC*01 TRBV11-2*03 None TRBJ2-7*01 TRBC2*01 0 0 0 0 30 0 0 0 0 0

CAVLDSNYQLIW-CASSQNRDLVGELFF TRAV1-2*01 TRAJ33*01 TRAC*01 TRBV4-2*01 TRBD1*01 TRBJ2-2*01 TRBC2*01 0 0 0 0 26 0 0 0 0 0

CAGESGGSYIPTF-CASSPPPGHSNRNRIGTEAFF TRAV25*01 TRAJ6*01 TRAC*01 TRBV27*01 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 0 16 0 0 0 0 0

CAYDSNYQLIW-CASSSTRRGPLYEQYF TRAV2*01 TRAJ33*01 TRAC*01 TRBV13*01 TRBD2*01 TRBJ2-7*01 TRBC2*01 0 0 0 0 13 0 0 0 0 0

CASLDSNYQLIW-CASSDSHTDTQYF TRAV1-2*01 TRAJ33*01 TRAC*01 TRBV6-4*01 None TRBJ2-3*01 TRBC2*01 0 0 0 0 11 0 0 0 0 0

CAVRDSNYQLIW-CASSHREHTEAFF TRAV1-2*01 TRAJ33*01 TRAC*01 TRBV6-5*01 None TRBJ1-1*01 TRBC1*01 0 0 0 0 7 0 0 0 0 0

CAVRGQYNFNKFYF-CASSEGVGTPFDEQFF TRAV3*01 TRAJ21*01 TRAC*01 TRBV2*01 TRBD2*01 TRBJ2-1*01 TRBC2*01 0 337 0 0 0 0 0 0 0 0

CAMREPADSSYKLIF-CASSYPTSGTPRNEQYF TRAV14/DV4*01 TRAJ12*01 TRAC*01 TRBV6-2*01 TRBD2*02 TRBJ2-7*01 TRBC2*01 0 150 0 0 0 0 0 0 0 0

CASRGGGGSNYKLTF-CSAPGQNYEQYF TRAV24*01 TRAJ53*01 TRAC*01 TRBV29-1*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 85 0 0 0 0 0 0 0 0

CAVRGYRDDKIIF-CASSSRVAGTDTQYF TRAV3*01 TRAJ30*01 TRAC*01 TRBV27*01 TRBD2*02 TRBJ2-3*01 TRBC2*01 0 53 0 0 0 0 0 0 0 0

CAMSSRF-CASSIYGQGYQPQHF TRAV14/DV4*01 TRAJ16*01 TRAC*01 TRBV19*01 TRBD1*01 TRBJ1-5*01 TRBC1*01 0 50 0 0 0 0 0 0 0 0

CAMREEYNNNDMRF-CASSSQRAGVYTGELFF TRAV14/DV4*01 TRAJ43*01 TRAC*01 TRBV7-6*01 TRBD2*02 TRBJ2-2*01 TRBC2*01 0 34 0 0 0 0 0 0 0 0

CAVGDFGNEKLTF-CSASRLRIGHGETQYF TRAV12-2*01 TRAJ48*01 TRAC*01 TRBV20-1*02 TRBD2*01 TRBJ2-5*01 TRBC2*01 0 32 0 0 0 0 0 0 0 0

CAILNNNDMRF-CSAKTGPPGEKLFF TRAV14/DV4*01 TRAJ43*01 TRAC*01 TRBV20-1*02 TRBD1*01 TRBJ1-4*01 TRBC1*01 0 30 0 0 0 0 0 0 0 0

CAYRSKNRDDKIIF-CASSLRWASVYEQYF TRAV38-2/DV8*01TRAJ30*01 TRAC*01 TRBV7-8*01 None TRBJ2-7*01 TRBC2*01 0 26 0 0 0 0 0 0 0 0

CIVRAYSGGSNYKLTF-CASSYHSNQPQHF TRAV26-1*01 TRAJ53*01 TRAC*01 TRBV11-2*01 None TRBJ1-5*01 TRBC1*01 0 25 0 0 0 0 0 0 0 0

CAVTTPPNAGGTSYGKLTF-CASRHTGAGMWTDTQYFTRAV8-4*01 TRAJ52*01 TRAC*01 TRBV7-9*03 TRBD2*01 TRBJ2-3*01 TRBC2*01 0 22 0 0 0 0 0 0 0 0

CAVRPGRDDKIIF-CASSSRLAGGTDTQYF TRAV3*01 TRAJ30*01 TRAC*01 TRBV27*01 TRBD2*02 TRBJ2-3*01 TRBC2*01 0 21 0 0 0 0 0 0 0 0

CAVRPDSNYQLIW-CASSLRTSGLSYEQYF TRAV3*01 TRAJ33*01 TRAC*01 TRBV3-1*01 TRBD2*01 TRBJ2-7*01 TRBC2*01 0 20 0 0 0 0 0 0 0 0

CAVGYSGAGSYQLTF-CASSISGGLSTDTQYF TRAV21*01 TRAJ28*01 TRAC*01 TRBV7-6*01 TRBD1*01 TRBJ2-3*01 TRBC2*01 0 20 0 0 0 0 0 0 0 0

CLVGANTNAGKSTF-CASSQDGGGPRQVEQFF TRAV4*01 TRAJ27*01 TRAC*01 TRBV4-2*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 19 0 0 0 0 0 0 0 0

CAGITDYGQNFVF-CSVEGGTLAGHYNEQFF TRAV25*01 TRAJ26*01 TRAC*01 TRBV29-1*01 TRBD2*02 TRBJ2-1*01 TRBC2*01 0 19 0 0 0 0 0 0 0 0 CVVNGGNTPLVF-CASSLGWRRATGETQYF TRAV12-1*01 TRAJ29*01 TRAC*01 TRBV7-2*02 TRBD2*02 TRBJ2-5*01 TRBC2*01 0 18 0 0 0 0 0 0 0 0

CSMEYGNKLVF-CASSLEFGVSNEQYF TRAV26-1*01 TRAJ47*01 TRAC*01 TRBV11-2*01 None TRBJ2-7*01 TRBC2*01 0 18 0 0 0 0 0 0 0 0

CALSDRYTGNQFYF-CASSLVARGATDTQYF TRAV9-2*01 TRAJ49*01 TRAC*01 TRBV11-2*01 TRBD1*01 TRBJ2-3*01 TRBC2*01 0 17 0 0 0 0 0 0 0 0

CAYSQETSGSRLTF-CASSVVWWSSQYF TRAV38-2/DV8*01TRAJ58*01 TRAC*01 TRBV9*01 None TRBJ2-3*01 TRBC2*01 0 17 0 0 0 0 0 0 0 0

CAAGGSARQLTF-CASSFITYGATGELFF TRAV13-1*01 TRAJ22*01 TRAC*01 TRBV7-9*03 TRBD1*01 TRBJ2-2*01 TRBC2*01 0 16 0 0 0 0 0 0 0 0

CAVRAF-CASSSGSLNTEAFF TRAV1-2*01 TRAJ16*01 TRAC*01 TRBV5-4*01 TRBD2*02 TRBJ1-1*01 TRBC1*01 0 16 0 0 0 0 0 0 0 0

CLVVPSGGYNKLIF-CASSFFFGVGEQYF TRAV4*01 TRAJ4*01 TRAC*01 TRBV5-5*01 TRBD2*01 TRBJ2-7*01 TRBC2*01 0 16 0 0 0 0 0 0 0 0

CAYRRLGNTPLVF-CASSAVDGQGFRTDTQYF TRAV38-2/DV8*01TRAJ29*01 TRAC*01 TRBV7-9*03 TRBD1*01 TRBJ2-3*01 TRBC2*01 0 15 0 0 0 0 0 0 0 0

CAVGDNFNKFYF-CASSPTSATGELFF TRAV8-3*01 TRAJ21*01 TRAC*01 TRBV28*01 TRBD2*01 TRBJ2-2*01 TRBC2*01 0 15 0 0 0 0 0 0 0 0

CASTHQAGTALIF-CASSETSGGVKTGELFF TRAV1-2*01 TRAJ15*01 TRAC*01 TRBV7-9*03 TRBD2*01 TRBJ2-2*01 TRBC2*01 0 14 0 0 0 0 0 0 0 0

CAVPSGYALNF-CASSPDSSADTQYF TRAV21*01 TRAJ41*01 TRAC*01 TRBV27*01 TRBD1*01 TRBJ2-3*01 TRBC2*01 0 13 0 0 0 0 0 0 0 0

CAVGDNFNKFYF-CASTMTSATGELFF TRAV8-3*01 TRAJ21*01 TRAC*01 TRBV28*01 TRBD2*01 TRBJ2-2*01 TRBC2*01 0 13 0 0 0 0 0 0 0 0

CLVGEPLNYGGSQGNLIF-CASSLEGAVPQNSYEQYF TRAV4*01 TRAJ42*01 TRAC*01 TRBV5-1*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 13 0 0 0 0 0 0 0 0

CAVIGRGGYQKVTF-CASSLASGGRTYEQYF TRAV12-2*01 TRAJ13*02 TRAC*01 TRBV5-1*01 TRBD2*01 TRBJ2-7*01 TRBC2*01 0 12 0 0 0 0 0 0 0 0

