Anti-WFDC5 monoclonal antibody, clone 4F6 (CABT-BL5980) This product is for research use only and is not intended for diagnostic use.

PRODUCT INFORMATION

Antigen Description This encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC contain only one WFDC domain, and this encoded contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster.Mouse monoclonal antibody raised against a full- length recombinant WFDC5.

Immunogen WFDC5 (AAH39173, 1 aa ~ 124 aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Isotype IgG2a

Source/Host Mouse

Species Reactivity Human

Clone 4F6

Conjugate Unconjugated

Sequence Similarities MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCVEDSQCPLTRKCCY RACFRQCVPRVSVKLGSCPEDQLRCLSPMNHLCHKDSDCSGKKRCCHSACGRDCRDPARG*

Size 100 μg

Buffer In 1×PBS, pH 7.2

Preservative None

Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

BACKGROUND

Introduction This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]

Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. [provided by RefSeq, Jul 2008]

GENE INFORMATION

Entrez Gene ID 149708

Protein Refseq NP_663627

UniProt ID Q8TCV5

Chromosome Location 20q13.12

Function peptidase inhibitor activity; serine-type endopeptidase inhibitor activity

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]

Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved