%' 3XT X] 1PVWSPS at Axbp[B

M V ;0BC20;;.AdXVah[^\]iidhVkZÈi]Z]djhZi]ViWZZgWj^aiÉq?PVT!(

You Can Dance Like the Stars!

25% OFF

• Alex/Landmark • Tysons Corner • Bethesda • Gaithersburg • Silver Spring wwww.arthurmurraydc.com ww.arthurmurraydc.com 1-800-503-6769 1-800-503-6769

: IN;EB<:MBHG H? u PPP'P:LABG@MHGIHLM'QIK>LL u F:K

#!2/,9.+!34/2!0 kîkblZeZmmZ\dl' ma^fZbgerLnggb\bmrh_LZfZkkZ%2.fbe^l Z\khp]^]_beebg`lmZmbhgbg 2EVELERSENJOYEDABREAKFROM+ATRINAWOES Ma^lnk`^h_obhe^g\^]^î^g^]ma^mkZn& ghkmah_;Zà]Z]' ^Zlm;Zà]Z]'Ma^[hf[^kdbee^]+,i^hie^ fZh_k^lb]^gmlZek^Z]rlaZd^g[r_^Zklma^ Bg\hg`k^llbhgZem^lmbfhgr%GZmbhgZe Zg]phng]^].*%e^Zobg`[âbg]ma^\aZkk^] 4Pbh4]^dVW)CZlDgaZVch \hngmkrpZlm^^m^kbg`hgma^[kbgdh_l^\& Bgmêeb`^g\^=bk^\mhkChagG^`khihgm^lZb]Z Zg]mpblm^]k^fZbglh_pa^ê^]\Zkml\nl& gZk^kZhîhBVgY^Zlm%ibmmbg`ma^k^`bhgÍl mhma^lmZmbhg'BC4E4=A7DABC0? AXVWcc^5XVWc)=^\]Xdjgi D@hVWdgi^dcXa^c^XegdiZhihq# Bh\_PcWTcXR2^dac6aTTcb0]]P=XR^[T 1d[[XTS?d[_Xc) HiZgcXaV^bh87H aVlhjîVbdjcih idÈkZcYZiiVÉq

4=C4AC08=<4=C

AP_½bBcâh) ;fUbXaUghYf :Ùg\VcYdi]" ZghYdcViZi]Z^g YZigîjhidi]Z Hbî]hdc^Vc#6ahd! igjZiVWad^Y iVaZh06g\Zci^" cVÉhB^gVcYV# -- (!" 7).-#.!-%%'%449)-!'%3

F83>F½BF0;:)%X 0LAYBOY0LAYMATE!NNA.ICOLE3MITHPUSHESASIDEPHOTOGRAPHERSASSHEENTERSTHE3UPREME#OURTON4UESDAY*USTICESAPPEARED READYTOSIDEWITH3MITHINHER YEARBATTLEFORAPIECEOFHERLATEHUSBANDSOILFORTUNE5P\X[hUTdS)B\XcWUPRTb^UUfXcWWTa[PcTWdbQP]S½bb^]k?PVT# FTPcWTa--?Pac[hBd]]h

27>A420BC>=?064"" \^]cW^[SS^VXbVaPcTUd[UâcWT_aTbT]cP]SÛcT]bW^fbXUÛU ZXS]P__TSUâcWTc^^cW4G?A4BB4hT>_T]Tabk?PVT! !k4G?A4BBk " ! %kF43=4B30H ThTDeZcZgh

B>;DC8>=B :XSbBW^d[S]½c1dh C^X[Tc?P_Ta4XcWTa 0OLICEIN0ICTON !USTRALIA HAVE ASKEDSUPERMARKETSANDGROCERS TOSTOPSELLINGEGGSTOCHILDREN PARTOFANEFFORTTOCUTINCIDENTSOF VANDALISM THE$AILY4ELEGRAPHREPORT 01BCA02C0AC ED3OMEMANAGERSOFSTORESSAYTHEY UNDERSTANDTHEINTENT BUTDONTWANTTOPREVENTPARENTSFROMBEINGABLETOSEND <^]P;XbP½bB\X[X]V THEIRCHILDRENTOTHESTOREFORTHEMh4HEREISAPROBLEMINTOWN DEFINITELY7E 0c6aTPc

"/"#(),$!0 LION)THASTOREMOVEASTAINLEFTBYA WADOFGUMSTUCKONTHEPAINTING&RIDAY ;>A3F0A4 38B28?;8=4 WOULDTAKEEXTRALESSONS THEPARENTS BYAVISITOR-USEUMOFFICIALSSAIDA WOULDBELECTUREDFORTWOHOURSONPAR BOYTOOKTHEGUMOUTOFHISMOUTHAND FaXcT¼8½[[1TP1TccTa ENTINGTECHNIQUES4HEBILLSTATESTHAT STUCKITON(ELEN&RANKENTHALERS ?PaT]c½$ CX\Tb TEACHERSWOULDHAVETHELEGALRIGHTTO 7^[hBWTTc ABSTRACTPAINTINGh4HE"AYv4HEGUM %DUCATIONLEGISLATIONINTHE5NITED DETAINSTUDENTSONANYDAYTHEYCHOOSE CWT1XQ[TbPhb2WaXbcfX[[R^\TPVPX]c^YdSVTcWT[XeX]VP]ScWTSTPS LEFTASTAINTHESIZEOFAQUARTER-USEUM +INGDOMWOULDALLOWSCHOOLSTO REGARDLESSOFWHETHERTHEPARENTSAGREE CW^\Pb7P[ThUXVdaTbWT\PhQTbcPacX]VfXcW7PaSh½b7PaSfPaTbW^_ EXPERTSARERESEARCHINGTHECHEMICALS SENDPARENTSOFDISOBEDIENTSTUDENTS ORNOT ANDALSO LEGALLY BEALLOWEDTO _TabX]

TUTORS TUTORS NEEDEDNEEDED FORFOR Do You Continue to AT-RISK AT-RISK CHILDRENCHILDREN Be Depressed? Change a life forever by teaching a child reading and math skills. Volunteer tutors needed for FLOC’S The NIMH is conducting a study to test the effectiveness of Neighborhood Tutoring Program. Training is AMPAkine in major depression. This study examines a different provided for this one-on-one, highly structured, mechanism of action from commonly used antidepressants. Our successful reading and math tutorial program. hope is to find new medications for individuals who have not Interested go to www.floc.org or contact us at 202-349-3512 or [email protected] . responded to past treatment. This is a 10-week outpatient and inpatient study of medication or Have you had severe mood swings and now feel placebo conducted at the NIH Clinical Center in Bethesda, Maryland. Participants must: • Be ages 21-55 • Be currently depressed DEPRESSED? • Have taken an antidepressant that did not help •Do you have highs and lows? •Feeling down or like crying? •Have difficulty making decisions? The study includes medical and psychiatric evaluations, and •Feel hopeless or worthless? research medication at no cost. Transportation reimbursement •Can’t sleep or sleeping too much? provided. •Have low energy or appetite changes? Atendemos pacientes de habla hispana. •Can’t concentrate? •Don’t enjoy things the way you used to? Call: 301-496-5645 (TTY: 1-866-411-1010) If you are experiencing some of these symptoms, http://patientinfo.nimh.nih.gov you may be suffering from or for other studies: www.clinicaltrials.gov Manic-Depression (Bipolar Disorder). If you are between 18 and 65 years of age, have been The National Institute of Mental Health feeling this way for at least 2 weeks, you may qualify to participate in a medication treatment research study. National Institutes of Health, Department of Health & Human Services For Information Call (202) 994-CARE Advance you. www.GWcare.org “Careers” can move you up and ahead. Mondays. The George Washington University is an Equal Opportunity/Affirmative Action Institution. X017a 3x1 F43=4B30Hk " ! %k4G?A4BBk"

ÆI]Z8dc\gZhhlVhhiVbeZYZY!VcYi]ZkVajZhd[[gZZYdb!_jhi^XZ VcYZfjVa^ingZXZ^kZYVigVbea^c\^ci]Z]ZVYadc\gjh]#Ç =PcX^] BT]A^QTac1haS SAYINGHEREGRETSVOTINGTOAPPROVETHE53!0ATRIOT!CTIN

Bg;kb^_ ATeT[TabATeXeTA: ;PfhTa)DBBTcc[TbFXcW IZkZ]^llgZd^makhnà `rimbZgfZg pahln^]Z_m^ka^pZl]^mZbg^]_hk =4F>A;40=BkMa^\khp]lp^k^ g^ZkerZr^Zk_heehpbg`ma^Lîm'** lfZeeZg]ma^\hlmnf^lpb\d^]& ZmmZ\dl%ableZpr^klZb]'Ma^l^mme^& erlZmbkb\ZeZlFZk]b@kZl[nbem f^gmpZl_be^]Fhg]Zrbg_^]^kZe mhpZk]bmlkhp]r\ebfZqMn^l]Zr \hnkmbg;khhderg%lZb]Zmmhkg^r bgmablankkb\Zg^&[n\de^]\bmrmaZm AZ^rhng`Rhhg%pahkîk^l^gml \hne]nl^Z_^peZnàl' >aZ[>efZàkZ[r'La^lZb]la^ Ma^\nefbgZmbhgh_ma^^bàm& [êbô^]bmpZlma^_bklml^mme^f^gm ]Zrik^&E^gm^g[Zla_êeg^Zkerlbq bgoheobg`\eZbfl_khfi^hie^ fhgmalmhma^]ZrZ_m^kma^:n`'+2 ]^mZbg^]Z_m^kLîm'**'0? lmhkfmaZmlfZla^]mahnlZg]lh_ ahf^lZg]dbee^]fhk^maZg*%,)) F0B78=6C>= i^hie^%maôZlmfZchkbmrh_ma^fbg 5300__aêTb?PcRWUâ G^pHke^Zgl' 0Sd[cbFXcW3T_aTbbX^] >o^gZfb]ma^mrib\Ze]^[Zn\a&

Ma^N'L'?hh]Zg]=kn` ^krÉbg\en]bg`^Zkerfhkgbg` !,%8"2!.$/.!0 :]fbgblmkZmbhgZiikho^]Zg^p ]kbgdbg`%_eZla^lh_[Zk^[k^Zlml ID;DBA834>=)-EMBERSOF:ULU+REWERIDETHEIR-ARDI'RASFLOATSDOWN#ANAL3TREETPASTREVELERSINDOWNTOWN.EW ]êbo^krlrlm^f_hkZ]kn`mhmk^Zm Zg]ldbfir\hlmnf^lbgma^?k^g\a /RLEANSON4UESDAY4ENMEMBERSOFTHE:ULUCLUBWEREKILLEDWHEN(URRICANE+ATRINADEVASTATEDTHEAREAINLATE!UGUST ]îk^llbhgbgZ]neml'Ma^Z`^g\r JnZkm^kÉma^k^pZlgh^l\Zibg` Ziikho^]ZiZm\a[rG^pRhkd& k^fbg]^klh_ma^lmhkf' \ho^k^]1)i^k\^gmh_ma^\bmr' ohrbgmhma^\bmr' Hke^ZgbZglZ_k^laeho^_hkma^bk\bmr'Ë [Zl^];kblmhe&Fr^klLjnb[[BC4A0? Zg]Lhf^kl^mIaZkfZ\^nmb\Zel \en[%hkdk^p^%maZmehlm*)f^f[^kl [eZ\d[^k^mZg]\Zfhn_eZ`^ngb& dghpahpmh]^l\kb[^bmÉ`k^Zm%Ë Bg\'%ma^\hfiZgb^lZgghng\^] mhDZmkbgZ%iZkZ]^]Zfb]ahf^l _hkf%ihkmkZr^]\b`Zk&\ahfibg` GZ`bglZb]h_maîZkmr'ÊDZmkbgZ ACB8=0BC>A< D^rl' Fhk^ng]^k`khng]^qiehlbhgl 9dSVTAd[TbUâ N'L'=blmkb\mCn]`^?^]^kb\h aZo^kh\d^]:eZ[ZfZÍleZk`^lm Fhk^ghhk]^k^]ma^_^]^kZe`ho& \hZefbg^lbg\^Z[eZlmeZlmp^^d ÊB_ma^bgo^lmb`Zmbhgikho^lmh[^Z 3T_âcTS2dQP]b ^kgf^gmmhfZd^bml[^lm^__hkmmh _hk\^]ma^ôZ\nZmbhgh_l\hk^lh_ \aZkZ]^'''ma^gma^[biZkmblZge^`bleZmbhg <80<8k:_^]^kZecn]`^kne^] aêima^bffb`kZgmlk^mnkgmhma^ phkd^kl'GhhgâZl[^^gankmbg Mn^l]ZrmaZmma^N'L'`ho^kg& Ngbm^]LmZm^l'Ng]^kma^_^]^kZe Zgrh_ma^[eZlml%Zg]ma^`ho^kg& maZmp^bgmkh]n\^]r^lm^k]ZrpbeeiZll''' f^gmZ\m^]ngk^ZlhgZ[erpa^gbm `ho^kgf^gmÍlehg`&lmZg]bg`Êp^m& f^gmlZb]ma^lô^kbmrh_ma^^qieh& ebd^Zahmdgb_^makhnà[nmm^k'Ë l^gmahf^*.=;0F<0:4AB½544;8=6B01>DC0=8=E4BC860C8>=8=C>03D108 LmZm^lpa^gma^bk[hZmk^Z\a^]Zg mhlmZr%pabe^mahl^lmhii^]Zml^Z mh^gm^k'0? 10B4358A<C70C2>D;30BBD<4>?4A0C8>=B>5B8GDB?>ACB Z[Zg]hg^][kb]`^bgma^?ehkb]Z Zk^l^gm[Z\d'0?

Does your home have s ick hous e s yndr ome? Dus t mites , molds and even holiday foods can caus e allergies . Flu-like s ymptoms , s inus infections even fatigue may be theresult. Our Physicians havethelatest medicines, testingandtreatment programs to help you feel better quickly, safely and easily all without those "painful" scratchtests.

Please accept our invitation to visit us and to make an appointment today.

Please call for an appointment T: 800.287.2829 MyAllergyCare.com

We participate with most health-plans

Offices conveniently located in: Ballston • White Flint • Chantilly • North Potomac • Vienna • Wheaton Plaza • Gaithersburg • Springfield • Sterling Introducing The Latest Now that there’s Technology In Comprehensive a choice, Dental & Orthodontic Care which +, would you •Implants All In One Facility "- •Emergency Care choose? 2 blocks away from •Dental Check-Ups Farragut North and Straight Teeth. No Braces. ) •Crowns & Bridges Farragut West Metro PREMIERE INVISALIGN PROVIDER •Root Canal Therapy Free Orthodontic (top 5% Nationwide 2005) •Oral Surgery Consultation Free Implant K Street Dental & •Periodontics Consultation Orthodontic Group •Cosmetic Dentistry Dr. A. Shouhayib & Associates •Orthodontics K Street Dental 308 Main Street •Digital Computerized X-Rays 1990 K Street NW, Suite 15-A Gaithersburg, MD 20878 •Intra-Oral Camera/Video Imaging Washington, DC 20006 Beside Whole Foods •Air Abrasion (No More Needles) 202.775.0167 301.977.9787 •EVENING HOURS BY APPOINTMENT www.kstreetdental.com

$ * % + Got Belly Fat? & , Find Out How Body ' ( ) ( Shapes Relate To Hormones And How Your -../ HormonesRelatetoFat % 0 Burning (Losing Weight) 1 ( % Most people think they need to lose weight to be healthy. This is NOT % 23 ( TRUE. You need to first get healthy 4 5 6 7 ( before you can lose weight and burn fat. Attend this FREE SEMINAR to learn the FOUR body ! " % shapes. Learn what it takes to burn ' # ( & away fat around the belly, hips and # ) thighs. Learn about the influence of food & exercise over fat-burning hormones. Learn how to trigger the 6 FAT BURNING HORMONES. "# $ Find out how hormones affect WHAT you crave (chocolate, $ % &' & sweets, carbs, salty foods). Limited Seating! Call for () ) location, and date. REGISTER Speaker: Dr. Eric Berg D.C. ) , < FREE SEMINAR 703-354-7336 #% ( 0 % 3 ( Enlarged Prostate? * + = . 4 "#$ %&&'() 0 ! ( # 7 ! 5 6 ( 7

• Urgent/frequent urination, especially during the night • Interrupted stream/flow • Feeling that your bladder does not completely empty 9 # ( 1 ( 89 ( ( 9 • Feeling that you need to strain If you have been experiencing these symptoms for the past 3 months, we have a research study for you. Our local physicians are studying an investigational # ( medication for the treatment of enlarged prostate, also known as BPH. This ( ;- : investigational medication may reduce the size of the prostate and therefore 3 1 ) & ( lessen the bothersome symptoms of BPH. ( Men, you may qualify if you: 8 8 4 • are age 40-80 (Those 40-65 must have had a vasectomy.) # & % , Qualified participants will receive all study-related care and study medication. # * To learn more, please call: -- & ) (301) 441-4402 , 9 ''( , . % Drs. Werner, Murdock & Francis, PA, Urology Associates # 7500 Hanover Parkway, Suite 203 • Greenbelt, MD 20770 ( # : The First Step Is Your Call™ WEDNESDAY 3.1.2006 EXPRESS 5 th five-day MARCH 1, 2006 MARCH 1, . Free shuttle available For tickets and more MetroOpensDoors.com Foggy Bottom-GWU station on the rail: Orange/Blue Lines. between station and Kennedy Center. Metrobus: 80. information, call 1-800-444-1324 or visit New York City Ballet Opera House The Kennedy Center March 1–3, 7:30 p.m. March 4-5, 1:30 and 7:30 p.m. Tickets: $29-$99 one of See the legendary New York City Ballet, ballet the largest and most prestigious classical companies in the world, at a engagement at the Kennedy Center. Opera Performing with the Kennedy Center House Orchestra, the company will dance several mixed programs that reflect the ensemble’s musical inspirations and celebrated history. Co-founded by one of the 20 century’s foremost choreographers, George has been Balanchine, the New York City Ballet dance praised for its influence on international dancers. and its impressive new generation of Metro kennedy-center.org TTY 202-638-3780 Judiciary Square stations. used to display advertising in the tunnel between Metro Center and over the next three weeks while Metro installs equipment that will be Some late-night Red Line riders may experience 10 to 15-minute delays Red Line trains will share one track between Farragut North and INFORMATION ANYTIME 202-637-7000 Judiciary Square stations from 10 p.m. to closing, Sundays through Fridays for the next three weeks. Trains will also share one track from 8 p.m. to closing for the next three weeks. Trains will also share one track from 8 p.m. to Courtesy of the Baltimore Symphony Orchestra First-Ever Tunnel Ads Late-Night Red Line Trains to Share Track During Installation of Late-Night Red Line Trains to Share Track During Installation and March 3-4 and March 22-23. These are estimated start times and could change. Please visit March 3-4 and March 22-23. These are estimated start times and could Line during these MetroOpensDoors.com to confirm start times. Riders traveling on the Red periods should add at least 10 to 15 minutes of travel time in their schedule. Still images The new tunnel advertising will simulate a 15- and 30-second video commercial. and you will see the mounted on the tunnel wall will appear to move as the train passes by, images through the train windows. announced two years The tunnel advertising program is just one of a series of initiatives Metro tunnel ad will generate ago as a way to generate additional revenue through advertising. Each service a minimum of $200,000 per year, which will be used to help fund customer early April. improvements. Metro expects to have the initial equipment in place by . The Ugly Duckling . BSOatStrathmore.org For tickets and more information, call 1-877- For tickets and more information, call 10 a.m. - 4 p.m. Washington, DC development site. Saturday, March 4 at 202-962-2677 or RSVP to Scott Kubly [email protected] More information at Attend an upcoming community planning Grosvenor-Strathmore station on the Red Line. Grosvenor-Strathmore station on the Metrorail station joint . session for the Takoma Takoma Residents MetroOpensDoors.com. 7005 Piney Branch Road Trinity Episcopal Church rail: KEEPING IN TOUCH WITH OUR CUSTOMERS IN TOUCH WITH KEEPING Cinderella Metro Metrobus: J5. BSO-1444 or visit The Washington Metropolitan area is home to some of the nation’s top arts centers, area is home to some of The Washington Metropolitan diverse concerts and high quality performing arts which feature world-renowned artists, Center are both Metro accessible and feature programs. The Strathmore and Kennedy standout performances this week. Baltimore Symphony Orchestra Music Center at Strathmore March 2, 8 p.m. Tickets: $21-$78 will present a The Baltimore Symphony Orchestra (BSO) Thursdays concert renowned young violinist at its Classical born in 1985 in tomorrow night. Sergey Khachatryan, “the kind of poet you Armenia, has been hailed by critics as will make his hope to find” and “sensational.” Khachatryan Maestro Yuri BSO debut with one of his great champions, Intrada, Sibelius’s Temirkanov. The program offers Hailstork’s Prokofiev lyrical violin concerto and a pairing of —interpretations of classic stories Area Arts Centers Present Classical Sights and Sounds Present Classical Sights Area Arts Centers www.bannercollege.edu %k4G?A4BBk " ! %kF43=4B30H