CAMRLNRDDKIIF-CASSRRGPRPDEQYF TRAV12-3*01 TRAJ30*01 TRAC*01 TRBV27*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 12 0 0 0 0 0 0 0 0

CAGRTGNQFYF-CASSLLAAPYEQYF TRAV12-2*01 TRAJ49*01 TRAC*01 TRBV6-1*01 TRBD2*01 TRBJ2-7*01 TRBC2*01 0 11 0 0 0 0 0 0 0 0

CAVEAAGNKLTF-CASSLISGRSETQYF TRAV21*01 TRAJ17*01 TRAC*01 TRBV5-5*01 TRBD2*02 TRBJ2-5*01 TRBC2*01 0 11 0 0 0 0 0 0 0 0

CAVGAATDKLIF-CSASPQSYEQYF TRAV8-3*01 TRAJ34*01 TRAC*01 TRBV20-1*02 None TRBJ2-7*01 TRBC2*01 0 11 0 0 0 0 0 0 0 0

CAVRGTGTASKLTF-CSGRAGGNEQFF TRAV21*01 TRAJ44*01 TRAC*01 TRBV29-1*01 TRBD2*02 TRBJ2-1*01 TRBC2*01 0 11 0 0 0 0 0 0 0 0

CATDEVGGNEKLTF-CASSRRGPRPDEQYF TRAV17*01 TRAJ48*01 TRAC*01 TRBV27*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 10 0 0 0 0 0 0 0 0

CALSELYQAGTALIF-CASSGGRGDEKLFF TRAV19*01 TRAJ15*01 TRAC*01 TRBV27*01 TRBD1*01 TRBJ1-4*01 TRBC1*01 0 10 0 0 0 0 0 0 0 0

CATDGGGADGLTF-CSAREGSGSEKYF TRAV17*01 TRAJ45*01 TRAC*01 TRBV20-1*02 TRBD2*02 TRBJ2-3*01 TRBC2*01 0 10 0 0 0 0 0 0 0 0

CVVRAYRDDKIIF-CASSSRLAGGITDTQYF TRAV10*01 TRAJ30*01 TRAC*01 TRBV27*01 TRBD2*02 TRBJ2-3*01 TRBC2*01 0 10 0 0 0 0 0 0 0 0

CAVNRNYGGSQGNLIF-CASGDGTGELFF TRAV3*01 TRAJ42*01 TRAC*01 TRBV28*01 TRBD1*01 TRBJ2-2*01 TRBC2*01 0 10 0 0 0 0 0 0 0 0

CAFYSNSGYALNF-CASEKGLGAYEQYF TRAV38-1*01 TRAJ41*01 TRAC*01 TRBV6-1*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 9 0 0 0 0 0 0 0 0

CAVYWGQKLLF-CASTDRDSSNIYEQYF TRAV29/DV5*01 TRAJ16*01 TRAC*01 TRBV5-4*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 9 0 0 0 0 0 0 0 0

CAASENYGQNFVF-CASSSRIQGGSYEQYF TRAV29/DV5*01 TRAJ26*01 TRAC*01 TRBV28*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 9 0 0 0 0 0 0 0 0

CAMRENSKLTF-CASSPVAGDHSGNTIYF TRAV14/DV4*01 TRAJ56*01 TRAC*01 TRBV18*01 TRBD1*01 TRBJ1-3*01 TRBC1*01 0 9 0 0 0 0 0 0 0 0

CAVGAQAREYGNKLVF-CASSLNSGTYEQYF TRAV8-3*01 TRAJ47*01 TRAC*01 TRBV5-4*01 TRBD2*02 TRBJ2-7*01 TRBC1*01 0 9 0 0 0 0 0 0 0 0

CAMSLLKGFGNVLHC-CASSVGERMTEAFF TRAV12-3*01 TRAJ35*01 TRAC*01 TRBV9*01 None TRBJ1-1*01 TRBC1*01 0 8 0 0 0 0 0 0 0 0 CAVSDGTNQFYF-CASSYGGRSSYEQYF TRAV8-6*01 TRAJ49*01 TRAC*01 TRBV6-6*01 TRBD2*01 TRBJ2-7*01 TRBC2*01 0 8 0 0 0 0 0 0 0 0

CAVSDGQKLLF-CASSHWEEQYF TRAV1-1*01 TRAJ16*01 TRAC*01 TRBV3-1*01 None TRBJ2-7*01 TRBC2*01 0 8 0 0 0 0 0 0 0 0

CAVNSGGGADGLTF-CASSSRTSGRDYEQYF TRAV41*01 TRAJ45*01 TRAC*01 TRBV7-9*03 TRBD2*02 TRBJ2-7*01 TRBC2*01 0 8 0 0 0 0 0 0 0 0

CAPQTGANNLFF-CASSPGSDYGYTF TRAV14/DV4*01 TRAJ36*01 TRAC*01 TRBV7-3*01 TRBD2*02 TRBJ1-2*01 TRBC1*01 0 8 0 0 0 0 0 0 0 0

CAGREGGSYIPTF-CASSLGVGSYNEQFF TRAV27*01 TRAJ6*01 TRAC*01 TRBV13*01 None TRBJ2-1*01 TRBC2*01 0 8 0 0 0 0 0 0 0 0

CAFMKHDYKLSF-CASSGQFPSPTDTQYF TRAV38-1*01 TRAJ20*01 TRAC*01 TRBV14*01 TRBD1*01 TRBJ2-3*01 TRBC2*01 0 7 0 0 0 0 0 0 0 0

CAASGTSGSRLTF-CATSLAGFSYNEQFF TRAV29/DV5*01 TRAJ58*01 TRAC*01 TRBV24-1*01 TRBD2*01 TRBJ2-1*01 TRBC1*01 0 7 0 0 0 0 0 0 0 0

CAASENYGQNFVF-CASSSRIAGGNYEQYF TRAV29/DV5*01 TRAJ26*01 TRAC*01 TRBV28*01 TRBD2*02 TRBJ2-7*01 TRBC2*01 0 7 0 0 0 0 0 0 0 0

CIVVPNFGNEKLTF-CAWSEDRGQGKPEAFF TRAV26-1*01 TRAJ48*01 TRAC*01 TRBV30*01 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 60 0 0 0

CFYGGATNKLIF-CASSLERGRDEQYF TRAV1-2*01 TRAJ32*02 TRAC*01 TRBV5-5*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 0 0 0 0 0 46 0 0 0

CAVRYTGFQKLVF-CASSRESASRVGYGYTF TRAV1-2*01 TRAJ8*01 TRAC*01 TRBV2*01 TRBD1*01 TRBJ1-2*01 TRBC1*01 0 0 0 0 0 0 11 0 0 0

CERSGSNYQLIW-CASSRESASRVGYGYTF TRAV1-1*01 TRAJ33*01 TRAC*01 TRBV2*01 TRBD1*01 TRBJ1-2*01 TRBC1*01 0 0 0 0 0 0 10 0 0 0

CAVRPYRDDKIIF-CASSSRLAGGSYEQYF TRAV3*01 TRAJ30*01 TRAC*01 TRBV27*01 TRBD2*02 TRBJ2-7*01 TRBC2*01 0 0 0 0 0 0 8 0 0 0

CAMREDTGRRALTF-CASSLGQGAANTEAFF TRAV14/DV4*02 TRAJ5*01 TRAC*01 TRBV7-8*01 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 6 0 0 0

CAGPISASKIIF-CAWSLRGDAEQYF TRAV13-2*01 TRAJ3*01 TRAC*01 TRBV30*01 TRBD1*01 TRBJ2-7*01 TRBC2*02 0 0 0 0 0 0 6 0 0 0

CALSDMDSNYQLIW-CASSTDLGRGSTEAFF TRAV19*01 TRAJ33*01 TRAC*01 TRBV5-8*01 TRBD2*02 TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 0 134 0

CAVNPRNDYKLSF-CASSEQIEQYF TRAV12-2*01 TRAJ20*01 TRAC*01 TRBV6-1*01 None TRBJ2-7*01 TRBC2*01 0 0 0 0 0 0 0 0 18 0

CAVDMWDMRF-CATSDPRQGVGTGELFF TRAV39*01 TRAJ43*01 TRAC*01 TRBV24-1*01 TRBD1*01 TRBJ2-2*01 TRBC2*01 0 0 0 0 0 0 0 0 9 0

CAAGTTGNQFYF-CASSQWAANTEAFF TRAV20*01 TRAJ49*01 TRAC*01 TRBV4-1*01 None TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 0 9 0

CAAIANDYKLSF-CASSLGSTPNEQFF TRAV29/DV5*01 TRAJ20*01 TRAC*01 TRBV5-4*01 None TRBJ2-1*01 TRBC2*01 0 0 0 0 0 0 0 0 8 0

CAVAANTDKLIF-CSASPASYEQYF TRAV8-3*01 TRAJ34*01 TRAC*01 TRBV20-1*02 None TRBJ2-7*01 TRBC2*01 0 0 0 0 0 0 0 0 8 0

CAVGTGGFKTIF-CASSPTGPRGGGTEAFF TRAV1-2*01 TRAJ9*01 TRAC*01 TRBV28*01 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 0 7 0

CAVRDGRAAGNKLTF-CATSDFKGPDGGVTQYF TRAV1-1*01 TRAJ17*01 TRAC*01 TRBV24-1*01 TRBD2*01 TRBJ2-5*01 TRBC2*01 0 0 0 0 0 0 0 0 7 0

CAVSGRTDKLIF-CSASPSSYEQYF TRAV8-6*02 TRAJ34*01 TRAC*01 TRBV20-1*02 None TRBJ2-7*01 TRBC2*01 0 0 0 0 0 0 0 0 7 0

CAMDSNYQLIW-CASGWESPLHF TRAV38-2/DV8*01TRAJ33*01 TRAC*01 TRBV6-5*01 TRBD2*02 TRBJ1-6*01 TRBC1*01 0 0 0 0 0 0 0 0 6 0

CAATPPASNFGNEKLTF-CASSRKWTSGDQETQYF TRAV13-1*01 TRAJ48*01 TRAC*01 TRBV7-8*01 TRBD2*01 TRBJ2-5*01 TRBC2*01 0 0 0 0 0 0 0 98 0 0

CILRDNFGNEKLTF-CASSRKWTSGDQETQYF TRAV26-2*01 TRAJ48*01 TRAC*01 TRBV7-8*01 TRBD2*01 TRBJ2-5*01 TRBC2*01 0 0 0 0 0 0 0 71 0 0

CAVRDQNAGNMLTF-CASSLNLGQGMNQPQHF TRAV1-2*01 TRAJ39*01 TRAC*01 TRBV5-4*01 TRBD1*01 TRBJ1-5*01 TRBC1*01 0 0 0 0 0 0 0 48 0 0

CAASGGYNKLIF-CASSLQREQYF TRAV29/DV5*01 TRAJ4*01 TRAC*01 TRBV2*01 None TRBJ2-7*01 TRBC2*01 0 0 0 0 0 0 0 38 0 0

CAVVDSNYQLIW-CASSHADSSSGANVLTF TRAV1-2*01 TRAJ33*01 TRAC*01 TRBV3-1*01 TRBD1*01 TRBJ2-6*01 TRBC2*01 0 0 0 0 0 0 0 29 0 0 CAMSAWEGAQKLVF-CASSYKGGVTYNEQFF TRAV12-3*01 TRAJ54*01 TRAC*01 TRBV6-6*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 0 0 0 0 0 0 27 0 0

CAMRGINTGNQFYF-CASSPTLGPRAGTDTQYF TRAV14/DV4*01 TRAJ49*01 TRAC*01 TRBV5-1*01 TRBD1*01 TRBJ2-3*01 TRBC2*01 0 0 0 0 0 0 0 20 0 0

CAVRDPRPGRKAYLRT-CASSHADSSSGANVLTF TRAV1-1*01 TRAJ23*01 TRAC*01 TRBV3-1*01 TRBD1*01 TRBJ2-6*01 TRBC2*01 0 0 0 0 0 0 0 18 0 0

CALGSNYQLIW-CASSYRGGNTIYF TRAV16*01 TRAJ33*01 TRAC*01 TRBV27*01 TRBD1*01 TRBJ1-3*01 TRBC1*01 0 0 0 0 0 0 0 17 0 0

CIVPQTGANNLFF-CASSTPSQGTEAFF TRAV26-1*01 TRAJ36*01 TRAC*01 TRBV11-2*03 None TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 16 0 0

CILRDVGGSQGNLIF-CASSLAVATGELFF TRAV26-2*01 TRAJ42*01 TRAC*01 TRBV5-4*01 None TRBJ2-2*01 TRBC2*01 0 0 0 0 0 0 0 15 0 0

CALSEGSGTYKYIF-CASSGSGTSGDEEFF TRAV19*01 TRAJ40*01 TRAC*01 TRBV9*01 TRBD2*01 TRBJ2-1*01 TRBC1*01 0 0 0 0 0 0 0 12 0 0

CALEADAGGTSYGKLTF-CASSPKIEAFF TRAV6*01 TRAJ52*01 TRAC*01 TRBV7-9*03 None TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 12 0 0

CAVVNQMDSNYQLIW-CASSQGGTGVAFF TRAV8-3*01 TRAJ33*01 TRAC*01 TRBV4-1*01 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 11 0 0

CAVAYQAGTALIF-CASEGDTQYF TRAV8-6*02 TRAJ15*01 TRAC*01 TRBV19*01 TRBD1*01 TRBJ2-3*01 TRBC2*01 0 0 0 0 0 0 0 11 0 0

CAVGDPNNAGNMLTF-CASSLAGEETQYF TRAV8-3*01 TRAJ39*01 TRAC*01 TRBV5-5*01 TRBD1*01 TRBJ2-5*01 TRBC2*01 0 0 0 0 0 0 0 10 0 0

CALGGMDSSYKLIF-CASRSGDTMNTEAFF TRAV19*01 TRAJ12*01 TRAC*01 TRBV7-9*03 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 9 0 0

CIRTNFGNEKLTF-CSVEDEAPRVYNEQFF TRAV26-2*01 TRAJ48*01 TRAC*01 TRBV29-1*01 TRBD2*02 TRBJ2-1*01 TRBC2*01 0 0 0 0 0 0 0 8 0 0

CALSSDRSGANNLFF-CASSMYSGSSYEQYF TRAV19*01 TRAJ36*01 TRAC*01 TRBV19*01 TRBD2*02 TRBJ2-7*01 TRBC2*01 0 0 0 0 0 0 0 8 0 0

CAMRVLTQGGSEKLVF-CASSPGTVYEQYF TRAV14/DV4*02 TRAJ57*01 TRAC*01 TRBV18*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 0 0 0 0 0 0 8 0 0

CAVAIPHTGANSKLTF-CASSFGTGGTPYNEQFF TRAV8-3*01 TRAJ56*01 TRAC*01 TRBV7-8*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 0 0 0 0 0 0 8 0 0

CAVILRDQAGTALIF-CASSLGTGNTEAFF TRAV1-2*01 TRAJ15*01 TRAC*01 TRBV7-9*03 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 7 0 0

CAVGALYGNKLVF-CATSGGGNTEAFF TRAV8-3*01 TRAJ47*01 TRAC*01 TRBV24-1*01 TRBD2*01 TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 7 0 0

CAVMDSNYQLIW-CASSDSTSGTDTQYF TRAV1-2*01 TRAJ33*01 TRAC*01 TRBV6-4*01 TRBD2*01 TRBJ2-3*01 TRBC2*01 0 0 0 0 0 0 0 7 0 0

CAVRDIGSGGYQKVTF-CASSQDPGSTGELFF TRAV3*01 TRAJ13*02 TRAC*01 TRBV4-1*01 None TRBJ2-2*01 TRBC2*01 0 0 0 0 0 0 0 7 0 0

CAFTLIQGAQKLVF-CASSHRVTEAFF TRAV38-1*01 TRAJ54*01 TRAC*01 TRBV11-2*03 None TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 7 0 0

CAVRDRGSQGNLIF-CASSPQGGTEAFF TRAV1-2*01 TRAJ42*01 TRAC*01 TRBV18*01 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 7 0 0

CALSEAYRDDKIIF-CASSSPSGTGSSYNEQFF TRAV19*01 TRAJ30*01 TRAC*01 TRBV6-5*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 0 0 0 0 0 0 7 0 0

CAMRGGSGTYKYIF-CASSQDRATDTQYF TRAV14/DV4*01 TRAJ40*01 TRAC*01 TRBV5-1*01 TRBD1*01 TRBJ2-3*01 TRBC2*01 0 0 0 303 0 0 0 0 0 0

CAGDRDDKIIF-CASSPMVGWTDTQYF TRAV27*01 TRAJ30*01 TRAC*01 TRBV12-4*01 TRBD2*02 TRBJ2-3*01 TRBC2*01 0 0 0 134 0 0 0 0 0 0

CAGVVASHAGNMLTF-CASSPMVGWTDTQYF TRAV27*01 TRAJ39*01 TRAC*01 TRBV12-4*01 TRBD2*02 TRBJ2-3*01 TRBC2*01 0 0 0 131 0 0 0 0 0 0

CAASNGNNDMRF-CASSLGLAGDLDEQFF TRAV13-1*01 TRAJ43*01 TRAC*01 TRBV7-9*03 TRBD2*02 TRBJ2-1*01 TRBC2*01 0 0 0 130 0 0 0 0 0 0

CAMRERGGGSNYKLTF-CASSTSQGGEQFF TRAV14/DV4*01 TRAJ53*01 TRAC*01 TRBV7-6*01 TRBD2*01 TRBJ2-1*01 TRBC2*01 0 0 0 94 0 0 0 0 0 0

