Product datasheet Anti-TLN2 Antibody Catalog Number: PB1014
BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China
Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected]
Basic Information Product Name Anti-TLN2 Antibody Gene Name TLN2 Source Rabbit IgG Species Reactivity human,mouse,rat Tested Application WB,IHC-P Contents 500ug/ml antibody with PBS ,0.02% NaN3 , 1mg BSA and 50% glycerol. Immunogen A synthetic peptide corresponding to a sequence in the middle region of human Talin 2 (1787-1822aa NPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEV). Purification Immunogen affinity purified. Observed MW 271KD Dilution Ratios Western blot: 1:500-2000 Immunohistochemistry(Paraffin-embedded Section): 1:50-400 (Boiling the paraffin sections in 10mM citrate buffer,pH6.0,or PH8.0 EDTA repair liquid for 20 mins is required for the staining of formalin/paraffin sections.) Optimal working dilutions must be determined by end user.
Storage 12 months from date of receipt,-20℃ as supplied.6 months 2 to 8℃ after reconstitution. Avoid repeated freezing and thawing
Background Information Talin 2 is a protein in humans that is encoded by the TLN2 gene. It belongs to the talin protein family. This gene encodes a protein related to talin 1, a cytoskeletal protein that plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. Talin-2 is expressed at high levels in cardiac muscle and functions to provide linkages between the extracellular matrix and actin cytoskeleton at costamere structures to transduce force laterally.
Reference
Anti-TLN2 Antibody被引用在1文献中。
The role of talin2 in breast cancer tumorigenesis and metastasis | Li L, Li X, Qi L, Rychahou P, Jafari N, Huang C. PubMed:29290996 | Oncotarget. 2017 Nov 6;8(63):106876-106887. doi: 10.18632/oncotarget.22449. eCollection 2017 Dec 5.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC AND CLINICAL USE. 1 Product datasheet Anti-TLN2 Antibody Catalog Number: PB1014
BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China
Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected]
Selected Validation Data
Western blot analysis of Talin 2 was detected in Talin 2 expression in rat paraffin-embedded brain extract (lane 1), sections of mouse mouse cardiac muscle intestine tissues using extract (lane 2) and rabbit anti- Talin 2 SMMC7721 whole cell Antigen Affinity purified lysates (lane 3). Talin 2 at polyclonal antibody 271KD was detected (Catalog # PB1014) at 1 using rabbit anti-Talin 2 μg/mL. The Antigen Affinity purified immunohistochemical polyclonal antibody section was developed (Catalog # PB1014) at 0.5 using SABC method μg/mL. The blot was (Catalog # SA1022). developed using chemiluminescence (ECL) method (Catalog # EK1002).
Talin 2 was detected in Talin 2 was detected in paraffin-embedded paraffin-embedded sections of rat intestine sections of human tissues using rabbit anti- intestinal cancer tissues Talin 2 Antigen Affinity using rabbit anti- Talin 2 purified polyclonal Antigen Affinity purified antibody (Catalog # polyclonal antibody PB1014) at 1 μg/mL. The (Catalog # PB1014) at 1 immunohistochemical μg/mL. The section was developed immunohistochemical using SABC method section was developed (Catalog # SA1022). using SABC method (Catalog # SA1022).
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC AND CLINICAL USE. 2
Powered by TCPDF (www.tcpdf.org)