Ndufaf8 (NM 001110242) Mouse Tagged ORF Clone – MG214227

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for MG214227

Ndufaf8 (NM_001110242) Mouse Tagged ORF Clone Product data:

Product Type: Expression Plasmids Product Name: Ndufaf8 (NM_001110242) Mouse Tagged ORF Clone Tag: TurboGFP Symbol: Ndufaf8 Synonyms: 1810043H04Rik Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >MG214227 representing NM_001110242 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC

ATGTCTGTGAACGGAGCGGTGTGGGGGCGTGTGCGGAGCCGTTTCCGAGCCTTCCCCGAGCATCTGGCGG CCTGTGGAGCTGAGGCCTCGGCTTATGGCAAGTGCGTGCAGGCGTCCACCGCCCCAGGAGGCCGCCTGAG TAAGGACCTCTGCGTTCGCGAGTTCGAGGCCCTGCGGAGCTGCTTCGCCGCCGCGGCCAAGAAGACCATG ATGGGAGGCTCC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA Protein Sequence: >MG214227 representing NM_001110242 Red=Cloning site Green=Tags(s)

MSVNGAVWGRVRSRFRAFPEHLAACGAEASAYGKCVQASTAPGGRLSKDLCVREFEALRSCFAAAAKKTM MGGS

TRTRPLE - GFP Tag - V Restriction Sites: SgfI-MluI

This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Ndufaf8 (NM_001110242) Mouse Tagged ORF Clone – MG214227

Cloning Scheme:

Plasmid Map:

ACCN: NM_001110242 ORF Size: 222 bp

This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 Ndufaf8 (NM_001110242) Mouse Tagged ORF Clone – MG214227

OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_001110242.1, NP_001103712.1 RefSeq Size: 494 bp RefSeq ORF: 225 bp Locus ID: 208501 UniProt ID: A2AMZ4 Gene Summary: Involved in the assembly of mitochondrial NADH:ubiquinone oxidoreductase complex (complex I, MT-ND1). Required to stabilize NDUFAF5.[UniProtKB/Swiss-Prot Function]