CAVQEAAGNKLTF-CASNQGLAGGRLYNEQFF TRAV20*01 TRAJ17*01 TRAC*01 TRBV19*01 TRBD2*01 TRBJ2-1*01 TRBC2*01 0 0 0 81 0 0 0 0 0 0

CAIQIGDYGQNFVF-CASSVLTSGGQETQYF TRAV14/DV4*01 TRAJ26*01 TRAC*01 TRBV6-1*01 TRBD2*01 TRBJ2-5*01 TRBC2*01 0 0 0 80 0 0 0 0 0 0 CALISNFGNEKLTF-CASSAGQVQETQYF TRAV9-2*01 TRAJ48*01 TRAC*01 TRBV2*01 TRBD1*01 TRBJ2-5*01 TRBC2*01 0 0 0 73 0 0 0 0 0 0

CAVGLSGSARQLTF-CASSQVPGLAGGLHEQYF TRAV2*01 TRAJ22*01 TRAC*01 TRBV3-1*01 TRBD2*02 TRBJ2-7*01 TRBC2*01 0 0 0 56 0 0 0 0 0 0

CAVRIWAEDFGNEKLTF-CASSIGADMYEQYF TRAV3*01 TRAJ48*01 TRAC*01 TRBV19*01 None TRBJ2-7*01 TRBC2*01 0 0 0 55 0 0 0 0 0 0

CAALTSGTYKYIF-CASSLDSVDQETQYF TRAV29/DV5*01 TRAJ40*01 TRAC*01 TRBV6-5*01 TRBD1*01 TRBJ2-5*01 TRBC2*01 0 0 0 54 0 0 0 0 0 0

CAVRDEGSGAGSYQLTF-CASSQDYAGGYEQYF TRAV3*01 TRAJ28*01 TRAC*01 TRBV4-3*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 0 0 52 0 0 0 0 0 0

CAVPTSGTYKYIF-CASSLVPGLAGGLVEQFF TRAV2*01 TRAJ40*01 TRAC*01 TRBV7-9*03 TRBD2*02 TRBJ2-1*01 TRBC2*01 0 0 0 46 0 0 0 0 0 0

CAEGGGSYIPTF-CASSLTQGAQETQYF TRAV5*01 TRAJ6*01 TRAC*01 TRBV7-8*01 TRBD1*01 TRBJ2-5*01 TRBC2*01 0 0 0 45 0 0 0 0 0 0

CALSELYSGGGADGLTF-CASSPGLAGDLYEQYF TRAV19*01 TRAJ45*01 TRAC*01 TRBV13*01 TRBD2*02 TRBJ2-7*01 TRBC2*01 0 0 0 35 0 0 0 0 0 0

CVVSDRGSTLGRLYF-CASSEGGKGQPQHF TRAV10*01 TRAJ18*01 TRAC*01 TRBV25-1*01 TRBD2*01 TRBJ1-5*01 TRBC1*01 0 0 0 33 0 0 0 0 0 0

CAGLFQGGSEKLVF-CASSAWTDDYNEQFF TRAV25*01 TRAJ57*01 TRAC*01 TRBV5-6*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 0 0 30 0 0 0 0 0 0

CIVRGGGSNYKLTF-CASSEDPGGRPQHF TRAV26-1*01 TRAJ53*01 TRAC*01 TRBV6-1*01 TRBD1*01 TRBJ1-5*01 TRBC1*01 0 0 0 28 0 0 0 0 0 0

CIVMGGSNYKLTF-CSARDRGSSNSPLHF TRAV26-1*01 TRAJ53*01 TRAC*01 TRBV20-1*02 TRBD1*01 TRBJ1-6*02 TRBC1*01 0 0 0 28 0 0 0 0 0 0

CAMSKFTSGTYKYIF-CASSPYDREGGYTF TRAV12-3*01 TRAJ40*01 TRAC*01 TRBV7-9*03 TRBD1*01 TRBJ1-2*01 TRBC1*01 0 0 0 26 0 0 0 0 0 0

CIVRVDNTGKLIF-CASRAGPHYEQYF TRAV26-1*01 TRAJ37*01 TRAC*01 TRBV6-1*01 TRBD2*02 TRBJ2-7*01 TRBC2*01 0 0 0 26 0 0 0 0 0 0

CASEMKTSYDKVIF-CASSPGLAGDLYEQYF TRAV24*01 TRAJ50*01 TRAC*01 TRBV13*01 TRBD2*02 TRBJ2-7*01 TRBC2*01 0 0 0 24 0 0 0 0 0 0

CALSEYAQGGSEKLVF-CASSAPSGDTYEQYF TRAV19*01 TRAJ57*01 TRAC*01 TRBV28*01 TRBD2*01 TRBJ2-7*01 TRBC2*01 0 0 0 24 0 0 0 0 0 0

CIVRVVRGAGGTSYGKLTF-CSARDRGSSNSPLHF TRAV26-1*01 TRAJ52*01 TRAC*01 TRBV20-1*02 TRBD1*01 TRBJ1-6*02 TRBC1*01 0 0 0 22 0 0 0 0 0 0

CIVSGGSNYKLTF-CSVRGRGSTNSPLHF TRAV26-1*01 TRAJ53*01 TRAC*01 TRBV20-1*02 None TRBJ1-6*02 TRBC1*01 0 0 0 20 0 0 0 0 0 0

CAVNFF-CASSTGTSLYNEQFF TRAV12-2*01 TRAJ16*01 TRAC*01 TRBV7-9*03 TRBD2*01 TRBJ2-1*01 TRBC2*01 0 0 0 19 0 0 0 0 0 0

CILIYSGAGSYQLTF-CASSTLFFEGQVRGYTF TRAV26-2*01 TRAJ28*01 TRAC*01 TRBV2*01 TRBD1*01 TRBJ1-2*01 TRBC1*01 0 0 0 19 0 0 0 0 0 0

CLVGSYGGATNKLIF-CASSYHAPGQGNTEAFF TRAV4*01 TRAJ32*02 TRAC*01 TRBV6-2*01 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 19 0 0 0 0 0 0

CAASIMGNTPLVF-CASSSGTGVYNEQFF TRAV13-1*01 TRAJ29*01 TRAC*01 TRBV5-1*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 0 0 18 0 0 0 0 0 0

CAMSQGAQKLVF-CASSPGAGSIVEKLFF TRAV12-3*01 TRAJ54*01 TRAC*01 TRBV6-1*01 TRBD1*01 TRBJ1-4*01 TRBC1*01 0 0 0 17 0 0 0 0 0 0

CAVGATSYSGYSTLTF-CASSENRGTYNEQFF TRAV8-3*01 TRAJ11*01 TRAC*01 TRBV5-4*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 0 0 16 0 0 0 0 0 0

CVAREAGGGNKLTF-CASSQGQGTGYTF TRAV12-1*01 TRAJ10*01 TRAC*01 TRBV6-5*01 TRBD1*01 TRBJ1-2*01 TRBC1*01 0 0 0 16 0 0 0 0 0 0

CVVTTTSGTYKYIF-CASSQEAYGYTF TRAV12-1*01 TRAJ40*01 TRAC*01 TRBV16*01 TRBD2*02 TRBJ1-2*01 TRBC1*01 0 0 0 15 0 0 0 0 0 0

CVVRPGSHALNF-CASSLASGVGTGELFF TRAV10*01 TRAJ41*01 TRAC*01 TRBV7-8*01 TRBD2*01 TRBJ2-2*01 TRBC2*01 0 0 0 15 0 0 0 0 0 0

CALPSYNTDKLIF-CSVVAGGPRTDTQYF TRAV9-2*01 TRAJ34*01 TRAC*01 TRBV29-1*01 TRBD2*01 TRBJ2-3*01 TRBC2*01 0 0 0 14 0 0 0 0 0 0

CAGHPSNTGKLIF-CASSPVPGQEYGYTF TRAV35*01 TRAJ37*02 TRAC*01 TRBV5-1*01 TRBD1*01 TRBJ1-2*01 TRBC1*01 0 0 0 14 0 0 0 0 0 0

CAVCDYKLSF-CASSSHGQGLDEQFF TRAV21*01 TRAJ20*01 TRAC*01 TRBV7-6*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 0 0 13 0 0 0 0 0 0 CAVKDSNYQLIW-CASGTDDSTDTQYF TRAV1-2*01 TRAJ33*01 TRAC*01 TRBV6-1*01 TRBD1*01 TRBJ2-3*01 TRBC1*01 0 0 0 13 0 0 0 0 0 0

CALTGAHSGGYQKVTF-CASSPGSHEQYF TRAV9-2*01 TRAJ13*02 TRAC*01 TRBV18*01 None TRBJ2-7*01 TRBC2*01 0 0 0 13 0 0 0 0 0 0

CAVSRQGSYIPTF-CASSSGQGHSTDTQYF TRAV3*01 TRAJ6*01 TRAC*01 TRBV5-1*01 TRBD1*01 TRBJ2-3*01 TRBC2*01 0 0 0 12 0 0 0 0 0 0

CVVNKGGKLIF-CASSQEVGTSSEQYF TRAV12-1*01 TRAJ37*01 TRAC*01 TRBV4-1*01 TRBD2*01 TRBJ2-7*01 TRBC2*01 0 0 0 11 0 0 0 0 0 0

CVVSDSGSARQLTF-CASSLVPGGLPYNEQFF TRAV8-2*01 TRAJ22*01 TRAC*01 TRBV5-1*01 TRBD2*01 TRBJ2-1*01 TRBC2*01 0 0 0 11 0 0 0 0 0 0

