Anti-WFDC5 monoclonal antibody, clone 4F6 (CABT-BL5980) This product is for research use only and is not intended for diagnostic use.
PRODUCT INFORMATION
Antigen Description This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster.Mouse monoclonal antibody raised against a full- length recombinant WFDC5.
Immunogen WFDC5 (AAH39173, 1 aa ~ 124 aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype IgG2a
Source/Host Mouse
Species Reactivity Human
Clone 4F6
Conjugate Unconjugated
Sequence Similarities MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCVEDSQCPLTRKCCY RACFRQCVPRVSVKLGSCPEDQLRCLSPMNHLCHKDSDCSGKKRCCHSACGRDCRDPARG*
Size 100 μg
Buffer In 1×PBS, pH 7.2
Preservative None
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
BACKGROUND
Introduction This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most
45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]
Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. [provided by RefSeq, Jul 2008]
GENE INFORMATION
Entrez Gene ID 149708
Protein Refseq NP_663627
UniProt ID Q8TCV5
Chromosome Location 20q13.12
Function peptidase inhibitor activity; serine-type endopeptidase inhibitor activity
45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]
Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved