Prozomix Limited, Station Court, Haltwhistle, Northumberland, NE49 9HN, UK. Tel: +44 (0) 1434 400455 Fax: +44 (0) 1434 322822 [email protected] [email protected] www.prozomix.com [full product listing at www.prozomix.com/products/listing]
Recombinant Enzyme Product Specification Sheet
Cat. No.: PRO-E0019
LOT: 2008-0019
Activity: Licheninase and cellulase
Synonyms: Lichenase; β-(1→4)-D-glucan 4-glucanohydrolase; 1,3;1,4-β-glucan endohydrolase; 1,3;1,4-β-glucan 4-glucanohydrolase; 1,3-1,4-β-D- glucan 4-glucanohydrolase; (1→3)-(1→4)-β-D-glucan 4- glucanohydrolase; beta-(1→4)-D-glucan 4-glucanohydrolase; 1,3;1,4-beta-glucan endohydrolase; 1,3;1,4-beta-glucan 4- glucanohydrolase; 1,3-1,4-beta-D-glucan 4-glucanohydrolase; (1→3)-(1→4)-beta-D-glucan 4-glucanohydrolase, and, endo-1,4-β-D- glucanase; β-1,4-glucanase; β-1,4-endoglucan hydrolase; celluase A; cellulosin AP; endoglucanase D; alkali cellulase; cellulase A 3; celludextrinase; 9.5 cellulase; avicelase; pancellase SS; 1,4- (1,3;1,4)-β-D-glucan 4-glucanohydrolase; 4-(1,3;1,4)-β-D-glucan 4- glucanohydrolase; endo-1,4-beta-D-glucanase; beta-1,4-glucanase; beta-1,4-endoglucan hydrolase; 1,4-(1,3;1,4)-beta-D-glucan 4- glucanohydrolase; 4-(1,3;1,4)-beta-D-glucan 4-glucanohydrolase, respectively
Nomenclature: CAZy [GH5 and GH26, glycoside hydrolase families 5 and 26, both members of clan GH-A], CtGH26-GH5-CBM11 has an N-terminal GH26 licheninase catalytic module, followed by GH5 cellulase catalytic module, and a C-terminal family 11 carbohydrate binding module specific for mixed linked β-1,3-1,4-glucans
Source organism: Clostridium thermocellum NCIB 10682
Enzyme Commission No.: 3.2.1.73 and 3.2.1.4, respectively
Activity: 480 U/mL (60oC; pH 7; barley β-glucan) Specific activity: 800 U/mg
Purity: > 80 % as judged by SDS-PAGE
Form and storage: Supplied in 3.2 M ammonium sulphate, store at 4oC (shipped at room temperature) pH optimum: -
Temperature optimum: 60oC (stable up to 65oC)
[Protein]: 0.6 mg/mL
Sequence length: 800 amino acids (view sequence)
Accession No.: AAA23225
Molecular weight: 91415.0 Da (theoretical) Prozomix Limited, Station Court, Haltwhistle, Northumberland, NE49 9HN, UK. Tel: +44 (0) 1434 400455 Fax: +44 (0) 1434 322822 [email protected] [email protected] www.prozomix.com [full product listing at www.prozomix.com/products/listing]
~ 90200 Da (observed by SDS-PAGE)
- (observed by mass spectrometry)
Biological function: The licheninase catalytic module hydrolyses (1→4)-β-D-glucosidic linkages in β-D-glucans containing (1→3)- and (1→4)-bonds. It acts on lichenin and cereal β-D-glucans, but not on β-D-glucans containing only 1,3- or 1,4-bonds. The cellulase catalytic module endohydrolyses (1→4)-β-D-glucosidic linkages in cellulose, lichenin and cereal β-D-glucans. The C-terminal family 11 CBM is specific for mixed linked β-1,3-1,4-glucans
Potential application(s): Biomass conversion, carbohydrate research
Comments: CtGH26-GH5-CBM11 contains an N-terminal GH26 licheninase catalytic module, followed by a GH5 cellulase catalytic module and a C-terminal family 11 CBM specific for mixed linked β-1,3-1,4-glucans
Usage: Agitate bottle sufficiently to fully homogenise enzyme precipitate before use
Assay: One unit is defined as the amount of enzyme required to release 1 μmol of glucose-reducing-sugar equivalents per minute from barley β-glucan in 50 mM phosphate buffer, pH 7.0, at 60°C, where reducing sugars are measured by the method of Miller (1959; Anal. Chem. 31, 426-428)
Primary sequence:
MLKIGAWVGTQPSESAIKSFQELQGRKLDIVHQFINWSTDFSWVRPYADAVYNNGSILMITWEPWEYNTVD IKNGKADAYITRMAQDMKAYGKEIWLRPLHEANGDWYPWAIGYSSRVNTNETYIAAFRHIVDIFRANGATN VKWVFNVNCDNVGNGTSYLGHYPGDNYVDYTSIDGYNWGTTQSWGSQWQSFDQVFSRAYQALASINKPIII AEFASAEIGGNKARWITEAYNSIRTSYNKVIAAVWFHENKETDWRINSSPEALAAYREAIGAGSSNPTPTP TWTSTPPSSSPKAVDPFEMVRKMGMGTNLGNTLEAPYEGSWSKSAMEYYFDDFKAAGYKNVRIPVRWDNHT MRTYPYTIDKAFLDRVEQVVDWSLSRGFVTIINSHHDDWIKEDYNGNIERFEKIWEQIAERFKNKSENLLF EIMNEPFGNITDEQIDDMNSRILKIIRKTNPTRIVIIGGGYWNSYNTLVNIKIPDDPYLIGTFHYYDPYEF THKWRGTWGTQEDMDTVVRVFDFVKSWSDRNNIPVYFGEFAVMAYADRTSRVKWYDFISDAALERGFACSV WDNGVFGSLDNDMAIYNRDTRTFDTEILNALFNPGTYPSYSPKPSPTPRPTKPPVTPAVGEKMLDDFEGVL NWGSYSGEGAKVSTKIVSGKTGNGMEVSYTGTTDGYWGTVYSLPDGDWSKWLKISFDIKSVDGSANEIRFM IAEKSINGVGDGEHWVYSITPDSSWKTIEIPFSSFRRRLDYQPPGQDMSGTLDLDNIDSIHFMYANNKSGK FVVDNIKLIGA
Literature: 1. Taylor et al. (2005) J. Biol. Chem. 280, 32761-32767