CAENPLQGAQKLVF-CASTPRGRQGIRGYTF TRAV13-2*01 TRAJ54*01 TRAC*01 TRBV2*01 TRBD1*01 TRBJ1-2*01 TRBC1*01 0 0 0 10 0 0 0 0 0 0

CATQGAQKLVF-CSVRGRGSTNSPLHF TRAV17*01 TRAJ54*01 TRAC*01 TRBV20-1*02 None TRBJ1-6*02 TRBC1*01 0 0 0 10 0 0 0 0 0 0

CAGRSHNTGNQFYF-CASSQDLGQGGTGELFF TRAV35*01 TRAJ49*01 TRAC*01 TRBV4-1*01 TRBD1*01 TRBJ2-2*01 TRBC2*01 0 0 0 10 0 0 0 0 0 0

CAVRDQYNFNKFYF-CASSQDAGSVPHGYTF TRAV3*01 TRAJ21*01 TRAC*01 TRBV4-1*01 TRBD2*01 TRBJ1-2*01 TRBC1*01 0 0 0 10 0 0 0 0 0 0

CAVSPGNTGKLIF-CSARDESTGVRDTQYF TRAV1-2*01 TRAJ37*01 TRAC*01 TRBV20-1*02 TRBD2*02 TRBJ2-3*01 TRBC2*01 0 0 0 10 0 0 0 0 0 0

CAVEGGVTSGTYKYIF-CAISGPGPGGYYEQYF TRAV36/DV7*01 TRAJ40*01 TRAC*01 TRBV10-3*01 TRBD2*01 TRBJ2-7*01 TRBC2*01 0 0 0 9 0 0 0 0 0 0

CALSGGSNYKLTF-CSARQGNEKLFF TRAV9-2*01 TRAJ53*01 TRAC*01 TRBV20-1*02 TRBD1*01 TRBJ1-4*01 TRBC1*01 0 0 0 9 0 0 0 0 0 0

CAVMDSSYKLIF-CASSELAGGPNEQFF TRAV1-2*01 TRAJ12*01 TRAC*01 TRBV6-1*01 TRBD2*02 TRBJ2-1*01 TRBC2*01 0 0 0 9 0 0 0 0 0 0

CALSEEYYGGSQGNLIF-CATSDSDRGRDEQYF TRAV19*01 TRAJ42*01 TRAC*01 TRBV24-1*01 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 0 0 8 0 0 0 0 0 0

CAVLLWKAAGNKLTF-CSARDGGSGSAREQFF TRAV22*01 TRAJ17*01 TRAC*01 TRBV20-1*02 TRBD2*02 TRBJ2-1*01 TRBC2*01 0 0 0 8 0 0 0 0 0 0

CAVSRDRDDKIIF-CASSQVIQVNYGYTF TRAV20*01 TRAJ30*01 TRAC*01 TRBV4-1*01 None TRBJ1-2*01 TRBC1*01 0 0 0 8 0 0 0 0 0 0

CVVSVRMDSSYKLIF-CASSSLSGGGGNEQFF TRAV8-2*01 TRAJ12*01 TRAC*01 TRBV6-6*01 TRBD2*01 TRBJ2-1*01 TRBC2*01 0 0 0 7 0 0 0 0 0 0

CAVRPFNTGFQKLVF-CSALPGQGGNSPLHF TRAV1-2*01 TRAJ8*01 TRAC*01 TRBV20-1*02 TRBD1*01 TRBJ1-6*02 TRBC1*01 0 0 0 7 0 0 0 0 0 0

CAVGRGSNYKLTF-CASSFGSQPQHF TRAV8-3*01 TRAJ53*01 TRAC*01 TRBV28*01 None TRBJ1-5*01 TRBC1*01 0 0 0 7 0 0 0 0 0 0

CAVNSFTSGTYKYIF-CASSLAGDPYNEQFF TRAV12-2*01 TRAJ40*01 TRAC*01 TRBV7-8*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 0 0 7 0 0 0 0 0 0

CAYRSPTSGTYKYIF-CASSAGQERAFF TRAV38-2/DV8*01TRAJ40*01 TRAC*01 TRBV25-1*01 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 7 0 0 0 0 0 0

CAVRDWDSNYQLIW-CASIVDTEAFF TRAV1-2*01 TRAJ33*01 TRAC*01 TRBV2*01 None TRBJ1-1*01 TRBC1*01 0 0 0 7 0 0 0 0 0 0

CAASKGNARLMF-CSATSTGSISYEQYF TRAV13-1*01 TRAJ31*01 TRAC*01 TRBV20-1*02 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 0 0 7 0 0 0 0 0 0

CAMRERLGSASKIIF-CSARDTGPYEQYF TRAV14/DV4*02 TRAJ3*01 TRAC*01 TRBV20-1*02 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 0 0 0 0 85 0 0 0 0

CASDNAGNMLTF-CASSPQSQNIQYF TRAV12-2*01 TRAJ39*01 TRAC*01 TRBV9*01 None TRBJ2-4*01 TRBC2*01 0 0 0 0 0 72 0 0 0 0

CAENSHFNAGGTSYGKLTF-CASSYSGHPGRAFF TRAV13-2*01 TRAJ52*01 TRAC*01 TRBV5-1*01 TRBD2*02 TRBJ1-1*01 TRBC1*01 0 0 0 0 0 23 0 0 0 0

CALPPDGQKLLF-CSARDTGPYEQYF TRAV6*01 TRAJ16*01 TRAC*01 TRBV20-1*02 TRBD1*01 TRBJ2-7*01 TRBC2*01 0 0 0 0 0 22 0 0 0 0

CALEAGNMLTF-CSVEPDRGRKETQYF TRAV6*01 TRAJ39*01 TRAC*01 TRBV29-1*01 TRBD1*01 TRBJ2-5*01 TRBC2*01 0 0 0 0 0 16 0 0 0 0

CLVGGYNKLIF-CASSPTTRSTSYNEQFF TRAV4*01 TRAJ4*01 TRAC*01 TRBV28*01 None TRBJ2-1*01 TRBC2*01 0 0 0 0 0 14 0 0 0 0

CAVYDYKLSF-CASSQERGVYNEQFF TRAV12-2*01 TRAJ20*01 TRAC*01 TRBV3-1*01 TRBD1*01 TRBJ2-1*01 TRBC2*01 0 0 0 0 0 14 0 0 0 0 CATDSTSGTYKYIF-CASSLEGASGYTF TRAV17*01 TRAJ40*01 TRAC*01 TRBV13*01 TRBD1*01 TRBJ1-2*01 TRBC1*01 0 0 0 0 0 14 0 0 0 0

CAGEDYGQNFVF-CASSLGWNEQFF TRAV27*01 TRAJ26*01 TRAC*01 TRBV7-9*03 None TRBJ2-1*01 TRBC2*01 0 0 0 0 0 12 0 0 0 0

CAVSSSGGYQKVTF-CSARDPRWGEKLFF TRAV8-6*01 TRAJ13*02 TRAC*01 TRBV20-1*02 TRBD2*01 TRBJ1-4*01 TRBC1*01 0 0 0 0 0 9 0 0 0 0

CAVSDRTDKLIF-CSASPSSYEQYF TRAV8-6*02 TRAJ34*01 TRAC*01 TRBV20-1*02 None TRBJ2-7*01 TRBC1*01 0 0 0 0 0 9 0 0 0 0

CAVIDLYSGAGSYQLTF-CASSIVGNSGELFF TRAV8-1*01 TRAJ28*01 TRAC*01 TRBV19*01 None TRBJ2-2*01 TRBC2*01 0 0 0 0 0 9 0 0 0 0

CAPPLSSGSARQLTF-CASSLGWNEQFF TRAV16*01 TRAJ22*01 TRAC*01 TRBV7-9*03 None TRBJ2-1*01 TRBC2*01 0 0 0 0 0 8 0 0 0 0

CAMWSSGGSNYKLTF-CASNLGATGELFF TRAV12-3*01 TRAJ53*01 TRAC*01 TRBV9*01 TRBD1*01 TRBJ2-2*01 TRBC2*01 0 0 0 0 0 8 0 0 0 0

CAARIQGAQKLVF-CASSPGGAAKNIQYF TRAV29/DV5*01 TRAJ54*01 TRAC*01 TRBV6-1*01 TRBD1*01 TRBJ2-4*01 TRBC2*01 0 0 0 0 0 8 0 0 0 0

