TNFSF18 antibody - middle region (ARP46568_P050) Data Sheet

Product Number ARP46568_P050 Product Name TNFSF18 antibody - middle region (ARP46568_P050) Size 50ug Symbol TNFSF18 Alias Symbols AITRL; GITRL; MGC138237; TL6; hGITRL Nucleotide Accession# NM_005092 Size (# AA) 199 amino acids Molecular Weight 23kDa Product Format Lyophilized powder NCBI Gene Id 8995 Host Rabbit Clonality Polyclonal Official Gene Full Name Tumor necrosis factor (ligand) superfamily, member 18 Gene Family TNFSF This is a rabbit polyclonal antibody against TNFSF18. It was validated on Western Blot using a cell lysate as a Description positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: KLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQN Target Reference Zhou,Z., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (14), 5465-5470 TNFSF18 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells.The protein encoded by this gene is a cytokine that belongs to the tumor Description of Target necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-662 BC112032.1 1-662 663-748 AY358868.1 616-701 Partner CUX1, CUX1, GOLGA5, OCRL, RAB1A, OCRL, RAB1A Reconstitution and Add 50 ul of distilled water. Final anti-TNFSF18 antibody concentration is 1 mg/ml in PBS buffer with 2% Storage sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-TNFSF18 antibody is Catalog # AAP46568 (Previous Catalog # AAPP27419) Immunogen The immunogen for anti-TNFSF18 antibody: synthetic peptide directed towards the middle region of human TNFSF18 Swissprot Id A9IQG8 Protein Name Tumor necrosis factor ligand superfamily member 18 Protein Accession # NP_005083 Purification Affinity Purified Species Reactivity Human, Dog, Horse Application WB Predicted Homology Based on Immunogen Human: 100%; Dog: 77%; Horse: 77% Sequence

Human Placenta WB Suggested Anti-TNFSF18 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Placenta Image 1

______

This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.