Iam... 06>>3A403)7HATSETSAPARTSTUDENTSWHOAREREADY FORCOLLEGEFROMTHERESTISANABILITYTOCOMPREHENDSOPHIS more confident. =PcX^] TICATEDTEXTS SAYSASTUDYFROMTHEMAKERSOFTHE!#4TEST more focused. more prepared. more experienced. more professional. more successful. more satisfied. IN CTaaâBdb_TRc3T]XTS1PX[ \aZg\^maZma^phne]_e^^ma^\hng& eZlmp^^dZehg`pbmaPZllbfB' THE HEALTHCARE FIELD FZgZkk^lm^]bgHabh mkr'AâZl_ZfberbgChk]ZgZg] FZsehnf%+-%Zg]FZk pZgHmafZg Offering These Career Programs: \aZk`^]pbmaiehmmbg` k^`neZkermkZoê^] >e&Abg]b%-,':eemak^êbo^]bg Call Now! ➤ Massage Therapy ho^kl^Zl%ikhl& Mhe^]hpbmabgmaêZlmr^Zk'Ma^r 1-877-600-8857 ➤ Medical Assistant Z`ZbglmN'L'fbebmZkr ^\nmhkllZb]' aZoîe^Z]^]ghm`nbemr' ➤ Medical Billing & Coding 2;4E4;0=3k:_^]^kZefZ`blmkZm^ :fZpbÍl Ma^`ho^kgf^gmZ\\nl^lma^f ➤ Surgical Technologist hk]^k^]ZfZgpbma]nZeN'L'& Zmmhkg^r%=^ggbl h_iehmmbg`mhdbeeN'L'lhe]b^klho^k& 2300 Wilson Boulevard, Suite 600 Chk]ZgbZg\bmbs^glabiaê]pbma& M^k^s%lZb]ma^k^ l^ZlZg]h_aZk[hkbg`hk\hg\^Ze& Arlington, VA 22201 hnm[ZbeMn^l]Zrhg\aZk`^la^ pZlghmak^Zm bg`m^kkhkblml' iehmm^]pbmamph\h&]^_^g]Zgml maZmabl\eb^gm !MAWI :gbg]b\mf^gmlZrlma^rmkZo& Financial Aid for Those Who Qualify Graduate Placement Assistance • Approved for VA Benefits mhpZ`^ZmmZ\dlZ`Zbglm:f^kb\Zg phne]_e^^Zg] ê^]mh`^ma^kmhZlahhmbg`kZg`^mh Zg]Zeeb^]mkhhil' maZm:fZpbÍl_Zfberebobg`bg ikZ\mb\^Zg]lmn]b^]ma^fZdbg`h_ Ikhl^\nmhklZk`n^]maZm Mhe^]haZ]Z`k^^]mhlaZk^ma^bk ^qiehlbo^l'BmZee^`^lmaZmZme^Zlmhg^ FhaZffZ]SZdb:fZpblahne] ahf^pbmaabf' h_ma^f^gk^l^Zk\a^]Zg]mkb^]mh ghm[^kê^Zl^][^\Znl^h_ma^kbld :fZpb%pahpZlZkk^lm^]bg h[mZbg`ho^kgf^gm`kZgmlZg]ikb& DoDDoo nn’t ’’tt BreBBrree aa tth he e FiFFii ll th!tthh!! h_aZkfmhma^\hffngbmrhkma^ :ffZg%Chk]Zg%pZl\aZk`^] oZm^_ng]bg`_hkma^mkZbgbg`'0? Only $264 Buys 2^]]TRcXRdc>:b Clean Air For Your Home. ET]TidT[P]>X[ 1. 50% of all illnesses are either caused or aggravated by indoor 0b7TPcX]V5dT[ air pollution. 70AC5>A32>==k

mbhgÊ@h]Ílpbee'ËLmhk^lphgÍml^ee Lnik^f^A<4A?A4B834=C18;;2;8=C>= ihkgh`kZiab\fZ`Zsbg^l%iaZkfZ& labi]h^lghmZepZrlf^ZgZ[lhenm^ DA68=66>E4A=>ABC>102:455>ACBC> Adapt you. 270=64C742D;CDA4>5>E4A40C8=6 “Personal Tech” can give you cool and useful tools. Mondays. \b^lphgÍm\Zkkr\hg]hflhk[bkma ]hfbgbhg'Ë1A80=B:>;>550? X017e 2x.5 F43=4B30Hk " ! %k4G?A4BBk&

1>CC;4=42:),OCALMEDIAREPORTTHATTHRIFTY"ELGIANSARECAUSINGAHEADACHEFOR $UTCHSUPERMARKETSBYGATHERINGLARGENUMBERSOFPLASTIC#OCA #OLABOTTLESANDBRING INGTHEMTOTHE.ETHERLANDSWHERETHEBOTTLESEARNADEPOSITFORBEINGRETURNED F^a[S

Bg;kb^_ >aSTabBPXSc^CXTBPSSP\c^:X[[X]Vb 1D30?4BC7D=60AH ^q^\nm^][rfblmZd^%Zg]LZ]]Zf ?dcX]>_cX\XbcXR^]5dcdaT Ikhl^\nmhklh__^k Zee^`^]erhk]^k^]ma^f]^\eZk^] >U8aP]XP]=dR[TPa?a^_^bP[ ^q^\nmbhgeblmZee^`^]er ÊfZkmrklËmh\ho^knima^^kkhk' KnllbZÍlik^lb]^gmlZb]Mn^l]ZrmaZm lb`g^][rhnlm^]e^Z]^k LZ]]ZfZg]lô^ghma^kf^f& a^blhimbfblmb\maZmabl\hngmkrpbee [^klh_ma^_hkf^kk^`bf^Zk^hg lmkbd^ZgZ`k^^f^gmpbmaBkZgho^k 10673038A0@kIkhl^\nmhklik^& mkbZe_hkma^]^Zmalh_lhf^*-1 bml]blinm^]gn\e^Zkikh`kZf':g l^gm^]]h\nf^gmlMn^l]Zrma^rlZb] Labbm^lbgZ\kZ\d]hpgeZng\a^] BkZgbZg]ê^`Zmbhgbl^qi^\m^]mh lahpLZ]]ZfAnll^bgZiikho^] Z_m^kZ*21+Zmm^fimmhZllZllb& Zkkbo^bgFhl\hp ^q^\nmbhglh_fhk^maZg*-)Labbm^l gZm^ma^_hkf^kBkZjbe^Z]^kbgma^ hgP^]g^l]Zr_hk bgma^*21)l%ma^fhlm]bk^\môb& mhpgh_=ncZbe'Ma^r_Z\^]^Zma[r ]bl\nllbhglhgZ ]^g\^r^mZ`Zbglmma^_hkf^kBkZjb aZg`bg`b_\hgob\m^]' ikhihlZemh^gkb\a e^Z]^kbgabl_hnk&fhgmamkbZe' Mn^l]ZrÍll^llbhgpZlhg^h_ma^ nkZgbnf_hkBkZg :fhg`mahl^l^gm^g\^]mhaZg` fhlmhk]^kerlbg\^ma^mkbZe[^`Zg hgKnllbZgm^kkb& pZlZg**&r^Zk&he][hr' bgH\mh[^k'Ma^]^_^gl^m^Zf`Zo^ mhkrmh^glnk^ma^ Ma^fhlmlb`gb_b\Zgm]h\n& nihgZ[hr\hmmh_ma^mkb[ngZeZg] 0UTIN gn\e^Zk_nê\Zg& f^gm_^Zmnk^]Zlb`gZmnk^lZb]mh Zmm^g]^]ma^l^llbhg%mahnàma^ ghm[^]bo^km^] [^LZ]]ZfÍlhgZ\hnkmeblmh_i^hie^ \ab^_cn]`^k^c^\m^]ma^bk]^fZg] _hkZmhfb\[hf[l'ÊP^Zk^himb& mh[^^q^\nm^]%mahnàbmpZlghm maZma^lmî]hpg' fblml%ËOeZ]bfbkInmbglZb]'ÊBmÍl \e^Zka^pZlZpZk^h_ma^bkZ`^l' :elh%LZ]]ZfZg]lô^kZe jnbmîhllb[e^_hknlmhk^Z\aZg :[hnm.)h_mahl^l^gm^g\^] hma^k]^_^g]ZgmlaZo^^g]^]Z

Z`k^^f^gmhgma^^lmZ[eblaf^gm ]b^]]nkbg`bgm^kkh`Zmbhg[^_hk^ "/"342/.'!0 ang`^klmkbd^lmZkm^]?^['*+%mph h_Zchbgmo^gmnk^hgKnllbZgm^kkb& ma^r\hne]`hmhma^`Zeehpl'Hg^ 102:8=2>DAC)3ADDAM(USSEINSPEAKSTOTHEJUDGEATHISTRIALIN"AGHDADON ]Zrl[^_hk^ma^eZlmmkbZel^llbhg%Z mhkrmh^gkb\ankZgbnf_hkBkZgbZg fZg%abl[khma^kZg]mphlhglp^k^ 4UESDAY4HESESSIONWASONEOFTHEMOSTORDERLYSINCETHEPROCEEDINGSBEGAN ]^_^gl^eZpr^klZb]Lng]Zr'0? gn\e^Zk^g^k`rg^^]l'Ë0?

=4F34;78 Ma^\ZmpZl_hng]ho^kma^p^^d& nkhi^%Zll\b^gmblml\hg& m^kgh_]bl^Zl^mkZglfbllbhgl^^gbg ma^mhpgh_=Zk[aZ`n]ZbgknkZe Zlkbhmbg`bgfZm^lmkb^]mhinla _bkf^]fhk^g^p\Zl^lh_[bk]_en [b`\Zmlbg:lbZ%ma^bglmbmnm^lZb] 28CH pZbe^]%_^Zk_nemaZmeho^]hg^lbg Worry Worry 7^cT[CWPc:XRZTS>dc ma^_Z\bebmraZo^[^^gdbee^]bgma^ 2dQP]b

Zg`^k^]fZgrF^qb\Zglpa^g :me^Zlm_bo^bgfZm^laZo^[^^g 3(!(-!2!)!&0'%449)-!'%3 • Are you so agitated that you can’t enjoy your life? bmdb\d^]hnmZ

BC0AC8CD?)4HE2OLLING3TONESWILLPLAYTHEIRFIRSTCONCERTIN#HINAIN!PRIL #HINESE PROMOTERSSAID4UESDAY THREEYEARSAFTERCANCELINGAPAIROFSHOWSBECAUSEOFTHE 3!23OUTBREAK4HEBANDWILLPLAY3HANGHAIS'RAND3TAGE AN SEATVENUE F^a[S

;^RP[?^[[BcXab;Xcc[T7^_T 1A0I8;k20A=8E0;<0682 ma^\hngmkrÍl_bklmZee&kZ\^^e^\mbhgl IhhkLhnma:_kb\Zgl bg*22-ÉZ+/i^k\^gmbg\k^Zl^% lmbeeeZ\d[Zlb\l^kob\^l Z\\hk]bg`mhAhnlbg`Fbgblmkr_b`& nk^l'MablpZl]^libm^ma^`ho^kg& ]^libm^\ZfiZb`gohpl f^gmli^g]bg`g^Zker-'.[beebhgmh 20?4C>F=B>DC705A820k [nbe]Z[hnm*'1fbeebhgg^pahf^l GhfmangsbGZiaZdZ]^Ílfhh] bgcnlmng]^k*+r^Zkl' lpbm\a^l[^mp^^gZg`^k%laZf^ Ma^`ho^kgbg`:_kb\ZgGZmbhgZe Zg]k^lb`gZmbhgZlla^lnko^rlma^

laZ\dla^laZk^lpbmaa^kfhma& /"%$:),7!!0 ^krZg]Z\eZfi]hpghg\hkknim ^k%lblm^k%[khma^kZg]mphrhng` 4HENUMBEROF3OUTH!FRICANFAMILIES \hng\behklma^\^gmkZeê^\mbhgl \abe]k^g' LIVINGINSHACKSHASRISENPERCENT \ZfiZb`gma^f^'LhaZlma^hiih& Ma^khh_h_ma^mph&khhfmbg lbmbhg=^fh\kZmb\:eebZg\^%pab\a Zg]\Zk][hZk]lmkn\mnkê^Zdlbg ie^]`^lh_\Zg]b]Zm^lbgeh\Zeê^\& aZlkngobmkbheb\Z]l\kbmb\bsbg`ma^ ma^kZbgZg]bmlpZeellaZd^bgma^ mbhglP^]g^l]Zr' :G<Ílk^\hk]' pbg]'Ma^k^blghknggbg`pZm^k Bfikhobg`[Zlb\l^kob\^laZl FZgrmkZ]bmbhgZe:G<lniihkm& hkê^\mkb\bmr' [^\hf^Zd^r\ZfiZb`gblln^Zl ^klÉebd^;^ZnmrGZshÉlZrma^r GZiaZdZ]^lZrllaâZll^^g fbeebhglh_ihhkLhnma:_kb\Zgl Zk^mhh]blbeenlbhg^]mhohm^' !.$2%0%..%2!0 ebmme^bfikho^f^gmbg\hg]bmbhgl lmbeepZbm_hkma^[^mm^keb_îkhf& ÊP^Zk^lb\dZg]mbk^]%ËGZsh ?0ACH?;D<4)!DANCERPERFORMSONAFLOATIN2IODE*ANEIRODURINGTHE ]nkbg`ma^+.r^ZkllaâZlebo^] bl^]ZmZiZkma^b]Íl^g]' lZb]'ÊMa^rd^îhgikhfblbg` 3AMBAPARADEON4UESDAYTHECENTERPIECEOF"RAZILSCARNIVALCELEBRATION bg

swim fling take $ 10 off any swimsuit purchase

Reston Town Center 703.956.1586

Wildwood Center 301.850.1761

Market Common Clarendon 703.835.9396

Visit or shop with us online at www.southmoonunder.com 10 EXPRESS 3.1.2006 WEDNESDAY (8)407-8222 1(888) EIA ASSISTANT MEDICAL aaeetInstitute Management Intercultural The ou o uies dcto,adTann Professionals Training and Education, Business, for Forum A eoa ann e u a,adThiagi. and Wah, Mun Lee Tannen, Deborah including: speakers keynote field, outstanding the with in experts by led workshops 20 Over neclua Relations Intercultural in Directions New and Practices Best 7 TH NULCONFERENCE: ANNUAL

t n ati o t e o 3

Cn n o eknstoo! Weekends now and Classes Evening and Day iaca i fYuQualify IfYou Aid Financial o lcmn Assistance Placement Job aigCareer Caring a

e c: Lc nei

nos vn T Trainin7months! rgasadShdlsVr yCampus by Vary Schedules and Programs r a i n i n CM VA MD DC 7 m o n t h s ! eeo/aa Welcome Home! Twinbrook Friendship Rockville Heights www.highlandhouseapts.net www.yalevillage.net www.rollinspark.net • Large PetsWelcome* •Large THw/Variety •Large offloorplans 877-275-8938 877-512-0182 1&2BRApts.and 877-510-8879 ChevyChase 3BRTownhomes RentalTownhomes! Apts.Available Eff, 1BR,2 Eff, Available from Rents from Rentsfrom Rockville Rockville Rents from Rentsfrom Available 2,3,4BR $1225 $1220 $1630 F43=4B30Hk " ! %k4G?A4BBk

UNDERSTANDING OUR WORLD <^]Th THE CONTINUING IMPACT OF THE HOLOCAUST Legitimizing the Unthinkable: A Disability Rights Perspective BcTa]BdTS>eTa2^]caPRc on Nazi Medicine with Harriet McBryde Johnson <;L_be^llnbmZ`Zbglm author, advocate, attorney lah\dch\d%\bm^lnl^h_ THURSDAY, MARCH 9 • 7– 8:30 P.M.

Zbkmbf^mhmhnmLbkbnl Join us to explore the persisting prejudice that people with =4FH>A:k<;L

LbkbnlZg]Lm^kgÍlZ`^gmZl]^_^g& Free admission. Space will go quickly; ]Zgml%\eZbflLm^kgbfikhi^kernl^] call 202.488.0407 by March 7 to reserve. (TTY 202.488.2606) Deadly Medicine will be open before and after the program. <;LkZ]bhÍlZbkmbf^mhikhfhmâbl *!3/.$%#2/7!0 Doors open at 6 p.m. g^plahppbmaLbkbnl%pab\a[^`Zg !TANEWSCONFERENCEIN.EW9ORK (OWARD3TERNSAID#"3ISTRYINGTOhBULLYvHIM eZlmfhgma'<;LZelh\eZbflLm^kg This program is made possible by the Helena Rubinstein Foundation. ]bl\nll^]ablieZglpbmaLbkbnl Lm^kglZb]maêZplnbmpZlf^k& ;n\apZe]%Zg]Lbkbnlmhk^mnkgZgr pbmahnm]bl\ehlbg`ma^fmh<;LZl bme^ll%Zg]lZb]<;LpZlmkrbg`mh _bgZg\bZe[^g^_bmlma^rk^\^bo^]_khf k^jnbk^]ng]^kabl\hgmkZ\m' Ê[neerËabf'A^\Zee^]maêZplnbmZ nlbg`<;LkZ]bhÍlZbkmbf^mhikh& >o^g[^_hk^maêZplnbmpZl_be^]% Êi^klhgZeo^g]^mmZËZ`Zbglmabf[r fhm^Lbkbnl%bg\en]bg`maôZen^ UNITED STATES HOLOCAUST MEMORIAL MUSEUM Lm^kgmkb^]mhnilmZ`^ma^Z\mbhg <;Lq^\nmbo^H__b\^kE^leb^ h_ZmkZg\a^h_LbkbnllaZk^lmaZm 100 Raoul Wallenberg Place, SW (15th Street), Washington, DC 20024-2126 pbmaZaZlmberZkkZg`^]g^pl\hg_^k& Fhhgo^l%pahfLm^kglZb]aê]Z Lm^kgZg];n\apZe]k^\^bo^]^Zker Metro: Smithsonian (Blue/Orange Line) | www.ushmm.org ^g\^bgFZgaZmmZgMn^l]Zrmhlmkbd^ `kn]`^Z`Zbglmabf' _hk^q\^^]bg`ZmZk`^m_hkln[l\kb[^k _bklmZmabl_hkf^k^fiehr^k' <;LpZgmlLm^kg%ablZ`^gm%=hg bg\k^Zl^l'B4C7BDC4;0? Grand PLAY Prize bmlik^]^\^llhk' $10,000 0__[TD]eTX[bX?^SBcTaT^20;85kK^Z\abg` Z\khllma^bkahf^g^mphkdl' m^f%nl^kl\Zg]h\dma^bkihkmZ[e^ Daily Prizes _nkma^kbgmhebobg`khhfl%:iie^ Ma^g^pFZ\Fbgbehhdlfn\a ieZr^klbgmhma^li^Zd^klZg]nl^Z

F =0B30@ B?$ =TfH^aZBc^RZ4gRWP]VT =0B30@Bc^RZ2: ;0BC 270=64 ?4A24=C270=64 BC>2: ;0BC 270=64 ?4A24=C270=64 ' (# ' ! ' # 8]caPfcV " '# !&! (" 1Xcbca\ ' $ !!! "' (("# !!' "( !' %% March 5-19 0__[XRPW ! & & '( 4eTa[Pbc %#! !#" &" 30C4 ;^bTab ;^bTab BC>2: ;0BC 270=64 ?4A24=C270=64 Look inside the inserts! Editions of March 5 2WXHdR & & $( '! 6TeXch7A !$ ' #'& %! 21B1] !##% "& # and March 12, including the Early Sunday Edition :X]V?Wa\ %!$ "%! '! 0_^[[^6 #("' ( ( $$ 2[TPa2WP] !'" " 7^b_XaP "(& &"# $% ?[dV?^fTa $ ( &% " 2^\RPbc !%'" "$ available Saturday at select locations. 6_^C<<0 ##' &# #! <022 !&$ "# 2^\Rb_ !%&$ # 3hR^\ ! "$ !( ! 4bRP[P6_ !#'$ " $ ( 3XaTRCE $&% # % Get in on the fun and you could win big! *No purchase necessary. For complete Official Rules and other contest details,visit 3Xb]Th !&(( "( %' washingtonpost.com/postcontests beginning March 5, 2006. Open to legal residents 6P]]Tcc %! % %" !% of DC, MD and VA,18 or older. Void where prohibited. Game Cards not available in 3^[[PabX]U^aTXV]RdaaT]Rh home delivery editions. APcTb 2daaT]Rh ;XQch<0 '!# % #& 2DAA4=C ?A4E8>DBF44: C>30H ?A4E8>DB30H H40A06>

BC0C4>5C74B42A4C0AH)3TARTINGATAM 72##HANNELS"ARBARA (ARRISONAND3ECRETARYOF3TATE#ONDOLEEZZA2ICEWILLBEWORKINGOUTINTHE GYMTOBURNCALORIESASPARTOFAHEALTHSERIESSETTOSTRETCHOVERTHREEDAYS ;^RP[

EP:X[[b= EZpfZd^klbgAhnl^ Ma^bg\k^Zl^phne]`^g^kZm^ OZ'%bllihglhkbg`bgUUTaX]V$ :Uâ mZ[e^lZe^lmZqieZg .)fbeebhgZggnZeerb_Ziieb^] ni`kZ]bg`ma^,)&r^Zk&he]k^`bhgZe [bee[^_hk^ma^_nee\hffbmm^^Z_m^k 8]Uâ\PcX^]^]DBc3TPcW _hkk^`bhgZemkZglbm bgma^\hngmb^l [nlZg]ln[pZrlrlm^f' Pabiie^%=&:kebg`mhg%Z`k^^]mh Ma^k^pZk]_hkbg_hkfZmbhgbgma^ h_ :kebg`mhg FZkreZg]Zg]ma^=blmkb\mh_ kôbl^bm%Ziierbg`ma^bg\k^Zl^mh dbeebg`h_ZfZghgNLmk^^mGP A827<>=3E0k?hkma^l^\hg] Zg] ?Zbk_Zq 1;4F8B0? ^][ri^hie^bgZ]Zkd\hehk^]mkn\d hklihkmnmbebmroâb\e^%lbfbeZkmhZ l\ZeZ]^'0? F0B78=6C>=32k20?8C0;½B28E8;F0A3454=B4B;8BC430B4=30=64A43 A>2:E8;;4<3 CTT]PVTa <^]cV^\Tah2^D_bATfPaS 5â7PcT2aX\TCX_bc^ $: 9PX[TSUâ :k^pZk]_hkbg_hkfZmbhgbgZl^kb^l h_aZm^\kbf^lmkbie^]Mn^l]Zrpbma ZeZk`^\hgmkb[nmbhg_khfZgZghgr& :XS]P__X]V fhnl]hghk'Fhgm`hf^krA><3k:Ikbg\^ Zg]hgâblmhkb\l\ahhep^kôZg& @^hk`^ÍlUUTab3XUUTaT]c C^k^fbZa;khpgAZee%*0%h_ 0RR^d]cÛBW^^cX]V EZg]ho^k%blZelh\aZk`^]pbma_Zel^ ¨!TEENAGERWHOWASINSIDEA *EEPFIREDUPONBYAN!LEXANDRIA bfikblhgf^gmZg]_bklmZg]l^\hg] POLICEOFFICERSAYSTHEOFFICERWAS ]^`k^^ZllZnem'A^k^fZbglcZbe^] NOTDIRECTLYINFRONTOFTHE*EEPWHEN bgeb^nh_,))%)))[hg]' -)#(%,$5#),,%470 HEBEGANFIRING DISPUTINGANINITIAL POLICEACCOUNTOFAFATALWEEKEND BDAA>D=3431HC7428CH)!CLASSFROM!MERICAN5NIVERSITYVISITS&ORT3TEVENS LOCATEDOFFTH3TREET.7INTHE Ma^l^Zk\a\hgmbgn^l_hkZghma^k SHOOTINGINTHEPARKINGLOTOFAPAN lnli^\mbgma^?^['1\Zl^%bgpab\a $ISTRICT4HEFORT ATTACKEDBY#ONFEDERATEFORCESIN ISPARTOFARINGOFFORTRESSESPROTECTINGTHECAPITALTHAT CAKEHOUSE\C^SPh?PVT0 iheb\^lZb]AZeeZg]ma^l^\hg]fZg HASBEENLISTEDASONEOF!MERICASMOST ENDANGERED#IVIL7ARSITES ACCORDINGTOTHE#IVIL7AR0RESERVATION4RUST db]gZii^]Z*-&r^Zk&he][hr'Ma^ iZbkZee^`^]erZiikhZ\a^]ma^ rhng`lm^kg^Zkma^G^p=3E0kE^`bleZmbhgikhab[& ]kbobg`Z\mboblmllZrZeehplk^lb]^gml CdTbSPh5TQ!' 4eT]X]V?XRZ# % (" ma^_Z\^b_a^]b]ghmZ\\hfiZgr bmbgÒbk`bgbZgl_khfl^kobg`Ze\h& mhl^ko^Ze\hahemhoblbmhklk^`Zk]& ;;H0? lhfîkhl^\nmhklZg]Zgmb&]kngd^g hklihnl^+*hkhe]^k'0?

5>A?4C4½BB0:4)0ETE3AMPRASISRETURNINGTOTHETENNISCOURT SIGNINGUPFOR THE7ORLD4EAM4ENNIS0RO,EAGUEMORETHANTHREEYEARSAFTERHISLASTMATCHA VICTORYOVERRIVAL!NDRE!GASSIINTHEFINALOFTHE53/PENFORHISTHMAJOR B_^acb

Bg;kb^_ BâXP]ÊXSa^>dcX]=Pcb½>_T]Ta Zg]k^`neZkl' lmZkmpa^gma^GZmbhgZelahlmma^ ;Zmme^_hkl^\hg][Zl^ ?hkma^k^\hk]%o^m^kZgnmbebmr& =0CB=>C4B Ibmml[nkàIbkZm^lhgMankl]Zr% pbeepZbmZlCZ\dlhg fZg=ZfbZgCZ\dlhgpbeelmZkmZm ¨&RANK2OBINSONMADE ma^lZf^]ZrLhkbZghe^Zo^lmh mhlmZkmol'DbZMb`^kl l^\hg]' HISFIRSTCOMMENTSON0EDRO ieZr_hkma^=hfbgb\ZgKîn[eb\ ÊP^ZkîeZrbg`Zm^Zfp^Ík^ !STACIO WHOAGREEDTOTERMS bgma^Phke];Zl^[Zee=0;BkPbeebm[^ChlÔb]kh ghm`hbg`mh_Z\^Zgrfhk^%lhbmÍl WITHTHE.ATS-ONDAY4HEDEAL Pa^gLhkbZghk^mnkgl_khfma^ hk:e_hglhLhkbZghlmZkmbg`Zml^\& fhkêbd^ZgbgmkZljnZ]`Zf^%Ë ISPENDINGAPHYSICALAND-2)ON mhnkgZf^gm%PZlabg`mhgahi^la^ hg][Zl^pa^gma^PZlabg`mhg Kh[bglhglZb]bgOb^kZ%?eZ' 7EDNESDAYh(EHOPESTOCOM pbee[^Zf^gZ[e^mhZlpbm\amhma^ GZmbhgZelhi^gma^bk^qab[bmbhg ÊP^ÍeemZd^Zghiihkmngbmrmh PETEANDSHOWUSHECANBEONEOF hnm_bê]' l^ZlhghgP^]g^l]Zr8 ehhdZmlhf^h_ma^hma^kieZr^kl THESTARTERS v2OBINSONSAIDh)TS ÊTLhkbZghÍlVghmieZrbg`

*/(.2!/58!0 Ma^Zglp^k3g^bma^k' maZmZkâ^k^bg\Zfi[Zmmebg` GOODTOHAVEANINDIVIDUALWHOS [^\Znl^B]b]gÍminmabfbgma^ 4IM(UDSONISTAKINGOVERAS!TLANTAS FZgZ`^k?kZgdKh[bglhgÍl _hkZch['Ma^l^\hg]`Zfâ^k^ HADSUCCESSAVETERANGUYWHO ebg^ni%ËKh[bglhglZb]'ÊPâZo^ ACEINHISSECONDYEARWITHTHECLUB ebg^ni_hkma^`Zf^Z`Zbglmma^ Zmahf^p^ÍeeaZo^Zik^mmr`hh] KNOWSHOWTOPITCH KNOWSHOW hma^kieZr^klmhehhdZm'Lha^Ílghm DbZMb`^kl_khfLhnmaDhk^Zpbee m^Zfhnmma^k^'Ë TOGETPEOPLEOUT KNOWSHOWTO `hbg`mhieZrma^_bklmmph]Zrla^Íl 10B410;; [^Zfbqmnk^h_[Z\dnil%ikhli^\ml Kh[bglhglZb]Ob]khblebdêrmh PITCHINTOUGHSITUATIONSv a^k^'Ë0? 7dSb^]AT_[PRTbB\^[ci 0b>_T]X]V3PhBcPacTa MbfAn]lhgpbeelmZkmhi^gbg`]Zr B?A8=6CA08=8=6k10AAH1>=3B¹5>A4E4AH>DA68A; _hkma^:meZgmZ;kZo^l'Ma^\aZg`^ bgma^khmZmbhg\hf^lpbmama^[e^ll& =Tf1XaS bg`h_+)).hi^gbg`]ZrlmZkm^kChag Lfhems%pahlZrlbmÍlmbf^mhiZllma^ 4]cTabaX^[Tb a^k^%a^Íl`hbg`mhlmZkmhi^gbg` Kb\aZk]Ab]Ze`hahi^l ]Zr'An]]rÍlma^`nr'Ë0? mhlZeoZ`^\Zk^^kZg] =10 2^[P]VT[^7TPSbc^Câ^]c^ pbglihmbgma^hnm_bê] ;krZgA8>;4BkKb\aZk]Ab]Ze`hZkkbo^] KZimhklZlbmlik^lb]^gmZg]`^g^k& Zmma^Hkbhe^lÍlikbg`mkZbgbg`_Z\be& ZefZgZ`^kMn^l]Zr%k^Z]rmhe^Zo^ bmrmabgdbg`Z[hnmahpabl_hkmng^ ablbfikbgmhgZ aZ]\aZg`^]' g^pm^ZfZ_m^k Bg+)))%Ab]Ze`hl^^f^]]^lmbg^] liebmmbg`pbmaZ _hklmZk]hfZ_m^k[Zmmbg`',*-pbma \en[maZm]b]gÍm --ahf^klZg]*++K;Blbgabl_bklm h__^kabfZ\hg& _neel^ZlhgpbmamaÂhnlmhg:lmkhl' mkZ\m^qm^glbhg' Lbg\^ma^g%abllmh\daZlienff^m^]% ;C8<4)$RESSEDINDRAGPORTRAYING0AULA!BDULOFh!MERICAN)DOL v3AN&RANCISCO'IANTSSTARSLUGGER"ARRY fZ]^.fbeebhgbg+)).Zg]*+'. fZgZg]\ab^_^q^\nmbo^'0? "ONDS CENTER PARTICIPATESINAROOKIEHAZINGSPOOFOFTHEHITTELEVISIONSHOWBESIDEHISTEAMMATESON4UESDAYIN fbeebhgmaîkôbhnll^Zlhg' 3COTTSDALE !RIZ5SUALLYSURLYINPUBLIC "ONDSHASSEEMEDMOREOPENTOTHEPRESSDURINGTHISSPRINGTRAINING ÊBmabgdZ[hnmmaZmZehm%ËlZb] 2>;;4647>>?B Ab]Ze`h'ÊMaZmdbg]h_\hgmkZ\m% FBD½b1T]]TcccÂTcXaT Zg]rhndghppaZmrhn\Zg]h% =b\d;^gg^mmpbeek^mbk^Zl paZmrhnÍo^]hg^bgmaîZlmÉbmÍl PZlabg`mhgLmZm^Íl[Zld^m[Zee m^\agb\Ze\hffbmm^^fZrlnli^g] ghm^Zlr';nmBZ\\îmmaZm'BÍfcnlm \hZ\aZ_m^kma^l^ZlhgZg]mnkgho^k CXTb>:½SX]Fâ[S1PbTQP[[2[PbbXR l^fb_bgZe`Zf^lZ_m^k*-bggbg`lb_ `hbg`mh\hfâ^k^%]hfr[^lmZg] ma^m^ZfmhlhgMhgr;^gg^mm'Ma^ 10B410;;kPhke];Zl^[Zee

CWTP\^d]cTHE7INTER/LYMPICS46RATINGSDECLINED B_^acb FROM4HEAVERAGERATINGWAS ANDTHECLOSINGCER (,qEMONIESWERETROUNCEDBYh$ANCINGWITHTHE3TARSv 8]=5; CP[Zb]^ ?a^VaTbb G^`hmbZmbhgl[k^Zd h__,]Zrl[^_hk^_k^^ Z`^g\rbll^mmh[^`bg

5>>C10;;uG?EeZ[hkmZedl[khd^ h__Mn^l]Zrmak^^]Zrl[^_hk^ma^

3!.'4!.!0 lmZkmh__k^^Z`^g\r%e^Zobg`m^Zfl BCD3H01A>03)-IDFIELDER"OBBY#ONVEY FORMERLYAKEYPLAYERON$#5NITED Zg]ieZr^klbgZjnZg]ZkrZ[hnm HASSCOREDFOURGOALSFORTHE"RITISHTEAM2EADINGINHISSECONDYEARWITHTHECLUB g^`hmbZmbg`g^p\hgmkZ\ml' @^g^NilaZp%^q^\nmbo^]bk^\& mhkh_ma^G?EIeZr^kl:llh\bZmbhg% li^gmmaêZlmmak^^]Zrlf^^mbg` THE OLYMPIANS 0\TaXRP]2^]eTh5Xcb bgG^pRhkdZg]PZlabg`mhgpbma \hffbllbhg^kIZneMZèbZ[n^' ÊP^Ík^]^Z]eh\d^]'Ma^k^Íl ARE BACK! 8]FXcW1aXcXbWB`dPS ghpa^k^mh`h%ËNilaZplZb]' ]^[nmbg+))*pa^ga^pZl*0Zg] ÊMa^k^Ílghk^Zlhgmh\hgmbgn^ >q&='<'Ngbm^]lmZk ma^lZf^r^Zk[^\Zf^Zmma^mbf^ma^ f^^mbg`'Ë Tickets start as low as bl_bg]bgàblgb\a^_hk rhng`^lml\hk^kbgFEL'A^\ZgieZr Ma^ G?E K^Z]bg`mabll^Zlhg bg]^_^gl^hkfb]_bê]Zg]aZll\hk^] Z\dghpe^]`^] * _hnk`hZel_hkK^Z]bg`mabll^Zlhg' ma^mZedlaZ][kh& $ L>224Ak;h[[rgèZg]hgma^[Zlbl N'L'gZmbhgZem^Zfbg,-Zii^Zk& gh_nkma^k]bl\nl& 5 h_mak^ôb]^hl'Ghpa^Ílhgma^ Zg\^l`hbg`bgmhP^]g^l]ZrgbàmÍl lbhglp^k^l\a^]& abàebàmiZ\dZ`^lZlK^Z]bg` ^qab[bmbhg`Zf^Z`ZbglmIheZg]Zm ne^]'Maê^Z`n^ 5PSHAW a^Z]l_hkmaÎk^fb^kE^Z`n^_hk DZbl^kleZnm^kgÍl?kbms&PZem^k& lZb]bmphne]ghm ma^_bklmmbf^' LmZ]bhgÉpa^gma^:f^kb\Zgl ^qm^g]?kb]ZrÍl]^Z]ebg^_hkma^ Ma^++&r^Zk&he]fb]_bê]^kaZl ieZrBmZerbgma^_bklmkhng]h_ma^ lmZkmh__k^^Z`^g\r' aZ]ZlmZg]hnml^Zlhg_hkma^KhrZel Phke]gèZg] l^Zlhg'EZlml^Zlhg%a^fZgZ`^] mbZmbhglmh^qm^g]ma^*+&r^Zk&he] Z_m^kfhobg`_khf='<'Ngbm^]bg _hnklmZkmlZg]Zii^ZkZg\^lZlZ Z`k^^f^gm' Cner+))-' ln[' MZedlaZo^[^^g`hbg`hg_hk Ê;h[[rÍl[^^gZlehp[nkg%Ë ÊB`hmma^\aZg\^mhieZr%Ëa^lZb]' fhk^maZgZr^Zk' K^Z]bg`fZgZ`^kLmô^gèbla%[nmbmÍlmph]b__^k^gm\ne& mablphne][^maêZlmr^ZkpbmaZ f^k%a^lZmabflê_]hpgZg]inmmh mnk^l'Ma^k^pZlZebmme^Z]cnlmf^gm lZeZkr\Zi%lhZ`^gmlZg]m^Zfh__b& Upcoming Home Games abflê_ma^mZk`^mh_[^bg`Zk^`neZk i^kbh]'Mablr^Zk%Bdg^pô^krhg^ \bZelpZgmmhdghpahpmhlmkn\mnk^ ieZr^kZg]a^Íl]hg^maZm'Ë Zg]_êm\hf_hkmZ[e^Zg]bmÍl`hg^ \hgmkZ\ml' 30H½BCE;8=4D? Zg]ZggnZekZbl^lZ_m^k+))/bgZ ehg`&m^kf]^Zephne][êbfbm^]mh Sunday, March 12th vs. Senators – 3 p.m. =10&?<>=2B=4HE7IZARDSLOOKTO WINTOHELPITS.#!!4OURNAMENTBID ,)i^k\^gm' BOUNCEBACKFROMTHEIRLOSSTO-EMPHIS 2>;;4647>>?B'?<>=4B?=!.O B_ma^]^Zebl^qm^g]^]ma^\Zi AGAINSTTHE)NDIANA0ACERS 4EXASINVADES4EXAS!- \hne][^*)fbeebhghkfhkâbà^k' For info, call 202-397-SEAT or 2>;;4647>>?B(?<>=320! -ARYLAND =10(?<>=4B?=4HE(OUSTON2OCKETS 30E46>;314A60? PLAYSITSFINALHOMEGAMEOFTHESEASON HOSTTHE0HILADELPHIAERS visit WashingtonCaps.com AGAINST-IAMI B>224A!?<>=4B?=!4HE53 C^]h:â]WTXbTa)?PcaXRZAP\bTh 2>;;4647>>?B&?<>=4B?=.O$UKE MENSNATIONALTEAMPLAYS0OLANDIN fX[[[TPeTcWTATSbZX]bfXcWPaT_dcP *Price based upon purchase of the WTOP Eagle’s Nest offer of four tickets or more. VISITS&LORIDA3TATE WHICHCOULDUSEA 'ERMANY cX^]PbPbPR[PbbPRckC^SPh½b?^bcB_âcb F43=4B30Hk " ! %k4G?A4BBk &

B<0ACC0;:)4HE.&,SCOUTINGCOMBINEWASUNKINDTOEX 4EXASQUARTERBACK6INCE 9OUNG2UMORSFLEWTHATHEGOTASIXONTHE QUESTION7ONDERLICTESTEXAMINING INTELLIGENCEANDSPEED"UT4EXANS'-#HARLEY#ASSERLYDEBUNKEDTHOSERUMORS B_^acb

dc^U7XbBWT[[ ahi^mhM^kilbgfb]lm ¨6ERNON$AVISWENTTOTHE.&, COMBINEINTENTONASTONISHINGTHE h_mablr^ZkÍl_k^^_Zee .&,STALENTEVALUATORS!NDTHE FORMER5NIVERSITYOF-ARYLANDTIGHT