CAPQDSNYQLIW-CSAFSGSEHNEQFF TRAV1-2*01 TRAJ33*01 TRAC*01 TRBV20-1*02 TRBD2*02 TRBJ2-1*01 TRBC2*01 0 0 0 0 0 7 0 0 0 0

CALVETGANNLFF-CASSLPGMNTEAFF TRAV19*01 TRAJ36*01 TRAC*01 TRBV11-3*01 TRBD2*02 TRBJ1-1*01 TRBC2*02 0 0 0 0 0 0 0 0 0 147

CASPGAGSYQLTF-CASSLWSATNEKLFF TRAV36/DV7*01 TRAJ28*01 TRAC*01 TRBV28*01 None TRBJ1-4*01 TRBC2*02 0 0 0 0 0 0 0 0 0 48

CAVGDNAGNMLTF-CASSEVWASDHEQYF TRAV22*01 TRAJ39*01 TRAC*01 TRBV6-1*01 TRBD2*01 TRBJ2-7*01 TRBC2*02 0 0 0 0 0 0 0 0 0 45

CATDRGDYKLSF-CASSLFLSSYNSPLHF TRAV17*01 TRAJ20*01 TRAC*01 TRBV27*01 None TRBJ1-6*02 TRBC2*02 0 0 0 0 0 0 0 0 0 43

CIVRVQPLNDYKLSF-CASSFGGREAGNTIYF TRAV26-1*01 TRAJ20*01 TRAC*01 TRBV12-4*01 TRBD1*01 TRBJ1-3*01 TRBC2*02 0 0 0 0 0 0 0 0 0 37

CALGPDKLIF-CASSPHTSTDTQYF TRAV14/DV4*01 TRAJ34*01 TRAC*01 TRBV7-9*03 None TRBJ2-3*01 TRBC2*02 0 0 0 0 0 0 0 0 0 23

CALPGPHFNKFYF-CASSDRDRELFF TRAV6*01 TRAJ21*01 TRAC*01 TRBV6-5*01 None TRBJ2-2*01 TRBC2*02 0 0 0 0 0 0 0 0 0 17

CAAYTGRRALTF-CASSRQGVLEAFF TRAV12-2*01 TRAJ5*01 TRAC*01 TRBV7-9*03 TRBD1*01 TRBJ1-1*01 TRBC1*01 0 0 0 0 0 0 0 0 0 14

CAVGASNDYKLSF-CASSLYRDISYEQYF TRAV8-3*01 TRAJ20*01 TRAC*01 TRBV4-3*01 TRBD1*01 TRBJ2-7*01 TRBC2*02 0 0 0 0 0 0 0 0 0 13

CAFATGNQFYF-CASSAVLAGGTDTQYF TRAV38-1*01 TRAJ49*01 TRAC*01 TRBV11-2*01 TRBD2*01 TRBJ2-3*01 TRBC2*02 0 0 0 0 0 0 0 0 0 12

CAGQAGTALIF-CASSQGEGGYTF TRAV12-2*01 TRAJ15*01 TRAC*01 TRBV4-1*01 TRBD2*01 TRBJ1-2*01 TRBC2*02 0 0 0 0 0 0 0 0 0 12

CAVQAEGNAGNMLTF-CASSFQAGSISGNTIYF TRAV20*01 TRAJ39*01 TRAC*01 TRBV7-2*01 TRBD2*01 TRBJ1-3*01 TRBC1*01 0 0 0 0 0 0 0 0 0 12

CAVRDEGGSYIPTF-CASSLEWVDTQYF TRAV3*01 TRAJ6*01 TRAC*01 TRBV7-2*01 TRBD1*01 TRBJ2-3*01 TRBC2*02 0 0 0 0 0 0 0 0 0 9

CAVRGNTDKLIF-CASSFQAGSISGNTIYF TRAV21*01 TRAJ34*01 TRAC*01 TRBV7-2*01 TRBD2*01 TRBJ1-3*01 TRBC2*02 0 0 0 0 0 0 0 0 0 9

CASGGEYGNKLVF-CATSRDQRGVYGYTF TRAV12-3*01 TRAJ47*01 TRAC*01 TRBV15*01 TRBD2*01 TRBJ1-2*01 TRBC1*01 0 0 0 0 0 0 0 0 0 8

CALSGTSF-CASSPPSTGTGELFF TRAV19*01 TRAJ16*01 TRAC*01 TRBV9*01 TRBD2*01 TRBJ2-2*01 TRBC2*02 0 0 0 0 0 0 0 0 0 8

CAASQGAQKLVF-CASSQDGRQTSYEQYF TRAV29/DV5*01 TRAJ54*01 TRAC*01 TRBV4-1*01 TRBD2*02 TRBJ2-7*01 TRBC2*02 0 0 0 0 0 0 0 0 0 7

CAVGDNFNKFYF-CASSRTSATGELFF TRAV8-3*01 TRAJ21*01 TRAC*01 TRBV28*01 TRBD2*01 TRBJ2-2*01 TRBC2*02 0 0 0 0 0 0 0 0 0 7

CAESSGGYQKVTF-CASGFGSGNTIYF TRAV5*01 TRAJ13*02 TRAC*01 TRBV12-5*01 None TRBJ1-3*01 TRBC2*02 0 0 0 0 0 0 0 0 0 7 Table S10 List of the most enriched clone antibodies in each patient by BCR single cell transcriptome analysis

Patient Patient Patient IGLorK_CDR3_IGH_CDR3 IGLorK_v_gene IGLorK_j_gene IGLorK_c_gene IGH_v_gene IGH_d_gene IGH_j_gene IGH_c_gene Patient1 Patient2 Patient3 Patient5 Patient7 Patient9 Patient10 4 6 8

CQAGDSSTHVIL_CAGNTGYYYYYGMDVW IGLV3-1*01 IGLJ2*01 IGLC3*01 IGHV4-34*01 IGHD2-8*02 IGHJ6*02 IGHG2*03 4 0 0 0 0 0 0 0 0 0

CQAGDNNIHVVL_CAGNTGYYYYYGLDVW IGLV3-1*01 IGLJ2*01 IGLC3*01 IGHV4-34*01 IGHD2-8*02 IGHJ6*02 IGHG3*01 3 0 0 0 0 0 0 0 0 0

CQTWGTGLQVF_CAREWADSTSSAFDYW IGLV4-69*02 IGLJ2*01 IGLC3*01 IGHV3-30-3*03 IGHD1-1*01 IGHJ4*02 IGHG1*01 3 0 0 0 0 0 0 0 0 0

CMQATQFPLTF_CVREVYGDPFDYW IGKV2-24*01 IGKJ4*01 IGKC*01 IGHV3-30-3*01 IGHD4/OR15-4a*01 IGHJ4*02 IGHA1*01 0 0 14 0 0 0 0 0 0 0

CQQYYNTPYTF_CARDAVGATDRIPFDYW IGKV4-1*01 IGKJ2*01 IGKC*01 IGHV3-74*01 IGHD1-26*01 IGHJ4*02 IGHM*01 0 0 3 0 0 0 0 0 0 0

CQQYYTTWTF_CSSTVAEGIDYW IGKV4-1*01 IGKJ1*01 IGKC*01 IGHV3-15*01 IGHD6-19*01 IGHJ4*02 IGHM*01 0 0 3 0 0 0 0 0 0 0

CHQYYRNPYTF_CARVKDWELLPLSYW IGKV4-1*01 IGKJ2*01 IGKC*01 IGHV5-51*01 IGHD1-26*01 IGHJ4*02 IGHG1*01 0 0 0 0 5 0 0 0 0 0

CQQSYRTPFTF_CARHKGGDNRFDPW IGKV1-39*01 IGKJ4*01 IGKC*01 IGHV4-39*01 IGHD3-16*01 IGHJ5*02 IGHM*01 0 0 0 0 5 0 0 0 0 0

CQVAGISGDHVIF_CGRGRVGRTHVAVDVW IGLV3-21*01 IGLJ2*01 IGLC3*01 IGHV3-33*01 IGHD2-15*01 IGHJ6*02 IGHD*01 0 0 0 0 4 0 0 0 0 0

CATRDDSLSVRVF_CASGQEYSGYDSAYW IGLV1-47*02 IGLJ3*02 IGLC3*01 IGHV3-30-3*03 IGHD5-12*01 IGHJ4*02 IGHA1*01 0 5 0 0 0 0 0 0 0 0

CELYLGRGISVF_CATGGREQFNW IGLV8-61*02 IGLJ3*02 IGLC3*01 IGHV3-7*01 IGHD1-26*01 IGHJ4*02 IGHA2*01 0 3 0 0 0 0 0 0 0 0

CTQATQFPYTF_CARDRDYIDYW IGKV2-24*01 IGKJ2*01 IGKC*01 IGHV1-18*01 None IGHJ4*02 IGHA1*01 0 0 0 0 0 0 5 0 0 0

CMQGTHWITF_CARDDDTDPSHFDHW IGKV2-30*01 IGKJ5*01 IGKC*01 IGHV3-48*02 IGHD4-11*01 IGHJ4*02 IGHA1*01 0 0 0 0 0 0 3 0 0 0

CMQTTQFPQTF_CAKRREIFWLGEGRGTPDY IGKV2-24*01 IGKJ4*01 IGKC*01 IGHV3-30*18 IGHD3-10*01 IGHJ4*02 IGHG1*01 0 0 0 0 0 0 3 0 0 0 W

CQQLSDNLPWTF_CARKIKEPGRYFDYW IGKV1-9*01 IGKJ2*02 IGKC*01 IGHV7-4-1*02 IGHD1-26*01 IGHJ4*02 IGHA1*01 0 0 0 0 0 0 3 0 0 0

CQQYGSSPWTF_CARVAESYYDFWSAKWEG IGKV3-20*01 IGKJ1*01 IGKC*01 IGHV3-53*01 IGHD3-3*01 IGHJ3*02 IGHM*01 0 0 0 0 0 0 0 361 0 0 AFDIW

CQQYNSYSF_CARSGPITIFGVVIKGRGGDAFD IGKV1-5*01 IGKJ3*01 IGKC*01 IGHV1-2*04 IGHD3-3*01 IGHJ3*02 IGHM*01 0 0 0 0 0 0 0 119 0 0 IW

CYSTDSSGNHYVF_CARVAESYYDFWSAKWE IGLV3-10*02 IGLJ1*01 IGLC1*01 IGHV3-53*01 IGHD3-3*01 IGHJ3*02 IGHM*01 0 0 0 0 0 0 0 7 0 0 GAFDIW

CKQGIHLPYTF_CARDGDSYGHDFDYW IGKV2-29*02 IGKJ2*01 IGKC*01 IGHV3-74*01 IGHD5-18*01 IGHJ4*02 IGHA1*01 0 0 0 0 0 0 0 7 0 0

CMQGSHWPRTF_CARDRFFRTFDYW IGKV2-30*01 IGKJ1*01 IGKC*01 IGHV3-7*01 IGHD3/OR15-3a*01 IGHJ4*02 IGHM*01 0 0 0 0 0 0 0 6 0 0 CSYAGGYTWVF_CTRDVSYSSNCW IGLV2-8*02 IGLJ3*02 IGLC3*01 IGHV3-74*01 IGHD6-19*01 IGHJ4*02 IGHG2*04 0 0 0 0 0 0 0 5 0 0

CQSYDSSLYGVIF_CARVAESYYDFWSAKWE IGLV1-40*01 IGLJ2*01 IGLC3*01 IGHV3-53*01 IGHD3-3*01 IGHJ3*02 IGHM*01 0 0 0 0 0 0 0 5 0 0 GAFDIW

CSYAGSSTFVF_CAKNTDYDFWSDYPKGYWF IGLV2-23*03 IGLJ1*01 IGLC1*01 IGHV3-23D*01 IGHD3-3*01 IGHJ5*02 IGHA1*01 0 0 0 0 0 0 0 4 0 0 GPW

CMQTLQTPHSF_CARGHSNYWSLSAVSLGYW IGKV2-28*01 IGKJ4*01 IGKC*01 IGHV3-11*06 IGHD4-11*01 IGHJ4*02 IGHA1*01 0 0 0 0 0 0 0 4 0 0

CSSYTTSTSPGF_CARDRTPNLSVLLSQFDYW IGLV2-14*02 IGLJ2*01 IGLC3*01 IGHV4-38-2*02 IGHD2/OR15-2a*01 IGHJ4*02 IGHA1*01 0 0 0 0 0 0 0 4 0 0

CMQALQTPLTF_CAKDLTPDGRWDIDYW IGKV2-28*01 IGKJ4*01 IGKC*01 IGHV3-23D*01 IGHD4-23*01 IGHJ4*02 IGHM*01 0 0 0 0 0 0 0 3 0 0

CQSYDSSLYGVIF_CARSGPITIFGVVIKGRGG IGLV1-40*01 IGLJ2*01 IGLC3*01 IGHV1-2*04 IGHD3-3*01 IGHJ3*02 IGHM*01 0 0 0 0 0 0 0 3 0 0 DAFDIW

CQPYNTYWTF_CARDRSRFCSGDSCFPFDLW IGKV1-5*01 IGKJ1*01 IGKC*01 IGHV1-18*01 IGHD2-15*01 IGHJ4*02 IGHA1*01 0 0 0 7 0 0 0 0 0 0

CGTWDSSLSAGVF_CARDPATFSIYFPSGAPIL IGLV1-41*01 IGLJ3*02 IGLC3*01 IGHV3-30-3*03 IGHD2/OR15-2a*01 IGHJ4*02 IGHG1*01 0 0 0 5 0 0 0 0 0 0 GW

CQQYFSTPHTF_CARKQWLGPIDYW IGKV4-1*01 IGKJ2*01 IGKC*01 IGHV4-34*01 IGHD6-19*01 IGHJ4*02 IGHM*01 0 0 0 4 0 0 0 0 0 0

CQQYYSIPSLTF_CATHRTYFDWLLPFDYW IGKV4-1*01 IGKJ4*01 IGKC*01 IGHV3-30-3*03 IGHD3-9*01 IGHJ4*02 IGHA1*01 0 0 0 0 0 179 0 0 0 0

CQHYYSSPPWTF_CARHRRSGSYGEALDLW IGKV4-1*01 IGKJ1*01 IGKC*01 IGHV1-18*01 IGHD1-26*01 IGHJ3*01 IGHA1*01 0 0 0 0 0 154 0 0 0 0

CSSYTSAATLVF_CARDPHTYDFWSEGDFL IGLV2-14*02 IGLJ3*02 IGLC3*01 IGHV1-2*02 IGHD3-3*01 IGHJ4*02 IGHG1*01 0 0 0 0 0 134 0 0 0 0

CQQSYNTPYTF_CARDRNYDFWNGFYTSNYY IGKV1-39*01 IGKJ2*01 IGKC*01 IGHV3-66*01 IGHD3-3*01 IGHJ6*03 IGHG1*01 0 0 0 0 0 129 0 0 0 0 YMDVW

CQVWDSTRDHPGVF_CAKSETSFGVTAPFDY IGLV3-21*01 IGLJ1*01 IGLC1*01 IGHV3-30*18 IGHD3-3*02 IGHJ4*02 IGHA1*01 0 0 0 0 0 93 0 0 0 0 W

CQQYNNLVLTF_CAKDERAYYHYMDVW IGKV1D-33*01 IGKJ4*01 IGKC*01 IGHV3-9*01 IGHD1-1*01 IGHJ6*03 IGHA1*01 0 0 0 0 0 76 0 0 0 0

CLAWDDKNVVF_CARIHYYESNVYDHW IGLV3-1*01 IGLJ2*01 IGLC3*01 IGHV2-26*01 IGHD3-22*01 IGHJ4*01 IGHA1*01 0 0 0 0 0 70 0 0 0 0

CMQALQTPETF_CARTQYSSSSDYW IGKV2-28*01 IGKJ1*01 IGKC*01 IGHV3-21*01 IGHD6-6*01 IGHJ4*02 IGHM*01 0 0 0 0 0 60 0 0 0 0

CSSYAGSNNWVF_CARDDSAGILTGIGGYW IGLV2-8*02 IGLJ3*02 IGLC3*01 IGHV1-2*02 IGHD3-9*01 IGHJ4*02 IGHM*01 0 0 0 0 0 40 0 0 0 0

CQQAKSFPLTF_CTRYSLSSGWIDPW IGKV1-12*02 IGKJ4*01 IGKC*01 IGHV3-49*03 IGHD6-6*01 IGHJ5*02 IGHA1*01 0 0 0 0 0 37 0 0 0 0

CQAWDSTTVLF_CARDPHTYDFWSEGDFL IGLV3-1*01 IGLJ2*01 IGLC2*02 IGHV1-2*02 IGHD3-3*01 IGHJ4*02 IGHG1*01 0 0 0 0 0 23 0 0 0 0

CGAWDDTLSAAVF_CARVFMLRDVDWSKTSQ IGLV1-41*01 IGLJ2*01 IGLC3*01 IGHV4-59*01 IGHD3-9*01 IGHJ6*03 IGHA1*01 0 0 0 0 0 10 0 0 0 0 NYYMDVW

CQQYNNLVLTF_CARGIAARTFDYW IGKV1D-33*01 IGKJ4*01 IGKC*01 IGHV3-74*01 IGHD6-6*01 IGHJ4*02 IGHM*01 0 0 0 0 0 9 0 0 0 0 CNSFTTSSTLVF_CAKDERAYYHYMDVW IGLV2-14*02 IGLJ2*01 IGLC1*01 IGHV3-9*01 IGHD1-1*01 IGHJ6*03 IGHA1*01 0 0 0 0 0 7 0 0 0 0

CSSYTSAATLVF_CVRQVFTLLGVPKNNYFDP IGLV2-14*02 IGLJ3*02 IGLC3*01 IGHV4-39*01 IGHD3-3*01 IGHJ5*02 IGHA1*01 0 0 0 0 0 7 0 0 0 0 W

CMQALQTPETF_CARGTAYYYGSGSYYKVLS IGKV2-28*01 IGKJ1*01 IGKC*01 IGHV4-34*01 IGHD3-10*01 IGHJ4*02 IGHD*01 0 0 0 0 0 3 0 0 0 0 GHHFDYW

CLLYYGGAQRVVF_CARVFSAIFLKIDYW IGLV7-43*01 IGLJ2*01 IGLC3*01 IGHV1-18*01 IGHD3-9*01 IGHJ4*02 IGHM*03 0 0 0 0 0 3 0 0 0 0

CKSYEGSQSYVF_CAKYHYGSGTSSGYW IGLV2-14*02 IGLJ1*01 IGLC1*01 IGHV3-7*01 IGHD3-10*01 IGHJ4*02 IGHG2*03 0 0 0 0 0 0 0 0 3 0

CQQSYSTPALTF_CARSAPVVGATISYYGMDV IGKV1-39*01 IGKJ4*01 IGKC*01 IGHV1-2*02 IGHD1-26*01 IGHJ6*02 IGHD*01 0 0 0 0 0 0 0 0 3 0 W

