SEP15 (Human) Recombinant (SECIS), that is necessary for the recognition of UGA as (Q01) a Sec codon rather than as a stop signal. Studies in mouse suggest that this selenoprotein may have redox Catalog Number: H00009403-Q01 function and may be involved in the quality control of . This is localized on Regulation Status: For research use only (RUO) 1p31, a genetic locus commonly mutated or deleted in human cancers. Two alternatively spliced transcript Product Description: Human SEP15 partial ORF ( variants encoding distinct isoforms have been found for NP_004252, 97 a.a. - 165 a.a.) recombinant protein with this gene. [provided by RefSeq] GST-tag at N-terminal.

Sequence: KLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLL DDNGNIAEELSILKWNTDSVEEFLSEKLERI

Host: Wheat Germ (in vitro)

Theoretical MW (kDa): 33.33

Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information)

Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols

Preparation Method: in vitro wheat germ expression system

Purification: Glutathione Sepharose 4 Fast Flow

Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID: 9403

Gene Symbol: SEP15

Gene Alias: -

Gene Summary: This gene encodes a selenoprotein, which contains a (Sec) residue at its . The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein have a common stem-loop structure, the sec insertion sequence

Page 1/1

Powered by TCPDF (www.tcpdf.org)