"2!$,%9#"/7%2!0 C4A?B7>>?BkHg\^ma^ldr`^ml ENDDIDJUSTTHAT\C^SPhX]B_âcb 3UMPTERWATCHES6ILLANOVACOACH*AY ]Zkd^ghnà%ô^gmaZmô^k&ik^l^gm 7RIGHTDISCUSSTHESTARFORWARDSSTATUS lbeo^kebgbg`blmhnàmhib\dhnm' Ln\ablma^\Zl^_hkma^FZkreZg] M^kkZibgl%pahaZoêhlmlô^gh_ pbma*.,[eh\d^]lahmlZg]@blmÍl,0 Bd\_cTa>_cbc^ ma^bkeZlmgbg^`Zf^lZg]ghp Zk^`hh]_hklbqmabgma^:<<' fnlmahi^_hkZfbkZ\e^h_g^Zk& Ê:lehg`Zl;;4647>>?BkObeeZghoZ_hkpZk] _hkma^M^kkZibgl%pahahlmFbZfb a^pZgmlf^mh[^%Ë@blmlZb]'

Lnfim^k%Zl^\hg]&m^Zf:ee& @blmZg]cngbhkPbee;hp^klZk^jnb& *%&&2%9!#!-!2!4)!0-!44(%73'5."9!0 bm^]fbgnm^lpa^gPbeebZflg^^]l ;b`>Zlmlê^\mbhgeZlml^Zlhg% ^mer`bobg`\hZ\a@ZkrPbeebZflZ B4;53454=B4)*AMES'IST LEFT HASSHOWNSOMEOFFENSIVEFLASHES BUTMOSTLYHE lhf^fhk^fnl\e^]hpgehp'ÊFr pbeek^mnkgmhma^_hnkma&kZgd^] k^Zlhgmh[^_^ê`hh]Z[hnmma^ AND7ILL"OWERS RIGHT HAVEDEMONSTRATEDTHEIRDEFENSIVESKILLSTHISSEASON fZbg_h\nlpa^gB`hbgblmhmkrZg] Pbe]\Zmlg^qmr^Zk_hkabll^gbhk _nmnk^'Ghmlhfn\ah__^glboêr% lanm]hpgma^hma^km^ZfÍl[b`fZg l^Zlhg' pa^k^g^bma^kblinmmbg`ni[b`gnf&

ROCKVILLE AUDI CAPITOL CADILLAC JERRY’S JEEP OF MANASSAS JERRY’S Lincoln Mercury PAUL BROTHERS SUBARU Rockville,MD 301-881-0900 Greenbelt, MD 301-441-9600 MANASSAS 703-631-1181 MANASSAS 703-631-1181 HERNDON 703-437-6000 1450 Rockville Pike • rockvilleporsche-audi.com 6500 Capitol Drive • www.capitolcadillac.com 8820 Centreville Rd• www.jerrysjeep.com 8820 Centreville Rd• www.jerryslmjeep.com 770 Eldon Street • www.paulbros.com

LAND ROVER ROCKVILLE 355 TOYOTA KOONS CHEVY TYSONS Rockville,MD 301-294-0117 EURO MOTORCARS Rockville, MD 301-309-3917 Vienna, VA 888-383-8200 1190 Rockville Pike • ‘Let the Adventure Begin‘ Bethesda,MD 301-986-8800 15131 Frederick Road • www.darcars.com BROWNS BUICK ISUZU 2000 Chain Bridge Rd • www.koons.com 7020 Arlington Rd. • Buying/Internet Services Welcome KAY JENNINGS SPRINGFIELD TOYOTA Fairfax, VA 703-934-4926 Springfield 703-451-0300 10245 Lee Highway • www.brownsbuickisuzu.com EURO MOTORCARS GERMANTOWN 6570 Amherst Ave. • www.springfieldtoyota.com LEXUS OF SILVER SPRING Germantown,MD 240-686-1300 KOONS TYSONS TOYOTA 19750 Germantown Rd. • euromotorcarsgermantown.com To place dealership listing Silver Spring, MD 800-266-4874 Vienna, VA 888-505-1137 JERRY’S FORD 2505 Prosperity Terr • www.lexusofsilverspring.com 8610 Leesburg Pike • www.koons.com in the directory, Annandale, VA 703-256-5000 please call 6510 Little River Turnpike• www.JerrysFord.com 202-334-4710 or your Washington Post KOONS STERLING FORD BROWNS LINCOLN MERCURY 355 NISSAN/VOLVO BROWN’S VW OF MANASSAS Sales Representative Alexandria, VA 888-342-7300 Fairfax 703-352-5500 Rockville, MD 301-309-2200 Manassas, VA 703-257-6002 46869 Harry Byrd Hwy • www.koons.com 10287 Lee Highway • www.brownscar.com 15911 Indianola Drive • www.darcars.com 8846 Mathis Ave. • www.manassasvw.com

Home & Shopping. Fridays.

XX262 'k4G?A4BBk " ! %kF43=4B30H

270BB8BC6DC)!FTERAFIVE YEARHIATUS THE2AMISGETTINGBACKINTOTHE CHASSISCABMARKET $ODGEANNOUNCED4HENEWSERIES WHICHWILLFEA 2Pab TURETHECABS WILLALSOBEEASYTOEQUIPWITHBOXREPLACEMENTS THECOMPANY

Gh%bgma^l^mkhn[e^]mbf^l%p^ \ZgghmZ__hk]mhljnZg]^kô^ghg^ _Zm\Zm':g]maZmÍlparp^lahne][^ aZiir_hkma^+))0F^k\^]^l&;^gs =ZVai]n!LZVai]nVcYL^hZ L&\eZlll^]Zg%lbq_b`nk^lh_^q^\n& mbo^\hfi^glZmbhgpbmaZiaZeZgq CWTF4ACA08=) LITER ]rgZfb\l^Zml%b_ma^\hfinm^kl STT__^RZTcb½bPUTch $/(# VALVE6WITHVARIABLE ]^m^\mma^pZkgbg`lb`glh_ZgZ\\b& A>03C4BCkBgZlniier&lb]^^\hg& INTAKEANDEXHAUSTVALVETIMING ]^gm%ma^l^ZmlbglmZgmerfho^bgmh hfr%kb\ai^hie^Zk^hnkfhlmik^& ANDDUAL STAGEINTAKEMANIFOLD \kZlaihlbmbhgZg]lpêeni%ahe]& \bhnlk^lhnk\^'P^fZr\ê^[kZm^ma^ SEVEN SPEEDADAPTIVE AUTOMAT bg`kb]^klmbàm'F^k\^]^lZelhlZb] ?^]ÍllfZ\d&]hpgh_AB4?>F4A) bga^ZormkZ__b\'

]^g^klZg]_^]hkZfZd^kl]blieZ\^] -95.'*#(5.,/3!.'%,%34)-%3 AT RPM BmÍlfhk^maZgZ`hh]\Zk'BmÍlZ pa^ghg^h_ma^p^Zemar_Zeel8 4HE-ERCEDES33AVING!MERICASUPPERCRUST ONESILLY RICHBIGWIGATATIME ¨?A824) lZ_^[^m'30==48;;>B0=64;4BC8<4B

‘‘ Thanks to Johns Hopkins,

I have a new 30%.#%27%).%2,!4)-%3 !UTOSAFETYADVOCATESSAYSLOPINGWINDSHIELDSANDLOWROOFLINESMOREAND teaching career... MOREPREVALENTINNEWCARDESIGNSHARMFULLYREDUCETHEDRIVERSFIELDOFVISION and a renewed commitment to IdHZZ!DgCdiidHZZ making a _^]^kZelmZg]Zk]l'Ë 0dc^\PZTabcaT]SX]V Maîkh[e^flLmhgêblmlZk^pêe& c^b\P[[TafX]S^fb dghpgmhfZgr]kbo^kl%iZkmb\neZker difference.’’ mahl^pah_Zee_Zkhnmlb]^ma^f^]bZg aPXbX]VbPUTchS^dQcb a^bàml_hkf^gZg]phf^g' Tia Coutroupis :meZlm\a^\d%Z\Zkpbmahnmpbg]hpl FbkbZfL\anefZg%pahbl._^^m 5th Grade Teacher aZlghmr^mZii^Zk^]%[nm\ZkfZd^kl mZee%lZrllhf^\Zk]^lb`glk^lmkb\m Zk^mk^g]bg`mhpZk]lfZee^kpbg& a^koblb[bebmr%bg\en]bgà^kanl[Zg]Íl ]hplmaZml^^fmhk^lmkb\moblb[be& ikbs^]LZZ[maZmla^k^\^gmer]^gm^] Whether you are just starting out in your career or moving ahead, the Johns Hopkins Graduate bmr'Fh]êlpbmaehpkhh_ebg^l%abà [^\Znl^bmlabàk^Zklaê_[eh\d^] lbeel%laZkierlehibg`pbg]labê]l% a^kob^ppa^g[Z\dbg`ni' Division of Education can help you reach your goal. As Maryland’s leading provider of master’s eZk`^]hhkibeeZklZg]a^ZormbgmlZk^ ÊMa^k^Zk^fh]êlh_\ZklmaZmB degrees in education, we are committed to your growth as a teacher, special educator, or pb]êrh__^k^]Zg]É[Zl^]hgahm phne]gô^k[nr[^\Znl^B\ZgaZk]& counselor. Earn your degree or certificate through full- or part-time study, with our flexible fh]êlln\aZlma^

EDU-WPE-2/27, 3/1-2, 3/6, 3/8-9/06 Zg]:nmhLZ_^mr'ÊMa^k^g^^]mh[^ E0AC014380=;>B0=64;4BC8<4B F43=4B30Hk " ! %k4G?A4BBk (

0C0;:8=6C>)!FTERWISHINGDEATHUPON'EORGE7"USHATASHOWIN $UBLIN SINGER-ORRISSEYWASRECENTLYQUESTIONEDBYTHE&") HETOLD.EW-USICAL %XPRESS4HEINDIE ROCKHEROCLAIMSHEIShNOTATHREATTOTHEGOVERNMENTv 4]cTacPX]\T]c

C^SPh½bC^_ BVc9gdlch^c>c` Bc^_b CWTX]RaTSXQ[TcadT 5>A2>=?>BC2><4=C4AC08=<4=C 0UcTa8]]^RT]RT) Uâ\TacPQ[^XSfaXcTa 8\PVTbÛ8]YdbcXRT 50;B47>>3BkRhniehirhnk\Zgh_ Ma^Lng]Zg\^&pbggbg`Ê:_m^k ihkdZg][^Zglhgma^\a^\dhnm[êm Bggh\^g\^Ë^qZfbg^lmaêbo^l Zg]fho^ZehgìZlmma^mZ[ehb]l h_lô^gf^gbfikblhg^]_hk [e^Zmbgènkb]]^mZbelh_ma^^l\Z& ]^\Z]^lZg]_k^^][r=G:ôb& iZ]^lh_mablhkmaZmlmZke^m' ]^g\^'ÊBggh\^g\^Ël\k^^glmhgbàm Ma^g%bgma^phke]Íl[eZ\d^lm Zg]?kb]ZrZmIkhoblbhglEb[kZkrbg bgd%rhnl^^3 \hgcng\mbhgpbmaÊBggh\^gml3A^Z] ÊK:;B=GNGBG?>GMBK> GMË hk ^^l' Ê@K:G=F:MNKGL=H@ */**HNMEHHDBG@?HK .4+)+&+22&)-/)'!=nihgmKRMBMË Pah%rhnfZrZld%pkbm^lmabl [be`^8?hkZpabe^bmpZlMhf =Í:gmhgb'

Ma^.2&r^Zk&he]lZb]ma^phkd '2%'7!(, 34%0(%.3!0 pZlgÍm^ZlrZg]bme^_mZ]ZkdfZkd <0:8=6D?C74=4FB)$!NTONITURNEDHISEXPERIENCEINTABLOIDWRITINGINTOABOOK h2ABID.UN)NFECTS%NTIRE#ONVENTv hgabf'A^Zelhpkhm^ma^lmhkb^l% Zg]%r^l%a^lZb]%a^fZ]^bmZeeni' ng]^k`khng]g^pliZi^k' eb`am^klb]^ÉÊG>P@>G>MB< *220Zg]_hkghp%aZlghbgm^k^lmbg

;nmmaZm]b]gÍm[hma^kma^mZ[ehb] ÊBphkd^]_hkfhlmh_ma^MOlmZ& =BLKR<:GF:D>RHNK k^mnkgbg`mhabl_hkf^k\kZ_m';nm 02/6)3)/.3,)"2!29 Ma^Lng%pab\a[hnàmablphkdbg mbhglbg;Zembfhk^'BpZlma^cZss =H@LF>EEEBD>IBSS:'ËLhf^ a^Z]fbk^lma^^__hkmlh_mahl^pah &REEDOMSJUSTANOTHERWORDFORNOT ma^fb]&*21)l' Zg]ihifnlb\\kbmb\_hkFZkreZg] hma^kla^pbla^laâZ]gÍmpkbmm^g aZo^_heehp^]abf%ebd^Ê:F>EB: BEINGWRONGFULLYIMPRISONEDFORYEARS Lhf^h_abl[^lm!Zg]%a^ghm^l% In[eb\;khZ]\Zlmbg`%Ëa^lZb]'A^ ÉÊFHMA>K;BM>LH??HPG >:KA:KMÍL;:K?;:@?HNG= ablphklm"Zk^]^mZbe^]bgabl[hhd% phkd^]ZlZkZ]bhmZed&lahpahlm MHG@N>MH?>>=LM:KOBG@ BGLHNMAI:gmbk^MABHIB:G<:FI'Ë kZgbgma^P^^derPhke]G^plZ[hnm BTeT]X]7TPeT]. in[ebla^][rObeeZk];hhdl' phklmmêôblbhgg^plikh]n\^kh_ :_m^klhf^h_abl]Zkd^k^__hkml% mphr^ZklZ`h' Lbgè^Zg]k^Z]rmhmbgè^8 =Í:gmhgbpZl]hbgìk^&`Zf^ Zeembf^'Ë a^lZb]%a^phne]`^mZebmme^phk& Pb]^\k^]b[bebmrpZlgô^kZg LZdb%bg:]ZflFhk`Zg% [khZ]\Zlml_hkma^;Zembfhk^Hkbhe^l A^lZpma^mZ[ehb]lZg]_b`nk^] kb^]'ÊBÍ]mabgd%ÌC^lnl%]b]mabl\hf^ blln^3ÊMa^lmn__pZlpkbmm^g_hk !ahlmlZgô^gbg`h_ehp&lmk^ll bgma^fb]&*21)l'?hkZmbf^%a^ a^\hne]]hZme^ZlmmaZmpêe' hnmh_F>8ÍË i^hie^pah]hgÍmmabgdpk^lmebg` Êfbgb&]Zmbg`Ëô^krP^]g^l]Zr pZlin[ebla^kh_AZkkr%;Zembfhk^Íl Lhf^h_abllmhkb^lp^k^hgma^ A^fho^]mhIhkmeZg]%Hk^'%bg bl_bq^]'Ë9>B4?715A0I84A0? mablfhgma!Mn^l]Zrl%:kebg`mhgÍl ;hneôZk]Phh]`kbee]h^lma^lZf^"' K^`blm^kZmankkr]Zm^'\hf' :pZk]lEZmbg:f^kb\Z' LZdb%+-00*1maLm'GP40i'f'%,.4 ;nmbg=^\^f[^k+))-%:ikbe^ +)+&+,+&.)).'!Phh]e^rIZkd&Shh" [hnàmma^Ze[nfÍlfZlm^kl_khf IV`^c\VHZXdcY8]VcXZ L^\lr=bl\hlZg]k^&kê^Zl^]bmhg 6Pah7Pac) B^dcW0\TaXRP]_^_ IêhFnlb\'Aînla^]ma^_bklmlbg& H^dC^^2P]BXc>]7Xb;P_ è^%ÊRhM^=bk^ËmhkZ]bh'LZe^lldr& Bgablg^p[hhd%ÊMa^Labê] QP]SgObohLbgK^lmkb\\bhg^l'Ë ^b`gZg]l^\nkbmriheb\b^lmhôheo^ h_maîZlmr^ZkblFbkZg]Z'Ma^ Pabe^FbkZg]ZÍllhng]\Zg[^ mhf^^m\hgm^fihkZkrmak^Zml'A^Íee