CQQTYSTPRLTF_CARSHDSSDYYYRTYYYG IGKV1-39*01 IGKJ4*01 IGKC*01 IGHV5-51*01 IGHD3-22*01 IGHJ6*02 IGHA1*01 0 0 0 0 0 0 0 0 3 0 MDVW

CQQYYSTQTF_CARDLTGYFDYW IGKV4-1*01 IGKJ1*01 IGKC*01 IGHV3-33*01 IGHD7-27*01 IGHJ4*02 IGHM*03 0 0 0 0 0 0 0 0 3 0

CSSYAGSNNYVF_CARHRSGGYYDYW IGLV2-8*02 IGLJ1*01 IGLC1*01 IGHV3-9*03 IGHD3-10*01 IGHJ4*02 IGHM*01 0 0 0 0 0 0 0 0 3 0

CLLSYSGPWVF_CARARGGSYSVSQSEGRLD IGLV7-46*02 IGLJ3*02 IGLC3*01 IGHV1-18*01 IGHD1-26*01 IGHJ4*02 IGHA2*01 0 0 0 0 0 0 0 0 3 0 YW

CAAWDDSLSGNWVF_CARDQSIHDILTGYYYG IGLV1-47*02 IGLJ3*02 IGLC3*01 IGHV1-18*01 IGHD3-9*01 IGHJ6*02 IGHG1*01 0 0 0 0 0 0 0 0 0 11 MDVW

CMQGIHLPFTF_CARAGYSSGWYLGDYYYYG IGKV2-29*02 IGKJ3*01 IGKC*01 IGHV1-69*01 IGHD6-19*01 IGHJ6*02 IGHG1*01 0 0 0 0 0 0 0 0 0 5 MDVW

CQKYNSAPRTF_CARIQLWLDYYYYYGMDVW IGKV1-27*01 IGKJ1*01 IGKC*01 IGHV4-34*01 IGHD5-18*01 IGHJ6*02 IGHG1*01 0 0 0 0 0 0 0 0 0 5

CAAWDDSLNGWVF_CARDEYYGSGSYYSLGY IGLV1-47*02 IGLJ3*02 IGLC3*01 IGHV1-69*01 IGHD3-10*01 IGHJ6*02 IGHG1*01 0 0 0 0 0 0 0 0 0 5 YYYGMDVW

CMQGTHWPPLTF_CARGPPRLNFDWLLLENN IGKV2-30*01 IGKJ4*01 IGKC*01 IGHV3-11*06 IGHD3-9*01 IGHJ5*02 IGHG1*01 0 0 0 0 0 0 0 0 0 4 WFDPW

CSSYTSSSISYVF_CARVRRVWTTGTGVAFDI IGLV2-14*02 IGLJ1*01 IGLC1*01 IGHV4-4*07 IGHD1-1*01 IGHJ3*02 IGHG1*01 0 0 0 0 0 0 0 0 0 4 W

CGTWDSDLSAWVF_CARIRRESGSQFSIDYW IGLV1-41*01 IGLJ2*01 IGLC3*01 IGHV2-70*15 IGHD1-26*01 IGHJ4*02 IGHM*01 0 0 0 0 0 0 0 0 0 4 References and Notes

References and Notes:

1. M. R. Duffy et al., Zika virus outbreak on Yap Island, Federated States of Micronesia. The New England journal of medicine 360, 2536-2543 (2009). 2. Y. P. Wu, R. Wei, P. G. de Groot, SARS in Hong Kong. The New England journal of medicine 349, 708-709 (2003). 3. C. J. Peters, Marburg and Ebola--arming ourselves against the deadly filoviruses. The New England journal of medicine 352, 2571-2573 (2005). 4. N. Zhu et al., A Novel Coronavirus from Patients with Pneumonia in China, 2019. The New England journal of medicine 382, 727-733 (2020). 5. F. Wu et al., A new coronavirus associated with human respiratory disease in China. Nature, (2020). 6. D. Wang et al., Clinical Characteristics of 138 Hospitalized Patients With 2019 Novel Coronavirus-Infected Pneumonia in Wuhan, China. Jama, (2020). 7. Q. Li et al., Early Transmission Dynamics in Wuhan, China, of Novel Coronavirus-Infected Pneumonia. (2020). 8. M. L. Holshue et al., First Case of 2019 Novel Coronavirus in the United States. The New England journal of medicine, (2020). 9. W. J. Guan et al., Clinical Characteristics of Coronavirus Disease 2019 in China. The New England journal of medicine, (2020). 10. J. F. Chan et al., A familial cluster of pneumonia associated with the 2019 novel coronavirus indicating person-to-person transmission: a study of a family cluster. Lancet (London, England) 395, 514-523 (2020). 11. A. L. Phelan, R. Katz, L. O. Gostin, The Novel Coronavirus Originating in Wuhan, China: Challenges for Global Health Governance. Jama, (2020). 12. N. Chen et al., Epidemiological and clinical characteristics of 99 cases of 2019 novel coronavirus pneumonia in Wuhan, China: a descriptive study. Lancet (London, England) 395, 507-513 (2020). 13. C. Huang et al., Clinical features of patients infected with 2019 novel coronavirus in Wuhan, China. Lancet (London, England) 395, 497-506 (2020). 14. R. J. M. Bashford-Rogers et al., Analysis of the B cell receptor repertoire in six immune-mediated diseases. Nature 574, 122-126 (2019). 15. J. E. Park et al., A cell atlas of human thymic development defines T cell repertoire formation. Science 367, (2020). 16. C. Soto et al., High frequency of shared clonotypes in human B cell receptor repertoires. Nature 566, 398-402 (2019). 17. J. Glanville et al., Identifying specificity groups in the T cell receptor repertoire. Nature 547, 94-98 (2017). 18. M. J. T. Stubbington, O. Rozenblatt-Rosen, A. Regev, S. A. Teichmann, Single-cell transcriptomics to explore the immune system in health and disease. Science 358, 58-63 (2017). 19. C. Lupfer, T. D. Kanneganti, The expanding role of NLRs in antiviral immunity. Immunological reviews 255, 13-24 (2013). 20. L. Unterholzner, The interferon response to intracellular DNA: why so many receptors? Immunobiology 218, 1312-1321 (2013). 21. B. Kroczynska, S. Mehrotra, A. D. Arslan, S. Kaur, L. C. Platanias, Regulation of interferon-dependent mRNA translation of target genes. Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research 34, 289-296 (2014). 22. K. C. Chiang et al., Interferon alpha-inducible protein 27 is an oncogene and highly expressed in cholangiocarcinoma patients with poor survival. Cancer management and research 11, 1893-1905 (2019). 23. A. L. Brass et al., The IFITM proteins mediate cellular resistance to influenza A H1N1 virus, West Nile virus, and dengue virus. Cell 139, 1243-1254 (2009). 24. A. R. Everitt et al., IFITM3 restricts the morbidity and mortality associated with influenza. Nature 484, 519-523 (2012). 25. T. Y. Lin et al., Amphotericin B increases influenza A virus infection by preventing IFITM3-mediated restriction. Cell Rep 5, 895-908 (2013). 26. Y. Cao et al., Differential responses of innate immunity triggered by different subtypes of influenza a viruses in human and avian hosts. BMC Med Genomics 10, 70 (2017). 27. Y. Zhang et al., MKP-1 is necessary for T cell activation and function. J Biol Chem 284, 30815-30824 (2009). 28. J. T. O'Neal et al., West Nile Virus-Inclusive Single-Cell RNA Sequencing Reveals Heterogeneity in the Type I Interferon Response within Single Cells. J Virol 93, (2019). 29. J. T. O'Neal et al., West Nile Virus-Inclusive Single-Cell RNA Sequencing Reveals Heterogeneity in the Type I Interferon Response within Single Cells. 93, (2019). 30. B. M. Tang et al., A novel immune biomarker IFI27 discriminates between influenza and bacteria in patients with suspected respiratory infection. Eur Respir J 49, (2017). 31. R. Tiwari, J. C. de la Torre, D. B. McGavern, D. Nayak, Beyond Tethering the Viral Particles: Immunomodulatory Functions of Tetherin (BST-2). DNA Cell Biol 38, 1170-1177 (2019). 32. X. Yang et al., Clinical course and outcomes of critically ill patients with SARS-CoV-2 pneumonia in Wuhan, China: a single-centered, retrospective, observational study. Lancet Respir Med, (2020). 33. M. Rodriguez, K. D. Pavelko, M. K. Njenga, W. C. Logan, P. J. Wettstein, The balance between persistent virus infection and immune cells determines demyelination. J Immunol 157, 5699-5709 (1996). 34. S. Tomaselli, F. Galeano, F. Locatelli, A. Gallo, ADARs and the Balance Game between Virus Infection and Innate Immune Cell Response. Curr Issues Mol Biol 17, 37-51 (2015). 35. J. Liu et al., The role of porcine reproductive and respiratory syndrome virus infection in immune phenotype and Th1/Th2 balance of dendritic cells. Dev Comp Immunol 65, 245-252 (2016).