\h^]jnbgm^mÍll^\hg]Ze[nf%ÊLbg 6.5$)')4!,0(/4/ ]^l\kb[^]Zl[n[[e^&`nfm^\agh& li^ZdZg]lb`gmablZ_m^kghhgZm K^lmkb\\bhg^l%Ëbl\^kmb_b^]ieZmb& 270=68=670=3B)/NEOF!RGENTINASHOTTESTACTSALSOCOMESWITHAGOODSTORY ihi%maêrkb\l`h]^î^k3Mhib\l Ihebmb\l Ikhl^' gnfbgbmlahf^\hngmkrZg]aZl bg\en]^]îk^llbgàheb]Zrl% Ihebmb\l Ikhl^%.)*.lF^gmbkZ%Ëbgfb]&+)),mh`hh] ÊFZr[^p^`bo^m^^gZ`^kllhf^ ik^lb]^gmKn[^g:ikbe^l^^f^] \eb\d^]Zg]lhhgk^\knbm^]`nbmZk& kôb^pl'FMObgobm^]FbkZg]Zmh aZiibg^llZg]_ngbgZlmZ`^h_eb_^ F70C½B70??4=8=6. mh[^ma^hgeri^klhglniihkmbg` blmEheh?n^gm^l%ikh`kZffbg`pbs& i^k_hkfZmmaêh\ZeghfbgZmbhg maZmbl\hg_nlbg`%ËFbkZg]ZÍlL^k`b ?[TPbTbT]S_aTbbaT[TPbTbP]S_W^c^b FbkZg]Z' Zk];kngh=Ôb\^gmbZg][Zllblm iZkmr_hkma^FMOOb]^hFnlb\ lZb]'<0A24;>18C0A18;;1>0A3 c^Tg_aTbbTeT]cb/aTPSTg_aTbbR^\ C ComputersCoommppuutteerrss F ForFoorr E EveryoneEvveerryyoonnee Matinee price for all shows Fri-Sun & holidays before 4PM and Mon-Thurs before 6PM. Advanced Ticketing available at MovieWatcher.com or (816) 363-4AMC. R-Rating requires ID. SYSTEM SPECIALS!! LAPTOP SPECIALS!! F - Closed Captioning · J - Descriptive Video Service · G - Open Captioning VPR Matrix D400a P4 2.8Ghz. . . $349 IBM THINKPAD R30 P3-m 1.0 Ghz ...... $399 AMC HOFFMANN CENTER 22 AMC POTOMAC MILLS 18 AMC TYSONS CORNER 16 512mb 160.0GB DVDRW 56K NIC XP 512 mb 30.0 GB DVD 56K NIC 14.1 TFT Eisenhower Ave and Telegraph Road in Alexandria 2700 Potomac Mills Circle, Ste 886 7850 Tysons Corner Center DELL OPTIPLEX P4 2.0Ghz . . . . . $229 DELL LATITUDE C600 P3 850 Mhz ...... $329 703-998-4AMC 703-998-4262 703-998-4262 256mb 40.0GB DVD NIC W2K 256 mb 20.0 GB CD 56K NIC 14.1 TFT DOOGAL (G) ✓ 1:30, 4:05, 6:20, 8:25 DOOGAL (G) ✓ 1:35, 3:30, 5:25, 7:20, 9:15 DOOGAL (G) ✓ 12:00, 2:15, 4:40, 7:10, 9:20 RUNNING SCARED (R) ✓ 1:20, 4:20, 7:20, 10:05 RUNNING SCARED (R) ✓ 1:30, 4:40, 7:25, 9:55 RUNNING SCARED (R) ✓ 1:10, 4:15, 7:20, 10:05 TYLER PERRY’S MADEA’S FAMILY REUNION (PG13) TYLER PERRY’S MADEA’S FAMILY REUNION (PG13) EMACHINE T3624 CEL D330 2.6Ghz . . $229 HP OMNIBOOK 6000 P3 700 Mhz ...... $249 ✓ ✓ TYLER PERRY’S MADEA’S FAMILY REUNION (PG13) ✓ 1:15, 1:45, 2:55, 3:25, 3:55, 4:30, 5:45, 6:15, 6:45, 7:15, 8:30, 9:00, 1:15, 2:15, 3:00, 4:00, 5:00, 5:30, 6:30, 7:30, 8:15, 9:00, 10:00 12:05, 1:15, 2:45, 4:10, 5:20, 7:00, 8:00, 9:45, 10:30 256mb 60.0GB CDRW 56K NIC XP 128 mb 6-10 GB DVD 56K NIC 14.1 TFT 9:30, 10:00 DATE MOVIE (PG13) 1:25, 2:25, 3:20, 4:30, 5:20, 7:00, 8:10, 9:05 DATE MOVIE (PG13) 1:00, 2:00, 3:15, 4:25, 5:15, 6:30, 7:45, DATE MOVIE (PG13) JF 2:25, 4:30, 7:00, 9:05 DATE MOVIE (PG13) 12:25, 2:35, 4:50, 7:10, 9:25 IBM & DELL Pentium 4 1.7Ghz. . . $179 PENTIUM 2 266-366 Mhz with CD-Rom. . . . $179 10:20 EIGHT BELOW (PG) 1:20, 2:20, 4:10, 5:20, 6:50, 7:55, 9:30 EIGHT BELOW (PG) 1:05, 4:05, 7:00, 9:45 256mb 20.0GB CD NIC W2K 128 mb 4-6.0 GB 56K Modem & Adapter EIGHT BELOW (PG) 1:00, 1:40, 3:45, 4:30, 6:35, 7:35, 9:25, 10:25 FREEDOMLAND (R) 2:30, 4:20, 5:10, 7:40, 10:00 FREEDOMLAND (R) 1:25, 4:30, 7:35, 10:15 EIGHT BELOW (PG) F 1:00, 3:45, 6:35, 9:25 CURIOUS GEORGE (G) 1:45, 3:45, 5:45, 7:45 CURIOUS GEORGE (G) 12:20, 2:40, 5:00, 7:30 DELL GX110 SFF P3 600Mhz . . . . . $89 FREEDOMLAND (R) 2:25, 5:40, 6:50, 8:30, 9:35 FINAL DESTINATION 3 (R) 2:05, 5:45, 7:50, 9:55 FINAL DESTINATION 3 (R) 12:30, 2:55, 5:10, 7:45, 10:15 CURIOUS GEORGE (G) 2:15, 4:45, 7:00, 9:20 FIREWALL (PG13) 1:50, 4:50, 7:10, 9:35 256mb CD Loaded W/98se OR Linux! USED • REFURBISHED • OPEN BOX FIREWALL (PG13) 12:20, 2:50, 5:15, 7:40, 10:10 FINAL DESTINATION 3 (R) 2:30, 4:55, 5:55, 7:25, 8:25, 9:55 THE PINK PANTHER (PG) 1:55, 5:05, 7:15, 9:25 FIREWALL (PG13) 2:20, 5:30, 8:00, 10:30 SOMETHING NEW (PG13) 7:00, 9:20 THE PINK PANTHER (PG) 12:10, 1:20, 2:30, 3:40, 4:55, 6:00, 7:15, 8:15, 9:30, 10:30 PENTIUM 3 SYSTEMS With MONITOR. . . $59 All Tested & Guaranteed THE PINK PANTHER (PG) 1:35, 4:20, 6:40, 9:10 WHEN A STRANGER CALLS (PG13) 2:10, 5:35, 7:45, 9:45 THE PINK PANTHER (PG) JF 12:10, 2:30, 4:55, 7:15, 9:30 (Min) 450mhz 128mb 2GB CD NIC & CRT PRICES & MODELS SUBJECT TO CHANGE MRS. HENDERSON PRESENTS (R) 5:00, 9:50 ANNAPOLIS (PG13) 9:40 PM SOMETHING NEW (PG13) 2:05, 4:35, 7:05, 9:45 BIG MOMMA’S HOUSE 2 (PG13) 1:50, 5:15, 7:35, 9:50 SOMETHING NEW (PG13) 1:45, 4:35, 7:20, 9:55 WHEN A STRANGER CALLS (PG13) 4:40, 10:25 NANNY MCPHEE (PG) 2:00, 4:15 WHEN A STRANGER CALLS (PG13) 3:15, 10:20 Falls Church, VA 703-821-1400 • Beltsville, MD 301-931-6630 • Glen Burnie, MD 301-553-6840 BIG MOMMA’S HOUSE 2 (PG13) 2:25, 8:05, 10:30 UNDERWORLD: EVOLUTION (R) 1:40, 7:05, 9:35 ANNAPOLIS (PG13) 9:40 PM NANNY MCPHEE (PG) 1:10, 4:10 AMC RIVERTOWNE 12 BIG MOMMA’S HOUSE 2 (PG13) 1:30, 4:25, 7:05, 9:50 UNDERWORLD: EVOLUTION (R) 2:10, 4:50, 7:40, 10:15 Exit 4A I-95, 1/2 mi. on Oxon Hill Rd. NANNY MCPHEE (PG) 12:50, 5:25, 7:50 HOODWINKED (PG) 1:25, 3:35 BROKEBACK MOUNTAIN (R) 1:00, 4:20, 7:25, 10:25 BROKEBACK MOUNTAIN (R) 1:25, 7:15 703-998-4AMC How to Buy a Home DOOGAL (G) 5:40, 8:00 AMC COLUMBIA MALL 14 AMC SPRINGFIELD MALL 10 RUNNING SCARED (R) 4:40, 7:40 10300 Patuxent Parkway Loisdale and Franconia Road TYLER PERRY’S MADEA’S FAMILY REUNION (PG13) with Zero Down 4:20, 5:30, 7:20, 8:10 410-423-0520 703-971-3991 DATE MOVIE (PG13) 5:20, 8:20 A new home ownership program allows qualified buyers to buy a home DOOGAL (G) 2:10, 4:15, 6:20, 8:30 EIGHT BELOW (PG) 4:30, 7:30 DOOGAL (G) 1:00, 3:20, 5:40, 8:00, 10:15 with absolutely no down payment. RUNNING SCARED (R) 5:10, 8:15 FREEDOMLAND (R) 5:50, 7:40, 8:20 RUNNING SCARED (R) 1:45, 4:45, 7:45, 10:25 TYLER PERRY’S MADEA’S FAMILY REUNION (PG13) CURIOUS GEORGE (G) 5:10 TYLER PERRY’S MADEA’S FAMILY REUNION (PG13) 1:30, 4:45, 8:45 FINAL DESTINATION 3 (R) 5:40, 8:00 12:00, 1:05, 1:50, 2:35, 3:55, 4:40, 5:25, 6:45, 7:30, 8:15, 9:35, 10:20 You may have owned a home before and are presently renting, or maybe DATE MOVIE (PG13) 5:20, 8:45 THE PINK PANTHER (PG) 5:50, 8:10 DATE MOVIE (PG13) 12:30, 2:45, 5:00, 7:15, 9:40 EIGHT BELOW (PG) 1:45, 4:30, 7:50 SOMETHING NEW (PG13) 7:50 you are first time homebuyers and need a way to break into the housing EIGHT BELOW (PG) 1:30, 4:25, 7:20, 10:25 FREEDOMLAND (R) 4:50, 8:00 WHEN A STRANGER CALLS (PG13) 4:50 FREEDOMLAND (R) 1:35, 4:20, 7:10, 10:10 CURIOUS GEORGE (G) 4:30 BIG MOMMA’S HOUSE 2 (PG13) 5:00, 7:50 market but are holding back because you think you require $10,000; CURIOUS GEORGE (G) 12:40, 3:00, 5:20, 7:40, 10:00 CURIOUS GEORGE (G) JF 4:30 $20,000 or even more for a down payment. FINAL DESTINATION 3 (R) 5:00, 8:30 AMC UNION STATION 9 CURIOUS GEORGE (G) JF 12:40, 3:00, 5:20, 7:40, 10:00 FIREWALL (PG13) 6:30 Located at Union Station FINAL DESTINATION 3 (R) 12:05, 2:10, 4:30, 7:00, 9:20 Well regardless of your present situation, if you want to get into, or FIREWALL (PG13) F 6:30 703-998-4AMC FIREWALL (PG13) 12:00, 2:30, 5:10, 7:50, 10:30 THE PINK PANTHER (PG) 2:00, 5:00, 8:15 DOOGAL (G) ✓ 2:30, 4:30, 7:00 THE PINK PANTHER (PG) 12:35, 3:05, 5:35, 8:05, 10:20 re-enter the housing market without having to make a cash down WHEN A STRANGER CALLS (PG13) 8:50 RUNNING SCARED (R) ✓ 1:30, 5:30, 8:15 SOMETHING NEW (PG13) 5:35, 8:10, 10:30 payment, then this new program may be just what you’re looking for. Why WHEN A STRANGER CALLS (PG13) F 8:50 TYLER PERRY’S MADEA’S FAMILY REUNION (PG13) ✓ WHEN A STRANGER CALLS (PG13) 9:30 PM BIG MOMMA’S HOUSE 2 (PG13) 4:40, 7:45 2:15, 5:00, 7:45 pay your landlord’s mortgage when you can be building your own equity. DATE MOVIE (PG13) 2:45, 4:45, 7:20 BIG MOMMA’S HOUSE 2 (PG13) 1:40, 4:15, 6:50 AMC MAZZA GALLERIE DATE MOVIE (PG13) JF 2:45, 4:45, 7:20 NANNY MCPHEE (PG) 12:45, 3:10 EIGHT BELOW (PG) 2:10, 5:10, 8:10 Industry insiders have prepared a new special report entitled, “How to Jenifer and Wisconsin FREEDOMLAND (R) 2:40, 5:05, 7:50 AMC COURTHOUSE PLAZA 8 202-537-9553 Buy a Home With Zero Money Down” which reveals how this new and CURIOUS GEORGE (G) 2:35, 4:35 Courthouse and Birch Rd. DOOGAL (G) 2:40, 5:00, 7:40, 9:40 FINAL DESTINATION 3 (R) 2:00, 5:55, 8:15 ✓ 703-998-4AMC innovative program can get you into the housing market immediately and TYLER PERRY’S MADEA’S FAMILY REUNION (PG13) ✓ FIREWALL (PG13) 8:00 wih absoulutely no down payment. 2:00, 4:35, 7:10, 9:45 WHEN A STRANGER CALLS (PG13) 7:00 DOOGAL (G) ✓ 3:00, 5:00, 7:30 EIGHT BELOW (PG) 2:00, 4:40, 7:20, 10:00 BIG MOMMA’S HOUSE 2 (PG13) 2:20, 5:25 FREEDOMLAND (R) 2:40, 5:45, 8:25 THE PINK PANTHER (PG) 2:30, 4:50, 7:30, 9:50 FINAL DESTINATION 3 (R) 2:30, 5:35, 8:20 SOMETHING NEW (PG13) 2:20, 4:45, 7:05, 9:35 AMC COUNTRY CLUB MALL 6 To hear a brief recorded message about how to order your free copy of FIREWALL (PG13) 3:10, 5:50, 8:15 NANNY MCPHEE (PG) 2:10, 4:30, 7:00, 9:25 Country Club Mall on Vocke Rd near Route 68. this report, call 1-866-791-1110 to discover how you can get into the THE PINK PANTHER (PG) 2:50, 5:10, 7:50 NANNY MCPHEE (PG) JF 2:10, 4:30, 7:00, 9:25 703-998-4AMC housing market NOW and with ABSOLUTELY NO DOWN PAYMENT. Call SOMETHING NEW (PG13) 5:40 MATCH POINT (R) 2:50, 5:40, 8:35 DOOGAL (G) ✓ 5:45, 7:45 7am-7pm. DATE MOVIE (PG13) 5:15, 7:30 MUNICH (R) 2:00, 5:20, 8:40 LOEWS GEORGETOWN 14 FREEDOMLAND (R) 5:25, 7:55 THE CHRONICLES OF NARNIA (PG) 2:20, 8:30 3111 K Street, N.W. CURIOUS GEORGE (G) 5:55, 8:05 GOOD NIGHT, AND GOOD LUCK (PG) 2:10, 5:30, 8:00 This report is courtesy of Primer Realty.com 202-342-6441 821 THE PINK PANTHER (PG) 5:35, 7:45 Not intended to solicit properties, currently for sale. DOOGAL (G) 12:10, 2:30, 4:45, 6:55, 9:00 WHEN A STRANGER CALLS (PG13) 5:35, 8:05 LOEWS WHEATON PLAZA 11 Copyright ©2005 ✓ RUNNING SCARED (R) 1:35, 4:20, 7:00, 9:40 MAGIC JOHNSON CAPITAL CENTRE 12 Viers Mill Rd. Btwn. Georgia & University TYLER PERRY’S MADEA’S FAMILY REUNION (PG13) ✓ 901-949-9202 746 1:30, 4:10, 6:50, 9:30 800 Shopper’s Way, Largo DATE MOVIE (PG13) 1:20, 3:25, 5:40, 7:50, 10:00 301-324-4220 844 DOOGAL (G) ✓ 5:20, 7:20, 9:20 FREEDOMLAND (R) 12:30, 3:10, 5:45, 8:20, 10:55 RUNNING SCARED (R) 2:10, 5:00, 8:10, 10:50 RUNNING SCARED (R) ✓ 4:10, 7:15, 10:00 Join Gadsby’s Tavern Museum for the most FREEDOMLAND (R) F 12:30, 3:10, 5:45, 8:20, 10:55 TYLER PERRY’S MADEA’S FAMILY REUNION (PG13) TYLER PERRY’S MADEA’S FAMILY REUNION (PG13) ✓ FINAL DESTINATION 3 (R) 4:40, 7:40, 10:20 2:00, 3:00, 4:30, 5:30, 7:00, 8:00, 9:30, 10:30 4:05, 7:00, 9:45 FIREWALL (PG13) 1:50, 4:25, 7:20, 9:50 DATE MOVIE (PG13) 2:15, 4:45, 7:15, 9:45 DATE MOVIE (PG13) 5:20, 7:30, 9:35 Spirited Competition in Ages THE PINK PANTHER (PG) 12:05, 2:20, 4:35, 7:15, 9:25 EIGHT BELOW (PG) 1:15, 4:15, 7:05, 10:15 DATE MOVIE (PG13) F 5:20, 7:30, 9:35 SOMETHING NEW (PG13) 2:00, 4:30, 7:10, 9:35 FREEDOMLAND (R) 2:20, 3:20, 4:50, 7:20, 7:50, 9:50 CURIOUS GEORGE (G) 1:05 EIGHT BELOW (PG) 4:20, 7:05, 9:40 THE MATADOR (R) 12:20, 2:40, 5:10, 7:35, 9:55 FINAL DESTINATION 3 (R) 1:50, 4:20, 7:10, 9:20 FREEDOMLAND (R) 4:15, 7:10, 9:35 MATCH POINT (R) 1:10, 4:05, 7:25, 10:10 FIREWALL (PG13) 4:00, 9:00 CURIOUS GEORGE (G) 5:45, 7:50 THE NEW WORLD (PG13) 1:15 THE PINK PANTHER (PG) 1:40, 4:40, 7:40, 10:00 FINAL DESTINATION 3 (R) 4:40, 8:00, 10:10 nd MUNICH (R) 12:00, 3:30, 7:05, 10:30 SOMETHING NEW (PG13) 1:20, 6:20 FIREWALL (PG13) 9:50 PM The 2 Annual MEMOIRS OF A GEISHA (PG13) 12:25, 3:35, 6:45, 10:05 WHEN A STRANGER CALLS (PG13) 12:50, 5:50, 10:20 THE PINK PANTHER (PG) 5:10, 7:20, 9:30 SYRIANA (R) 1:55, 5:00, 7:55, 10:45 BIG MOMMA’S HOUSE 2 (PG13) 1:10, 3:40, 6:10, 8:40, 10:55 WHEN A STRANGER CALLS (PG13) 4:45, 7:35, 10:10 Great Rum Punch Challenge LOEWS WISCONSIN AVE. 6 LOEWS SHIRLINGTON 7 BIG MOMMA’S HOUSE 2 (PG13) 4:30, 7:30, 9:50 4000 Wisconsin Avenue, N.W. 2772 South Randolph 202-244-0882 714 703-671-0910 801 LOEWS FAIRFAX SQUARE 8 RUNNING SCARED (R) 1:30, 4:15, 7:00 MRS. HENDERSON PRESENTS (R) 2:00, 5:00, 7:20, 9:30 8065 Leesburg Pike March 11, 2006 7:00 - 9:30pm DATE MOVIE (PG13) 2:30, 4:40, 7:10 THE THREE BURIALS OF MELQUIADES ESTRADA (R) 703-506-9857 802 1:10, 3:40, 6:20, 9:10 FREEDOMLAND (R) 1:40, 4:10, 6:55 MRS. HENDERSON PRESENTS (R) 2:40, 5:20, 7:45, 10:00 CURIOUS GEORGE (G) 2:20, 4:45 TRISTRAM SHANDY: A COCK AND BULL STORY (R) 1:20, 4:40, 6:50, 9:20 THE MATADOR (R) 2:30, 4:50, 7:10, 9:50 Just as residents did 200 years ago, enjoy FIREWALL (PG13) 2:00, 4:30, 6:50 MATCH POINT (R) 1:30, 4:30, 7:10, 9:50 MATCH POINT (R) 2:05, 4:45, 7:35, 10:05 MUNICH (R) 7:30 WHY WE FIGHT (PG13) 1:40, 4:20, 6:30, 9:00 6 different Rum Punches and vote for the TRANSAMERICA (R) 2:20, 4:40, 7:30, 9:45 BROKEBACK MOUNTAIN (R) 2:40, 6:20 BROKEBACK MOUNTAIN (R) 1:00, 4:10, 7:00, 9:40 winner! Also enjoy gourmet food and a silent GOOD NIGHT, AND GOOD LUCK (PG) 1:50 MUNICH (R) 1:40, 5:10, 8:30 LOEWS WHITE FLINT 5 CAPOTE (R) 4:50, 7:30, 10:00 MUNICH (R) F 1:40, 5:10, 8:30 auction. Non-alcoholic drinks available. North Bethesda MEMOIRS OF A GEISHA (PG13) 1:50, 5:00, 8:20 310-423-1014 741 LOEWS DUPONT 5 GOOD NIGHT, AND GOOD LUCK (PG) 2:00, 4:10, 7:20, 9:30 TYLER PERRY’S MADEA’S FAMILY REUNION (PG13) 1350 19th St. CAPOTE (R) 2:10, 4:45, 7:00, 9:35 Call 703.838.4242 or visit 2:00, 4:40, 7:00, 9:25 202-872-9555 711 FREEDOMLAND (R) 2:05, 4:35, 7:10, 9:50 MRS. HENDERSON PRESENTS (R) 5:15, 8:15 LOEWS UPTOWN 1 www.gadsbystavern.org to register. FIREWALL (PG13) 2:15, 7:30 MANDERLAY (NR–NOT RATED) 4:30, 7:30 3426 Connecticut Avenue N.W. THE PINK PANTHER (PG) 2:10, 4:45, 7:15, 9:30 WHY WE FIGHT (PG13) 5:30, 8:30 MRS. HENDERSON PRESENTS (R) 2:00, 4:20, 7:00, 9:35 BROKEBACK MOUNTAIN (R) 4:45, 7:45 202-966-5400 713 BROKEBACK MOUNTAIN (R) 4:30, 9:45 CAPOTE (R) 5:00, 8:00 GOOD NIGHT, AND GOOD LUCK (PG) 2:00, 4:30, 7:00, 9:30 Times for Wednesday, March 1, 2006 Gadsby’s Tavern Museum ✓-SPECIAL ENGAGEMENT No passes or discount coupons FEATURE PRESENTATION STARTS APPROX. 10-15 MINUTES AFTER PUBLISHED SHOWTIME 134 N. Royal Street Alexandria, VA 22314 The City of Alexandria complies with the terms of the ADA. An individual who wishes an accommodation should call 703.838.4242 at least seven days prior to the event.

WEDNESDAY Design you. IT’S UNBOUND TO BE A GREAT WEEKEND “Home & Shopping” can lead you to your look. Wednesdays.

3.1.2006 WeekendPass. Thursdays. EXPRESS XX040 X017d 3x1.5 20 WEDNESDAY 3.1.2006 EXPRESS 21 XX617a 2x12 GHI A publication of is... health | fitness | nutrition | grooming | Look for this new weekly section Look for this new weekly to look and feel all about how that’s best. and be your Every Tuesday in Express Tuesday Every Starting March 7 March Starting Get beauty | fashion | relationships | and much more l l f 8 d h n d h l a o r 1 e c g n a n t r a c a u o a e a ©2006 920 915 915 o n i l e (1255) e e t X017a 3x.5 . e h 800 1015 800 1025 (115 430) (200) 815 r , s (500) 1025 s g a s t e t 740 950 1020 745 945 1030 (115 400) 645 730 940 1010 A e l n a g o (110 355) 650 930 (200 445) 715 945 (200 420) 730 940 (140 415) 705 945 (130 350) 715 930 (115 340) 645 920 m (100 410) 710 1000 (100 400) 740 1020 (120 410) 720 1015 (145 425) 725 1005 (105 355) 655 1000 (100 400) 710 1010 (100 345) 715 1000 (100 400) 745 1020 (145 445) 800 1015 (105 400) 720 1005 r V (1200 220 440) 700 (1245 345) 700 950 (1230 320) 655 945 (1240 335) 715 945 (1130 200 410) 650 w i (1240 410) 720 1010 (1245 325) 755 1020 o a t (115 200 415 500) 715 (110 150 345 430) 700 n f t t i o (1215 230 445) 700 930 (1220 230 500) 730 950 (1245 145 330 430) 700 (1145 210 420) 735 935 (1210 225 440) 740 955 i , (1215 245 510) 745 1015 (1220 1250 310 340) 700 (1150 215 430) 800 1015 g e t t s e o r n n v e a t b p i (1245 145 345 445) 705 745 1000 0 o s e c v e (1230 130 315 415) 630 730 930 1030 (1230 130 315 415) 630 730 915 1015 (1200 100 300 350) 640 710 925(1135 1000 155 330 405) 645 750 905 1025 9 r d i m h n (1205 130 240 400 450) 710 750 940 1020 e b n 0 a n i d y c n r e r o 9 e s r o i a - e y n i e t a 7 m s r a H a e 5 s 8 u a . c , Mondays. s t e 6 7 y o i 7 e e BIG MOMMA'S HOUSE 2 (PG-13) DIG MADEA'S FAMILY REUNION (PG-13) DIG DOOGAL (G) DIG RUNNING SCARED (R) - ID REQ'D DIG EIGHT BELOW (PG) DIG DATE MOVIE (PG-13) DIG FREEDOMLAND (R) - ID REQ'D DIG FIREWALL (PG-13) DIG FINAL DESTINATION 3 (R) - ID REQ'DTHE PINK DIG PANTHER (PG) DIG CURIOUS GEORGE (G) DIG WHEN A STRANGER CALLS (PG-13) DIG DOOGAL (G) DIG MADEA'S FAMILY REUNION (PG-13) DIG DOOGAL (G) DIG MADEA'S FAMILY REUNION (PG-13) DIG DOOGAL (G) DIG MADEA'S FAMILY REUNION (PG-13) DIG RUNNING SCARED (R) - ID REQ'D DIG FREEDOMLAND (R) - ID REQ'D DIG FINAL DESTINATION 3 (R) - ID REQ'DCURIOUS DIG GEORGE (G) DIG SOMETHING NEW (PG-13) DIG MATCH POINT (R) - ID REQ'D DIG CHRONICLES OF NARNIA (PG) DIG OC & DA: DATE MOVIE (PG-13) DIG RUNNING SCARED (R) - ID REQ'D DIG EIGHT BELOW (PG) DIG DATE MOVIE (PG-13) DIG FREEDOMLAND (R) - ID REQ'D DIG FIREWALL (PG-13) DIG FINAL DESTINATION 3 (R) - ID REQ'DTHE PINK DIG PANTHER (PG) DIG CURIOUS GEORGE (G) DIG SOMETHING NEW (PG-13) DIG NANNY MCPHEE (PG) DIG BROKEBACK MOUNTAIN (R) - ID REQ'D DIG RUNNING SCARED (R) - ID REQ'D DIG EIGHT BELOW (PG) DIG DATE MOVIE (PG-13) DIG FREEDOMLAND (R) - ID REQ'D DIG FIREWALL (PG-13) DIG FINAL DESTINATION 3 (R) - ID REQ'DTHE PINK DIG PANTHER (PG) DIG CURIOUS GEORGE (G) DIG WHEN A STRANGER CALLS (PG-13) DIG NANNY MCPHEE (PG) DIG BIG MOMMA'S HOUSE 2 (PG-13) DIG r - u h y d d 1 r v d u t 3 p o e u i # 0 a e o 0 l n b f t 1000 1000 1025 (115) , I a h y d 7 w a m s a 650 950 . 840 1010 745 1015 t c 730 830 1020 (120 420) 710 9 (1200 250 515) i S (145 410) 645 910 (110 410) 700 945 (125 400) 650 930 (200 435) 710 945 (115 415) 745 1035 (215 510) 810 1030 (150 445) 800 1040 720 755 1000 1030 (100 440) 750 1025 (155 445) 740 1030 (1210 245 510) 740 (1240 350) 655 940 (1245 345) 645 915 (1230 340) 630 920 (1230 335) 710 955 (1240 435) 715 955 (1150 215 440) 705 (1235 340) 700 1005 n (1215 225 455) 730 945 (1210 240 500) 720 930 (1145 130 230 430 530) (1210 230 445) 725 930 (1200 100 235 400 515) (1220 240 500) 740 940 (1205 220 435) 650 920 (1250 300 510) 720 925 (1200 225 450) 715 940 n (1140 1210 150 220 250 i (1205 225 505) 800 1025 (1205 235 500) 735 1005 (1120 205 500) 750 1040 (1215 245 515) 745 1015 (100 140 330 400) 640 900 0 l (1155 210 435) 700 920 950 e c (1130 1215 200 300 440 540) 740 d l (1140 1220 220 320 520) 620 820(1150 910 1250 210 310 450 550) 750 850 (1130 130 230 420 520) 710 810 1000 r 9 E o f 6 - 355 425 455 525) 630 700 730 800 905 935 1005 1035 0 e 1 g 7 , “Careers” can move you up and ahead.

r . SOMETHING NEW (PG-13) DIG BIG MOMMA'S HOUSE 2 (PG-13) DIG DOOGAL (G) DIG FINAL DESTINATION 3 (R) - ID REQ'D DIG CURIOUS GEORGE (G) DIG DOOGAL (G) DIG MADEA'S FAMILY REUNION (PG-13) DIG RUNNING SCARED (R) - ID REQ'D DIG EIGHT BELOW - DIGITAL PROJECTION (PG) DIG EIGHT BELOW (PG) DIG DATE MOVIE (PG-13) DIG FREEDOMLAND (R) - ID REQ'D DIG FINAL DESTINATION 3 (R) - ID REQ'DTHE DIG PINK PANTHER (PG) DIG CURIOUS GEORGE (G) DIG WHEN A STRANGER CALLS (PG-13) DIG NANNY MCPHEE (PG) DIG BIG MOMMA'S HOUSE 2 (PG-13) DIG HOODWINKED (PG) DIG BROKEBACK MOUNTAIN (R) - ID REQ'D DIG CHRONICLES OF NARNIA (PG) DIG MADEA'S FAMILY REUNION (PG-13) DIG RUNNING SCARED (R) - ID REQ'D DIG EIGHT BELOW (PG) EIGHT BELOW (PG) DIG DATE MOVIE (PG-13) DIG FREEDOMLAND (R) - ID REQ'D DIG FIREWALL (PG-13) DIG THE PINK PANTHER (PG) DIG MADEA'S FAMILY REUNION (PG-13) DIG DOOGAL (G) DIG FIREWALL (PG-13) DIG RUNNING SCARED (R) - ID REQ'D DIG EIGHT BELOW (PG) DIG DATE MOVIE (PG-13) DIG FREEDOMLAND (R) - ID REQ'D DIG BIG MOMMA'S HOUSE 2 (PG-13) DIG FIREWALL (PG-13) DIG FINAL DESTINATION 3 (R) - ID REQ'DTHE DIG PINK PANTHER (PG) DIG NANNY MCPHEE (PG) DIG CURIOUS GEORGE (G) DIG SOMETHING NEW (PG-13) DIG c a n 8 h I 920 930 935 955 c 1010 (205) ,

(410) 950

e (505) 1020 (1250) 710 7 o (115 350) 655 (105 350) 650 (125 335) 715 (135 430) 725 805 1010 1035 c (445) 750 1025 (130 430) 740 940 (125 425) 735 945 (120 420) 700 940 (105 410) 710 935 (115 340) 720 950 (110 355) 655 955 (215 500) 735 945 (100 405) 700 955 (145 435) 700 935 (120 355) 705 940 n (110 415) 730 1010 (100 400) 720 1005 (105 400) 645 1000 (100 405) 710 1015 (110 415) 720 1015 (100 410) 715 1005 (130 420) 730 1010 (210 455) 800 1030 (110 435) 735 1025 (120 440) 725 1005 (130 430) 745 1030 n (1250 405) 725 1000 (1255 355) 715 1000 (1255 345) 730 1030 - (125 140 205 405 420 (130 210 430 505) 735 (1200 225 455) 730 955 e (1210 1230 100 250 320 (1205 235 505) 740 1020 (1240 310 545) 815 1035 (1220 300 535) 755 1015 (1225 255 515) 750 1025 s i

i c 445) 645 700 725 925 940 1005

(135 215 435 510) 725 810 1025 3

(120 200 350 425) 650 740 930 1005 S e 400 530) 640 720 810 920 1000 1040 (1215 1245 230 330 445 540) 800 940 o r r

e 0

depression…but still feel sad? feel still depression…but u Are you taking medication for medication you taking Are h e Times For 3/1/06

T 7 N Still Depressed? Still Advance you. DOOGAL (G) DIG MADEA'S FAMILY REUNION (PG-13) DIG RUNNING SCARED (R) - ID REQ'DEIGHT DIG BELOW (PG) DIG DATE MOVIE (PG-13) DIG FREEDOMLAND (R) - ID REQ'D DIG FIREWALL (PG-13) DIG THE PINK PANTHER (PG) DIG CURIOUS GEORGE (G) DIG MRS. HENDERSON PRESENTS (R) - ID REQ'D DIG SYRIANA (R) - ID REQ'D DIG RUNNING SCARED (R) - ID REQ'D DIG DOOGAL (G) DIG RUNNING SCARED (R) - ID REQ'DEIGHT DIG BELOW (PG) DIG SECOND CHANCE (PG-13) DIG CURIOUS GEORGE (G) DIG MATCH POINT (R) - ID REQ'DBROKEBACK DIG MOUNTAIN (R) - ID REQ'DCAPOTE DIG (R) - ID REQ'D DIG DATE MOVIE (PG-13) DIG MADEA'S FAMILY REUNION (PG-13) DIG EIGHT BELOW (PG) DIG DATE MOVIE (PG-13) DIG FREEDOMLAND (R) - ID REQ'D DIG FIREWALL (PG-13) DIG FINAL DESTINATION 3 (R) - IDTHE REQ'D PINK DIG PANTHER (PG) DIG CURIOUS GEORGE (G) DIG WHEN A STRANGER CALLS (PG-13) DIG SOMETHING NEW (PG-13) DIG NANNY MCPHEE (PG) DIG BIG MOMMA'S HOUSE 2 (PG-13) DIG MADEA'S FAMILY REUNION (PG-13) DIG WHEN A STRANGER CALLS (PG-13) DIG RUNNING SCARED (R) - ID REQ'D DIG SOMETHING NEW (PG-13) DIG FREEDOMLAND (R) - ID REQ'D DIG MADEA'S FAMILY REUNION (PG-13) DIG EIGHT BELOW (PG) DIG DATE MOVIE (PG-13) DIG FIREWALL (PG-13) DIG FINAL DESTINATION 3 (R) - IDTHE REQ'D PINK DIG PANTHER (PG) DIG WHEN A STRANGER CALLS (PG-13) DIG BIG MOMMA'S HOUSE 2 (PG-13) DIG THE THREE BURIALS OF MELQUIADES ESTRADA (R)DIG - ID REQ'D OC & DA: EIGHT BELOW (PG) DIG UNIVERSITY SchoolSchool of of Computer Computer InformationInformation Systems Systems

BS IN INFORMATION TECHNOLOGY AAS IN NETWORK MANAGEMENT AND SECURITY • Emphasis is on PC configuration and trouble shooting, network administration and network management, • Instructors use team based approach to simulate teamwork as demanded by IT Market. • Emphasis is on computer systems security including network security and Internet security AAS IN DIGITAL DESIGN • Curriculum emphasis is on web design. • Exposure to emerging technologies in web design and the Internet. • Team based approach to media design simulates a professional work environment. Call 1–800–7–my–goal to enroll ! " (1-800-769-4625)000 EARN YOUR BS DEGREE IN #$% AS LITTLE AS 30 MONTHS!! EARN YOUR AAS DEGREE IN AS LITTLE AS 15 MONTHS!! • Financial Aid is available for those who qualify. • Two convenient locations: Tyson’s Corner and Woodbridge. • Student housing is available in ! " Tyson’s Corner. # $ We Help You Achieve Your Goals! %&'

www.stratford.edu & Main Campus • Tyson’s Corner: 7777 Leesburg Pike • Falls Church,VA 22043 ( ) % Branch Campus • 13576 Minnieville Road Woodbridge,VA 22192 * " 1 9: * ;3 < +"" ,) ( - Landscape Design . /0 * & +1 ) ) & & & Graduate Certificate 2 233 0 ) GW K STREET CENTER 4 "% * " & & . ( 2 & 2 ) ( ) Landscape professionals are in Information Session ) + 0 demand. With its emphasis on Tuesday, March 14 5678 &%' ()#* +, small-scale landscape design, our 6:30 pm program enjoys a strong K Street Center for reputation in the area’s landscape Professional Education and horticulture industry. 2020 K Street NW Lower Level Washington, DC Convenient. Evening and Metro: Orange or Blue Line to weekend classes, downtown and Farragut West or Foggy Bottom in local gardens. RSVP today! 202.973.1130 Transferable. May be applied to nearyou.gwu.edu/landscape an MLA at Virginia Tech’s Alexandria campus.

www.gwu.edu/gradinfo

GW is an equal opportunity/affirmative action institution certified to operate in VA by SCHEV. 30942 F43=4B30Hk " ! %k4G?A4BBk!"

C748A644B40A42>>:43)'ORDON2AMSAY THE"RITISHCHEFWITH3ATANS PEOPLESKILLS RETURNSTOROASTCULINARYWANNABESINASECONDSEASONOF&OXS h(ELLS+ITCHENv4HISDELICIOUSREALITYCOMPETITIONRETURNSIN*UNE CT[TeXbX^]

ÊBÍfle^îbg`hgma^\hn\a%Ë >=CEC>=867C ^qieZbglabl_Zma^k' Lhbm`h^lhgÊ?k^^Kb]^%ËZ`hh_r 6HaVX`ZgÉhFF78C4 (OWDID.ICOLE,INKLETTEREVERBECOME 5^g½b¼5aTTAXST½ Zm23,)i'f'' 0<4A820½B=4GCC>?<>34;PM 50. GZm^!Chla=^Zg"blfbe]er\aZ& 7ENEVERRECOVEREDFROM-ISS*AYSAY cPZTbPUd]]h[^^ZPc `kbg^]Zmmaîkhli^\mh__kbmm^kbg` INGSHELOOKEDONEOFTHE3EVEN$WARFS _^bcR^[[TVT[PiX]Tbb ZpZrableb_^bgmaâhf^mhpga^ h,UCKY vMAYBE 4ONIGHT h!.4-vTRAILS mahnàmaâZ]^l\Zi^]'Hgma^ HERONA0ARISPHOTOSHOOT 341DCkGZm^li^gmablmbf^pblêr hma^kaZg]%a^Íllmbeelfbmm^gpbma 101HBC4?B pabe^h__Zml\ahhebgkbg

;>BCPM !"# #LAIRERETRACESHER 7" lnk_^]Zg]]kZgd[^^k' f^kabà&l\ahhe_ZgmZlr`bkeZg] STEPSTOTHEPLACE"ABY4URNIPHEAD C8;C)'EEKSAREALWAYSCUTERWHEN GhpaâZlk^mnkg^]mhmbgr ghpZ[Zgdmêe^k'PahÍl^g`Z`^]' WASKIDNAPPEDMEANWHILE *ACKAND ALMOSTUPSIDE DOWNANDINPAIRS Chaglhg5C74181;4)A8E0;B>594BDB Zg]\kZla^lpbmaabliZk^gml' hg\^\an``^]fhmhkhbeZlZiZkmr <0:48CF>A: PM .ATIONAL'EOGRAPHIC Ng_hkmngZmêr%GZm^ÍliZk^gml lmngmZg]ghp[kZ`lZ[hnmbm' ?A>942CAD=F0HPM "RAVO 4HEFINAL !PPARENTLY THEh-ONTY0YTHONS,IFE aZo^mnkg^]bmbgmhZ`rf' Ê?k^^Kb]^ËblZ\ZnmbhgZkrmZe^

THREESCURRY3ANTINOSANTICSMAKEFOR OF"RIANvVERSIONOFFAITHANDPROPHETEER ÊBÍeele^îhgma^\hn\a%Ëaîkh& &/8 _hkma^\akhgb\ZeerngfhmboZm^]' GREAT46 BUT$ANIEL6 WILLYOUMAKE INGIN*ESUSYOUTHWASFAIRLYACCURATE ihl^l'ÊMa^\hn\ablghmZghimbhg%Ë H>DAA>><.F70CA>><..ATE ?hkmngZmêr%bm\hf^lpbmaeZnàl USSOMESPACEPANTS 0A8>=14A64A4G?A4BB ablfhflahhml[Z\d' *OSH$EAN ANDHISFOLKSRE NEGOTIATE mhh'5A0I84A<>>A40?

#4EA ##867B;G#4EA 224AA>;;GE>>3 40;>@#>40; ! !0E$@34@ E.4/F !0E$@34@ E394.091@46=F! #4EA )>=867B(7>E (48=54;3 )74(8=A )74(8=A (48=54;3 <4@820=3>; ,60=074148,64=>=:0<19<7 ! @44'834 #4EA 4@0;3>0B!0@64 @84=3A

,;3#4EA ,744;>5>@BC=4 4>?0@3G ! ==C0;2034AB E ,>0<84>C 0,@0F! 0@10@0,0;B4@A(?4280; ! #4EA

(#4EA #4EA)>=867B =B )>=867B (B8;;(B0=38=6 ! (B8;;(B0=38=6 ! @8<8=0;"8=3A E'81484=30/?=480==F !0B4(7>E #4EA (#. E,<0,70F! #4EA )70B A(7>E )70B A(7>E @84=3A D4@G'0G<>=3 <4@820A#4FB)>?">34; ! >;;4640A:4B10;; 4,74,> ,=820"0@A E39C ,>0C=F

)74#4EA>C@,8B7 8@:A,44: ,8=3A>@0AB;4'>G0;.40@ ! =(40@27>5=284=B@4;0=3 ">=BG%GB7>=A%4@A>=0;4AB ! =34?4=34=B!4=A E4<6)<0=>60

,>@;3#4EA CA8=4AA'?B )74#4EA>C@,8B7 8@0AB;4'>G0;.40@ ! )7480=0>=A?8@02G ">=BG%GB7>=A%4@A>=0;4AB ! ">=BG%GB7>=A%4@A>=0;4AB ! CA8=4AA(27; )0D8A(<8;4G ,>@;3#4EA ">=4GE8A4 0HH #,<> 91 (% 4AB@84=3A ,>@;3#4EA )0D8A(<8;4G 70@;84'>A4 !,<,C,8,8 ! (B4D40@D4G )74%0@:4@A "G,8540=3 83A 4@=84"02 $=4)@448;; ! 40CBG0=3B7444: 4@=84"02 "G,8540=3 83A (4F0=3B748BG ,8;;@024 <4@820= CAB824 >;30A48;4A >C=BGC=B4@ >C=BGC=B4@ >C=BGC=B4@ >C=BGC=B4@ (?G8=6>="GA4;5 (?G8=6>="GA4;5 @>AA8=6 >@30= E,746C11,42>38;4C=B4@80@84A )74">ABFB@4<4 >@A4%>E4@'>03B>B74"02;0G ! !8BB;4/>>)70B>C;3 ! =8<0;%@428=2B >@A4%>E4@'>03B>B74"02;0G %0@:)A)>? !8D4 224AA@0=B43 )74%0@:4@A )74%0@:4@A )74>@=4@ =!8D8=6>;>@ =!8D8=6>;>@ =!8D8=6>;>@ '+& %@>942B'C=E0G E69A0<#9A0942B'C=E0G E ,509@0942B'C=E0G E)3,>=*9?< 480F %@>942B'C=E0G E$0?8498F %@>942B'C=E0G ! %@>942B'C=E0G &$ , I!>>:,7>A)0;:8=6#>EK >< %@4A4=BA '4=> 08;G(7>E >;14@B'4?>@B 70??4;;4A(7>E (>CB7%0@: (>CB7%0@: @0E=)>64B74@ 08;G(7>E >;14@B'4?>@B &*') >@4=A828;4A >@4=A828;4A >?A >?A )4F0A(,) )4F0A(,) >@4=A828;4A >@4=A828;4A %AG27824B42B %AG27824B42B !0A+460A!0E %0@2>% "(&+ ', 0A701 0A701 FB@4<4=68=44@8=6 (C?4@A78?A #9A0<1?6=34:= ! "GB7CAB4@A E996482,%4B#,.5F "GB7CAB4@A E#088C<9:F 8@BG >1A E34780C%A00:030<89719<>F )@0C<0!8548=B74' %;0AB82(C@64@G4D4@;G8;;A %;0AB82(C@64@G45>@40=35B4@ '41C8;B)74C<0=>3G(7>? ! %;0AB82(C@64@G4D4@;G8;;A "(% , (8AB4@(8AB4@ /02:>3G %78;>5B74CBC@4 )70BA(>'0D4= I#>E.>C(44B K /@08>?<06C=98 4.3,65,9388C#,.,< !854,8B74@4: (8AB4@(8AB4@ /02:>3G )70BA(>'0D4= >;384 0B4)@C4>;;GE>>3(B>@G #4EA ! #4EA @ E.>498F @ E&,>>99=,8/&A48=F 8@;#4FB>>@ #C<14@ (8=6;4 (0BC@30G#867B!8D4

)70B A(7>E )70B A(7>E 1>D4B74!0E

8=6>5B748;; 8=6>5B748;; I1>D4B74!0EK <,7,%>0@08%0,2,608=4>>B7K %?=:08=09648,<<066 '4=>D0B8>= ,:=3,0@@8>@A C@1??40; >CA4C=B4@A 8B274=)@4=3A ,0=B)70B CG"4 ! 0A78=B74BB82 >CA4C=B4@A ,70B.>C4B @40<>CA4 @44(BG;4 ,7>A4!8=4 $"#, B740D4= E0<0)092,48F (<0;;D8;;4 E&<,8=10<08.0F I 0@0B4 83K .>498$,6:3 ,..349!9<4C?54E#,>F 9<4>, ,<>489@0 )74 ;C1 "()&', >=A?8@02G E 48.968==,==48,>498F ">34@="0@D4;A E=<470 ,-F ">34@="0@D4;A E6?0F ">34@="0@D4;A E%0A0<=F ">34@="0@D4;A E,>3<997&0.3F (8F46@44A>5@0=28A02>= "! )"$ )74>;34=8@;A )74>;34=8@;A I)74(>C;>;;42B>@K 064==,46-0<>C2743K $97,8.0088,617,8$,8/,66,>485911 ,8;;@024 ,8;;@024 %0@4=B0;>=B@>; '>><'0834@A ! 8@42B5542B ")+A)74(7>? ")+A)74(7>? )@C4!8 54 E7,97:0>4>4@0,>0@;3 E0C)0=>F #43A(27>>; 0==G%70=B>< 08@;G$33?0@4=BA 8<= (?>=64>1 ;;@>E=*? C;;>CA4 @4A7%@8=24 '>A40==4 '>A40==4 '>A40==4 )74>A1G(7>E (B0@60B4( E<,.0F 7>ABC=B4@A 7>ABC=B4@A 7>ABC=B4@A E C<>60=#6,8>,>498F 7>ABC=B4@A !0A826,8/3970= I)74*=8=D8B43K ,>@;3A,8;34AB%>;824+834>A (@8<4(24=4=D4AB860B8>= (@8<4(24=4=D4AB860B8>= I)74%@8=28?0;K ,70=06?=34 8?<-,83423=.3996:<48.4:,61423>=.,7:?=.<470 * (48=54;3 (48=54;3 D4@G'0G<>=3 D4@G'0G<>=3 D4@G'0G<>=3 D4@G'0G<>=3 D4@G'0G<>=3 D4@G'0G<>=3 (4F0=3B748BG (4F0=3B748BG I4BB8=6%;0G43K "0@B70 ! "GAB4@84A>5#>07A;>>3 #>07A@:)74)@C4(B>@G %AG2782,8B=4AA E0><,C,6F! %AG2782,8B=4AA E"@0<5466F! #>07A@:)74)@C4(B>@G 70@<43 E 4>>609B919<<9<=F !0E$@34@ E?-<4=F (% I@<06433>=K 98 4@&C60< 30<9><40=>9=,@0,<>31<97,8,=>0<94/ I@<06433>=K 5,41 C=:

(0;034%0@490A #>B8)4;4<=3> !0)>@<4=B0 )84@@034%0A8>=4A >@0HM=%0@B83> 428A8>=4A 428A8>=4A #>B8)4;4<=3> NB1>;74=>9=9

J&C4!>2C@0 #>B8284@>*=8D %4@46@8=0 >=B@0+84=B>G"0@40 ;1>@030 >=@0=28A2>%@4A4=B0 %@8<4@ #>B8284@>*=8D

(?>@BA4=B4@ 4@0 >;;4640A:4B10;; ?50,>69<4/,%>,>0 4@0 #0A:4B10;; #346,/06:34,0<=,>9?=>98$9.50>= <97&9C9>,08>0<489?=>98 (?>@BA4=B4@

"8:40=3"8:4 @>C=3B74>@= =B4@@C?B8>= (40A>=,44:;G >;;4640A:4B10;;&0B,=,>&0B,= 4@0 >;;4640A:4B10;; '>,3,>&0B,=3<4=>4,8 4@0

=>2:>CBA (?>@BA#8B4 #0A:4B10;; 8/4,8,#,.0<=,>),=3482>98)4D,0<48),=3482>98 ,8H0@3A%>AB (?>@BA#8B4 4@0 "0@G;0=3 4AB(?>@BA !>C>11A)>=867B )74(8BC0B8>='>>< %0C;0/07=#>E !0@@G 8=6!8D4 =34@A>=>>?4@

(?4280;'4?>@B 4@0 )74>F'4?>@B,8B7(74?0@3(<8B7 )74$'48;;G02B>@ 4@0 0==8BG>;<4A 4@0 $=B74'42>@3+0=(CAB4@4= )74$'48;;G02B>@

)741@0@B 0@310;; >C=B3>E=,8B7 48B7$;14@<0== '8B0>A1G!8D48@42B (20@1>@>C67>C=B@G )74(8BC0B8>=,8B7)C2:4@0@;A>= I=B7440B>5B74#867BK %4/80C#94>40< +!$ I>@.>C@G4A$=;GK .>498$920< 99<0,<9609?;?0>&9:96 +# I)74(?G,7>!>D43"4K +# I(B@8:4*?B740=3K ?=4.,6?/C,<6,8/ +!$ I)74@8364A0B)>:>'8K <,7,)4664,796/08 +!$ I@><4@4B>B4@=8BGK <,7,?<> ,8.,=>0< +!$ >.>C4;84D48="8@02;4A I 8@AB0B4AK /,7%,8/60< +# "0: (>?@0=>A IAA0C;B>=%@428=2B K .>498>3,8,A50 +$ )74(>?@0=>A E66?0$0=:0.>F I'0GK +# "->=(4B I>>34;;0AK <470<,7,$9-0<>0!4<9$,C 49>>,90#0=.4 +$ I)74%70=B><>5B74$?4@0K 0<,60< +# I#>!>>:8=602:K ,?<08966C +$ IA>>30AB4BAK 970/C<,7,,.5!4.396=98 4&( +# )74!,>@3 E ,>0.9707==G"=4<>=82K +$ 608=AB'>?4A I)7486E44=)74C@A4>5"82704;"G4@AK I">=AB4@K +$ 0=4 +$ I#0B8>=0;)@40AC@4K /@08>?<0!4.96,=,20?8>0<970D +# I+0=4;A8=6K ?23,.57,8 798=>0<3?8>0<-,>>60=.<0,>?<0=48&<,8=C6@,84, 0D>2 I;;0=270=B43K 880,>3,A,C,=K 492<,:3C09<20 %.9>> 08 09<20% #,>>981423>=)9<6/),< +# I03(0=B0K +$ !#k4G?A4BBk " ! %kF43=4B30H Classifieds

JOBS JOBS JOBS JOBS JOBS

AUTOMOTIVE—Very busy service station in No VA. Dentist— for General Practice in DC suburbs (MD) GENERAL JOBS - AIRPORT SERVICES ACCOUNTING—ABC Imaging, has an excel oppty looking for Auto Mechanic. 5 yrs exp. Want to make needed. FT/PT. Fax 301-570-4040. Equipment Operators needed at Dulles Airport to Marketing for an A/P MGR. Pos req B.S. in Acctg & 3+ yrs exp $70k+? Call Zafar 571-243-8800 or fax: operate large vac. trucks. Seasonal FT and PT. MARKETING AGENTS as supervisor. Apply:www.abcimaging.com 703-670-8602 $12-$14/hr. Call Inland Tech. 703-572-7843. For more info visit DISPATCHER/OPERATIONS Fairfield Resorts is expanding its already [email protected] Beauticians/Barber/Natural Hairstylist—Exp’d. HOTEL — Assistant Executive Houskeeper — Full FT/PT 202-319-7086 When was the last time you enjoyed your work? time. Hotel experience necessary. Arlington Resi- successful marketing program and is hiring for the BEAUTY—Stylist & braiders needed. Call Progressive. Stable. Growth. Arlington company dence Court Hotel, opening soon. Please call 703/ approaching Spring & Summer season. If you are ACTIVISM 301-423-3755. in search of positive, sharp teammate, able to 247-1002 to schedule an appointment. outgoing and want a fun job where you can make BOOKKEEPING ASSISTANT work independently. Excellent salary & benefits. great money while working throughout the CAMPAIGN F/T. Exper’d & organized to assist in a/p, timesheets, Fax 703-525-1637 Michael or Hotel community, call Craig Farrin at 703-837-3414 or data entry, routine calculations, mileage, posting & [email protected] The Inn of Rosslyn email: [email protected] JOBS files. Know QuickBooks & payroll software, standard DRIVER (DELIVERIES)/ INVENTORY CLERK The average Marketing Agent is making $55K per FRONT DESK (FT)— Flexible hours, position avail- year plus benefits. Don’t let this pass you by! ENVIRONMENTAL ACTION ofc equipment & procedures. HS Dip. Must pass Immed opening. P/T, M-F, good driver record, valid NCIC Crim bkgd check. $28500 annually to start. drivers lic. Knowledge of DC metro area. Fax resume able in Northern VA. Please send resume MORTGAGE $350-$550/Week Appt. only. Call 202-678-1077. 301-967-7073 or call 301-967-0200 703-524-0220. LOAN OFFICERS • Stop air & water pollution CASHIER/RECEPTIONIST Driver—DUMP TRUCK Driver needed. Contact JANITORIAL We close loans fast. Exceptional processing sup- • Gain campaign exper. Falls Church, VA powersport dealership has immed. Darryl at 202-327-1949. port. Call 877-548-0721 • FT/PT Leadership positions available FT & PT openings for friendly customer service Driver—earn $600-800/week FT, $9-14/hr PT. De- Level Fitness is looking for a qualified person to oriented individuals. Must have clear speaking join our energetic friendly atmosphere. We are MORTGAGE LOAN liver meals for Take-Out Taxi. All shifts available. PROCESSOR Dupont Circle voice, ability to multi-task in a fast-paced envi- Must have own vehicle. Call 301-571-0111. located in Potomac, MD. Job will include Call Erin 202-797-9655 ronment. Some exper. preferred. Must be able to DRIVER washing towels & cleaning equipment. Evening Excellent opportunity available for experienced Admin Asst/Receptionist work eves & Sat. DFWP. 703-237-3400 ext. 256. Or hrs. Please call Wilma at (301)-229-0080, fax Loan Processor. Proficient with Calyx Point. Call Busy out patiant physical therapy prac. in Hyatsville email: [email protected]. TRACTOR TRAILER DRIVER 301-229-0085 or email: [email protected] 240-333-4580 for immediate consideration. wants an energetic, motivated, bilinugal Spanish/ CHEERLEADERS/MODELS/RING Class A, CDL License. 240-350-9466. LEGAL SEC/Rockville—Personal injury essential. OFFICE MANAGER English speaking indiv. Duties: Verifying insurance GIRLS —Wanted for all-expense paid Driver WP knowledge. [email protected] or FAX benes & sched. Fax or e-mail resume to 301-881-9465. Detail oriented individual with an accounting/book- 301-853-0096; campt@ camphysicaltherapy.com. Celebrity Myrtle Beach Bike Week Trip. Tractor Trailer Driver— Class A, CDL License. keeping background preferably with Quickbooks 240-535-8975. LOCKSMITH ADMINISTRATIVE No exp. Apply in person: experience to handle the accounting affairs of an Driver -Truck FedLock seeks ENTRY (will train) & EXPERIENCED established No.Va. wholesale/retail operation. Ex- Office-Answer Phones 9:15 p.m.-10:15 p.m. or call Over the road. Class A lic. 3yrs exp. 301-674-9949 TECHS. Installation/service, access control, 240-286-3660 or citing worldwide high-end customer based com- Schedule appts, maintain DRIVERS hardware, no auto. Great opportunity for pany experiencing significant growth, in need of customer database; Knowl- 301-568-8500 CDL DRIVERS for children in P.G. area. Must be at personal/professional growth, excellent edge of Metro area. Fax re- highly skilled individual. Excellent compensation least 25 yrs old. Clean MVR. Drug test & background salary/benefits. Company offers extensive & package and opportunity. Fax resume to: sume/info to (301)498-1704 Computers check req’d. $13-$15/hourly. Split shift. Fax resume: continuous training. Fax 703-525-1637, Michael. JAVA/J 2 EE Developer 703-991-6010 Advertising 301-441-8127 or call 301-441-8124. EOE Fort Mead or Annapolis jct MD. LS Poly req’d. Maintenance — For 74-unit garden apt. in River- OFFICE MANAGER—Great comp skills, Quickbooks Sales Assistant Resume to:[email protected] DRIVERS— Class A OTR, 3 yrs exper. & Class B. dale, Md. w/HVAC exp. preferred, turnovers, paint- & Excel. F-T, Arl VA, able to work alone. Call: Apply in Hyattsville. Position in Columbia, MD. Call Consulting ing, basic plumbing & electric. Fax resume to: 703-525-6888; Fax: 703-525-1243. New office opening in Washington, DC. Entry level 240-988-6438. 301-731-4859. for TV rep firm. Self starter; ability to multi-task; IHS International, LC, Drivers PRINTING—ABC Imaging is expanding its good people skills, heavy phones. Growth potential. provider of social and market research and Maintenance Tech/Engineer DRIVERS WANTED Needed in SE Washington, DC. 156 unit complex. operations! Visit us at www.telerepinc.com. Excellent benefits. consulting services for US companies interested in Immediate positions avail: Salary mid $20’s. Email resume to: investing or otherwise establishing relations with We are looking for exp drivers. Must have standard Must have exp. Please FAX resume to: [email protected] Chinese companies and government agencies, has transmission exp w/26ft box truck/ CDL pref’d but 202-561-8907. • ASST STORE MGRS or fax 703-528-7979 the following job openings in its Arlington, Virginia no req’d. Must have current MVR. We need prof. Maintenance Worker — Full time. Physical labor • PRESS OPERATORS office: Director of IT/Telecom Project Development: people to give our customers the BEST MOVE THEY required. Please call 703/247-1002 to schedule an • COPY OPERATORS appointment. Plan, direct, and coordinate financial management EVER HAD. We offer pay rates starting at $12/hr For more info see ARTS of projects. Direct Project Development staff and changing to $14/hr. DC North 301-735-3700/ Marketing Ad company. 6 Fun, Outgoing people www.abcimaging.com consultants in both the Virginia and Beijing offices. Alex 703-751-5700 needed to work in PR dept. M-F, 8-5, Great people or apply by sending resume to: PT Box Office Asst.: Flex sched. must accommodate Support research for projects. Assist in developing skills. Do you like to travel? Call today start tomor- [email protected] evening, weekend and some wkday hrs. 25-30hrs/wk. new clients and act as liaison with clients. Assist row 703-212-7525 Need organized, detail-oriented individual to answer with accuracy of specialized translations of DRIVING/LIMO - CDL w/P PROMOTERS ASSISTANT telephone and process box office ticket sales. B.A. materials. Frequent travel to China. Req: Fluency in PT eves & wknds. VA/DC/MD. $18-$20/hr. Spring- field 703-550-7200 Wanted for Gentleman’s Club, PG County w/own desirable w/ 1 yr. admin. exp., preferably box office or both English and Mandarin Chinese; MBA or MS in transport. Bonuses & commiss. 240-286-3660. theater. Knowl. of Word & Excel helpful. $10.50- Computer Science or Engineering. Contract and Psychology Assistant $11.25/hr. Send cv ltr and resume to FSL, Attn: Legal Affairs Manager: Lead legal and contractual HR/PTBox, 201 E. Capitol St., SE, WDC 20003-1094, Agency in Montgomery county is seeking F/T and support for projects. Support research for projects. P/T behavior specialist to provide behavior manage- email to [email protected] or visit our website at Assist developing new clients and act as liaison with www.folger.edu. No phone calls please. EOE Engineer ment services to people with developmental disabil- clients. Assist with accuracy of specialized ities. M/A or M/S in psychology required. Fax translations of materials. Frequent travel to China. Assistant NEW SKIES SATELLITES, Inc., resume to 301-762-5230 or apply online at Req: Fluency in both English and Mandarin Chinese; WASHINGTON MEDIAPORT [email protected] Personal assistant with accounting and office expe- LLM and/or Masterof Laws from Chinese law school. rience for builder developer must have computer Director of Research: Direct research staff and Ground Station Engineers: REAL ESTATE skills. Hourly pay negotiable. Please fax resume to consultants in both the Virginia and Beijing offices. Senior and Junior Levels VA Real Estate Buyer Agents (202) 362-2870 or e-mail to: [email protected] Lead research in support of specialized projects and clients, including telecommunications clients. Reports to: Mediaport Manager, Bristow, VA Auto Mechanic — Limo FT wknds. $15. Must know FT/PT. Buyer’s leads provided. John Elkins, Gold Assist with the development of research proposals Agent Real Estate, LLC, 703-930-7166. Lorton VA. bf 703-550-7200 and reports for specialized projects. Perform Responsibilities: • Perform shift duties as required. RECEPTIONIST— For hair salon in Vienna. specialized translations of materials. Frequent 703-242-7500 AUTO SALES travel to China. Req: Fluency in both English and • Installs, tests and configures all station hardware and software from the modem through the antenna Mandarin Chinese; MS in Telecommunications. Fax, feed. Provide 24/7 on-call support to the Network Operations Center. Receptionist send, or email cover letter and resume to • Coordinate carrier activations with the NSS Payload Operations Center. Provide weekly status reports to [email protected] management; Maintain accurate set of station drawings. Perform shipping and receiving functions; Level A Unique Fitness Club in Potomac, MD is COURIER-BIKE/ Perform maintenance of all station hardware as required by the PM schedule. seeking FT/PT energetic person to join our team. OFFICE ASST/ Must be dependable, friendly, organized and posses Qualifications : some computer skills. Please call Wilma at DARCARS Automotive Group, one of the $8.50/Hr. Apply in person Mon-Fri. 8am-11am. 1323 R.I. Ave NW, DC. Senior Level (301)-229-0080, fax 301-229-0085 or email: region’s fastest growing auto organizations, is • Degree at Associates or Bachelors level in satellite engineering, communications , electronic engineering [email protected] seeking highly motivated, customer friendly DANCERS— Wanted for Gentleman’s Club (PG people to join our sales team! No experience County). $300-$500/night. No exp. needed. or equivalent military or commercial experience. RESTAURANT necessary — we provide one of the top training 240-286-3660 or 301-568-8500 • Minimum of 6-10 years experience in RF engineering or in the satellite communications field with programs in the industry! We offer: teleport operations. Executive Chef & • $80K+ 1st yr earning potential Daycare Assistant—Home-based daycare needs • Good knowledge of microwave and satellite techniques and the ability to troubleshoot at system level Sous Chefs • Company car & paid vacation assistant, FT, with infants & toddlers. Legal & using various test equipment such as digital o’scopes, spectrum analyzers and Firebird 6000. • Health insur & 401K bilingual in Spanish. Own transportation. Effective leaders, capable of producing results with • Rapid advancement into mgmt 703-827-2646 or 703-597-2865. Junior Level • Degree at Associates level in satellite engineering, communications, electronic engineering or minimum of 3 years management experience, Apply in person with Shannon Ryan, Mon thru Fri, DENTAL FRONT DESK/ADMINISTRATOR strong culinary skills and high volume experience. 9:30am-6pm at DARCARS of Silver Spring Customer service & office exp. pref’d. Will train right equivalent military or commercial experience. Positive management style and proven leadership 12214 Cherry Hill Rd, Silver Spring, MD; call person. Must be highly dependable w/good work • Minimum of 3 years experience in RF engineering or in the satellite communications field with skills are required. Understanding of food cost, 301-622-0020 or email [email protected] ethic. Solo practice, downtown nr. Metro. teleport operations. inventory and payroll controls, basic computer skills Pls. lv. msg. 703-585-8393. • Good knowledge of microwave and satellite techniques and the ability to troubleshoot at system necessary. Culinary degree and Spanish proficiency AUTOMOTIVE—Very busy service station in No VA DENTAL HYGIENIST - P/T level using various test equipment such as digital o’scopes, spectrum analyzers and Firebird 6000. are helpful. Commitment and ability to grow looking for Service Manager. 5 yrs exp. $60k guar. + Needed 2-3 days/week (Tues-Fri) in general practice nationally with company. Send resume to: 6842 Elm Commis. Call Zafar 571-243-8800 or fax: near American Univ. DC license is required. Call Resumes to: [email protected] Street, Ste. 207, McLean, VA 22101 or 703-670-8602 202-244-1601. [email protected] F43=4B30Hk " ! %k4G?A4BBk!$ Classifieds

Restaurant Security Restaurant TELEMARKETING Armed DHS/GSA Security Officers JOBS Entry Level Bar/Waitstaff Needed Earn up to $25/hr. NOVO1 is looking for highly Restaurant Manager For DC locations. Must possess valid A1 certification skilled, exper’d inside sales reps to market for $15/hr+tips & suitability, be US citizen (no exceptions), with Fortune 100 co. FT/PT. Great working environment, RESTAURANT Effective leaders with positive management style good work ethics. All shifts. $20+ p.h. to start. Call Laurel, MD. Call 301-361-1111, ask for Mark. SERVERS/BARTENDER and proven leadership skills. Minimum one year Apply in person Mon-Fri., 10am-3pm, 202-293-8011 or fax resume: Needed for busy downtown Italian rest. exp. req’d. 150 S. Washington St., #201 TELEMARKETING experience in fine dining restaurant management. 202-293-1095. RainSoft 202-289-7300. Wine and culinary knowledge, high volume ex- Falls Church, VA 22046 Security & Guest Services Is expanding in our Laurel office. Need experienced perience, basic computer skills essential. Ability to Email for more info: Outbound Pros. Day + evening shifts available for grow nationally with company. Send resume to: TYSONS CORNER CENTER RESTAURANT [email protected] surveyors & setters. Hourly scale + demo bonus + 6842 Elm Street, Ste 207, McLean, VA 22101 or Tux Req’d install bonus = GREAT PAY! Immediate interviews HOST STAFF [email protected] Seeking F/T Security Officers & Guest Service Needed for busy downtown Italian rest. Restaurant Representatives. Must be 18. Have valid drivers for immediate openings. Call Mr. Cash 202-289-7300. Camille’s Sidewalk Cafe, Arlington, VA, is hiring for license, basic knowledge of computers & high 301-490-7778. all positions. Call 301-332-8600. level of customer svc. skills. Contact Kim Hart at RESTAURANT 703-893-9403 or EMAIL at: TRAVEL AGENTS NEEDED Kitchen/Sushi Helper. PT lunch & Dinner. N Arl. [email protected] Work from home. No exp nec. 703-534-6000 Training included. Call 301-352-7330. RESTAURANT SECURITY VET/RECEPTIONIST M-F, with alternating Sats. FT/PT. $9-12/hr. Exp Odyssey Cruises now hiring all positions: Servers, OFFICERS NEEDED pref’d. Apply in person, 2935 Chain Bridge Rd, Server Assistants, Bartenders, Cooks, Dishwashers, Hiring for residential areas in No. VA. Night Oakton, VA. Hosts and Marine Crew. Applications accepted positions avail. Benefits & training. Call Monday-Friday beginning February 27th thru Friday Amber at Security Associates, 703-257-0292 CAREER TRAINING AND March 10th between 10-3; also Wednesday March 1st and 8th 6-8pm; Applications also online at TELEMARKETING EMPLOYMENT SERVICES www.jobflash.com/pyi or by phone 877-409-6460 RainSoft Odyssey Cruises located at Gang Plank Marina, 600 Is expanding in our Laurel office. Need experienced Water St. SW located near The Waterfront Metro Outbound Pros. Day + evening shifts available for Greenline. Equal Opportunity Employer Surveyors & Setters. Hourly scale + demo bonus + A Bar Career SALES install bonus = GREAT PAY! Immediate interviews In 1-2 Weeks for immediate openings. Call Mr. Cash • Days, Evenings & Weekend Classes A RARE OPPORTUNITY 301-490-7778. • Free Lifetime Personalized Job Placement CAREER TRAINING AND • Approved by the State of MD Prosperous NoVA/MD Company in the home im- • National Alcohol Awareness Certificate (T.I.P.S.) provement industry is expanding. Prior industry EMPLOYMENT SERVICES Call for nearest location 1-866-411-2MIX experience not necessary but welcome. Profes- www.authenticbartending.com sional training program provided. Someone who needs at least $65,000 per year with the potential of six figures. Commission, Incentive and bonus. Car Required. No overnight travel. Call Brian Quick between 9am and 3pm @ 301-560-6920 SALES — Leaf Guard of Maryland looking to expand sales force need 1 FT or 2 P/T in-home closers. Very generous compensation plan. Great product and proven sales system. Metro area/Baltimore, No. VA and Montgomery County. To be considered for this excellent opportunity call 410-774-2000 or fax resume 410-774-2008. EOE SALES Spirit Cruises, LLC is the nation’s largest harbor dining cruise company with multiple brands. We are currently seeking an ACCOUNT MANAGER & a SALES ASSOCIATE for our Washington DC sales operation to drive sales & create more awareness of our products in the DC market place for the assigned market segment. To apply submit (1) cover letter, (2) resume, and (3) salary requirements, noting the reference code in the subject line, to the contact listed below. Willing to train entry level sales reps. Please note that resumes without salary requirements will not be considered. [email protected] Visit us on the web at www.spiritcruises.com Security Guards— PT on-call Sec Grds needed for special events. Clean backgrd, drug free. Must be 21. Weekly pay, & shift 3-11, 11-7. Fax res to: 301-265-9866, on-line app www.ppssvc.com, or apply in person 1050 17th St NW suite 600 Wash, DC. 20036 Between 9AM-4PM. Security D.C. ARMED SPO’s for premier DC locations. Must possess valid DC Armed SPO commission (no exceptions), pass background check, be team player, w/good work atten- dance & ethics. Long-term assignments. FT/PT. Call Mon-Fri, 10AM-3PM, 202-293-8011, or fax resume: 202-293-1095. !%k4G?A4BBk " ! %kF43=4B30H Classifieds

Queen MCI Mar 9—Sec 105 Row G. Face Value ALEX —2BR, 2BA, $1550, spac LR & kit, nr bus, BEALETON—Brand new 4BR, 3½BA SFH, frpl, fin CAREER TRAINING AND Train To Become $88/OBO. (703) 426-8047 TSR-2006 @hotmail.com. Metro & shops, storage & balc w/d in unit, bsmt, St Stl appls, 2-car gar, wood flrs, Crosses Rte NOTARY REPUBLIC AT HOME Rockville—9504 Viers Dr Sat 3/4 9am-1pm. Collect- 703-731-9154. 17 & 29. $1900. 571-259-1767 EMPLOYMENT SERVICES www.greaterskills.com Toll Free 866-253-3257 ibles, Art, Furn, toys, books, crafts, hhold ALEX—Bsmt apt for rent. Nr Metro! Close to BELTSVILLE/COLLEGE PK—2BR, 2 BA, newly renov, Vintage Ring—10 ct Sapphire/white Sapphire la- everything! $900/mo incl utils. Avail now. hdwd flr, w/d. $1350. Call Alvin 301 613-5999 All Computer Classes $295 TRAIN TO BECOME A dies ring, USGL Certified, Appraises $11240, accept 703-370-0745 Beltsville PC Repair Admin Asst. Bookkeeping $5548 OBO ALEX — Cape cod house. 3BR, 2 BA, great loc, close For Beginners & More 301-942-8724 SECURITY SPECIALIST LIGHTHOUSE@ TWIN LAKES 301-537-3065 to DC, Old Town, Ft Belvior and Potomac River. Great Location, Amenities COMPUTER TRAINING AT PARKS COLLEGE Woodbridge 3/4-3/5 9a-5p —Like-New 42” Sony $2000/mo. 571-220-4720 and Service! Pets Welcome TV, furn. + more. 14110 Bay Vista Dr. # 302 (703) ALEX/LANDMARK $1050 A+, NET+, SECURITY+, CCNA & MICROSOFT OFFICE Graduate in less time than you think! 618-8419 for info. 1-888-604-5684 Updated 1 BR penthse, fresh paint, new carpet. Utils www.aimco.com/025031 SUITE. FIRST FIVE STUDENTS TO REGISTER FOR incl’d. Pool, partyrm, assigned prkg. Vacant. A+ WILL GET FREE COMPUTER, FIRST 5 Tysons Corner Campus Call Joan, 703-960-6168, Jobin Realty. BETHESDA 4906 MAPLE AVE $3400/MO STUDENTS TO REGISTER FOR CCNA WILL GET SALES & AUCTION Arts & Crafts style home walking distance to all of FREE CISCO ROUTER. CLASSES EVENING OR WEEK- 1430 Spring Hill Rd, Suite 200 ALEX—M/F non-smoking prof. shr house walking dwntwn NIH & Metro. 2BR, 1BA+ Mstrsuite up. Great END. 301-459-6870 McLean, VA 22102 distance to Metro. Lots of storage. No pets. $800 kit. Joel Martin 202-274-1882. RE/MAX Allegiance E-BAY SELLER SERVICE includes all. 703-587-4118. BETHESDA—Brand New state-of-the apartment Arlington Campus Reliable and Reasonable. ALEX—Nice 3BR 2BA TH w/fin bsmt, sm fenced homes with all the luxury amenities you’ve been 801 N Quincy, Suite 500 We do all the work! Call Joe or David backyd, WW carp, CAC. Excel loc! Only 5 mins to looking for. Studio, 1BR, 1BR/den, 2BRs 301-595-3001 202-494-5023. Pentagon/Crystal City/Olde Towne & 10 mins to DC! CABLE & HI-SPEED INTERNET Arlington, VA 22203 PUBLIC AUCTION + Pvt PKG! Pet ok. $1650 + utils. 703-921-1940 Sauls Lithograph Co. Inc. ALEX/OLD TOWN—1BR/1BA condo, fully furn. ROSEDALE PARK CALL: 866-300-9344 TUES, MARCH 14 AT 11AM $1650+utils. 703-683-1349 420 Rosedale Avenue Adkey NPEX625E 2424 Evarts St. NE ALEX SO.—Totally renov. 2BR/1BA TH, fin bsmt, new 301-657-4800 Washington, DC 20018 kit & Bath. $1350/mo. 6801 Kenyon Dr. BOWIE—2BR, 2BA in Bowie Town Ctr $1500 Call Olu BUSINESS AND Harris (2) color heat set web press, Cymbolic 703-780-4533 @ 240-305-8888 Platejet 8, McCain 7 pocket saddle stitch & trim, ALEXANDRIA BOWIE—3-BR 3½-BA TH, available now. $2000+ FINANCIAL OPPORTUNITIES drills, shrink wrappers, Lawson paper cutters, film AFFORDABLE LUXURY! 301-523-9361 processors, folders, Macs & HP’s, pallet jacks, vans, BOWIE—3BR/2½BA 2 lvl + fin. bsmt TH equip. 100% INVESTOR FINANCING truck, air compressors, office furniture and much 1 BRs fr $895 2BR fr $985 w/marbl fpl, ac, laundry rm, w/w crpt. No pets. No income required. 877-548-0721 more. 3BR from $1415 $1750, utils not incl. 443-271-1966 Info: 410-876-8210 BOWIE—Beaut. spac. 2-BR 2-BA, 2 yr young, 3rd flr, e-usmortgagefinancecorp.com www.americanaai.com Washington Square elevator condo, in sought-after Bowie Town Center. Absolutely No Upfront Costs AMERICAN AUCTIONS & 1-877-437-2395 $1600. Owner 443-271-0430 or Monthly Payments! APPRAISALS, INC. Alexandria—Belle Haven Hilltop-$2350, Renovated BOWIE RENT TO OWN Plaintiffs Turn Your LAWSUIT into 3+2.5 plus office, wood floors, large yd, w/d, 6219 3BR, 2½BA, 3 lvl TH. $5000 down. Call TICKETS Tally Ho Ln 703-861-4131. 703-625-0275. Agent. Free Money Before Settlement, Alexandria City/Rt 1 CAP HTS—Lg. 4BR SFH w/cac, carpet, updtd kit, Trial or Appeal 877-227-4285 Highrise, Garden Apts & Twnhms w/d, d/w, near schools/shops. Sec. 8 Welc. $1850 + MAKE $5-$10K EXTRA A MONTH NATIONALS*WIZARDS*CAPITALS Numerous Amenities! util. 301-430-0267 Preventing Forclosures! Attend FREE Upcoming BON JOVI*BILLY JOEL*QUEEN CENTREVILLE—Bsmt for rent w/BR, FB, $650. Seminar 1-800-290-3269 *SPECIAL Loc: Lee Hwy, close Stone Rd. 703-830-6614; www.foreclosuresolutionsgroup.com 301-985-6250 Move-in by 3/31/06 703-408-1506 www.greatseats.com $275 Move-in Credit CENTREVILLE—New TH, never lived-in, 2MBR, 3FB, NCAA BASKETBALL EAST REGIONAL TICKETS 1 car gar, close to everything. $1980. 571-237-9179. STUFF —March 24 & 26 at MCI Center. Great corner seats. 4th Mo Rent 1/2 Credit CENTREVL—2 LVL APT IN TH, 3BR, 2 full shwrs/ 800-739-0339 Carydale East 703-751-7576 ½BA, hdwd flr, 2 prkng spots, pvt laund. rm., *Holly Court 703-765-7039 $1400+1mo. dep.+utls. Avl. now. 703-625-6334. 6 ft Air Hockey Table—Execellent condition, great CHANTILLY—Lg. UNIQUE furn. guest hse on lg est, fun for family! $100 703-655-5788 *Rolling Hills 703-780-0161 PETS *Carydale Village 703-780-6244 wireless, w/d. Military & TDY disc. $1195. A/OFC FURN. LIQUIDATION *Washington Avenue 703-765-7039 703-266-1516 Won’t Last! Hurry Feb 27-March 4 Children’s Hospital Area ADOPT A CAT/KITTEN VET CHECKED NEW & USED 30-50% OFF www.carydale.com DISCOVER THE BEST IN DOWNTOWN LIVING! Call Feline Foundation. Alexandria EHO Walk to Brookland Metro, Deli/Market & Services • Desks, Credenzas 703-920-8665 www.ffgw.org • Flat File, Chairs, Fire Safes RENT SPECIALS! HUGE 1,2 & 3 BR FLOORPLANS • File Cabinets, Reception Units Havenese—3 lovable (F) no shed beauties, ador- Call for details THE CLOISTERS (877) 879-5376 • Bookcases and much more able fluff balls, no shed, 8 wks old ready 03/11/06 Breathtaking 1 & 2 BR $1900.00 Sire: AKC reg. (703) 920-6980 Apartment Homes From $989 Children’s Hospital Area Open 9:00 AM - 5:30 PM, Mon-Sat POODLE—1 Dark Red Minis Puppies, Male, all shots, 7200-A Fullerton Rd. Springfield, VA 22150. Call us ParcView Apartments WALK TO METRO! AKC, $800. 703-924-0378 703-485-4148 703-455-5500. POODLE/STANDARD—AKC, great ped., sweet, • Easy access to Brookland Metro Visit us @ WWW.COFOVA.COM M-F 8-5; Sat 10-5; Sun 12-5 • Individual washers & dryers, kitchen w/breakfast trained, guar. healthy. Call 804-761-6603 . amar- *Restrictions Apply, Call for details [email protected] nook and microwave ALL WINTER SALE ALEXANDRIA FOXCHASE • Short term & furnished available ROTTWEILERS—AKC,German Pups,MC/VI. Alexandria’s Finest loaded w/amenities. Great Bargains All Winter! Bigrotts.com 703-867-1881 THE HEIGHTS 877-879-8977 New PCs from $399. Used PCs from $99. CALL TODAY 888-296-0863 COLLEGE PARK EHO Laptops from $199. MACS from $199. www.foxchaseapts.com UNIVERSITY GARDENS Trade in your PC or MAC for something newer. EQUAL HOUSING AIMCO EHO We also do full-service and repair. Great for Students! Alexandria Practical Computer 703-321-3003 OPPORTUNITY • HUGE BALCONIES Bad Credit Chapter 13 & 7 RIVERSIDE • Spacious closets All advertisements for the sale or INCREDIBLE RATES • 2 swimming pools Approval Purchase Refi. DC/MD/VA • Shuttle bus to UMD in community rental of dwelling units published in INCREDIBLE LOCATION • Small pets okay! Global Mortgage Express are subject to the federal INCREDIBLE VALUE & SERVICE! 877-316-6285 1-866-393-1300 Fair Housing Act, which makes it (888) 592-0159 1801 Jasmin Terr, Adelphi ***BAD/NEGATIVE CREDIT illegal to advertise “any preference, ALEXANDRIA SOUTHERN TOWERS CRYSTAL CITY/Potomac Yard 1BR Apts Studio Special All utils incl w/Cable TV, nr Metro, shops & rests. Remove from Credit Report limitation, or discrimination be- from $725* Free prkg. Short term lease - min 3 months. 1BR cause of race, color, religion, sex, Unfurn $1200; Furn $1300. 703-979-3772. Call 202-775-6932 No Security Dep. or Move-In Fees Downtown City Living at its best.. BD $130—Full matt set Brand new in manuf handicap, familial status or national All Utilities Included StepstoMetro plastic Can dlvr 301-343-8630 origin, or intention to make any 703-485-4154 Restaurants, Museums, and more BD $140 Qn Dbl pillowtop matt set new in plastic Virginia Mgmt Inc *Subj to Change such preference, limitation, or dis- ALEXANDRIA, VA EHO Newly renovated! Free Gated Parking. Rich Berber Can del 301-399-7870 Carpet, A/C, laundry. EHO BD $250 Double pllwtop king matt set New in crimination.” State law forbids dis- KINGS GARDEN plasticCan del 301-343-8630 • Walk to Schools, shopping, and Huntington Metro 2BR from $1430 BDRM 8PC-Cherry slgh bd set, $595, New-box. crimination based on factors in • Floor to ceiling windows Washington Apartments 3/343-8630, 7/263-7888. addition to those protected under • Walk-in Closets 202-737-2206 1201 6th Street NW • Balconies or Patios DUMFRIES—New lux TH, 3BR, 2 car gar. end-unit, TRAIN FOR A CAREER IN BEDS federal law. 877-317-0279 frplc, right off 95. NS/no pets. $1700. $500 off 1st CRIMINAL JUSTICE AT Used in Great Condition Express will not knowingly ac- 6300 South Kings Hwy month. 703-801-5100 TWIN SETS -- QUEEN SETS ANNADALE EHO Dupont Circle—Large one bedroom,fully furnished, cept any advertising for real available immediately. Walking distance to Metro.- PARKS COLLEGE -- KING SETS -- The Parliments Rent all inclusive.Call 301-275-5530. No high school diploma or GED? estate which is in violation of Right off the Beltway! DUPONT CIRCLE FROM $129 • Rents from $930 inc utils We have options! MD 301.324.8684 301.468.6443 the law. All persons are hereby • Park-like setting THE CHASTLETON informed that all dwellings ad- • Wall-to-wall carpet Tysons Corner Campus BALTIMORE 410.719.6922 Walk to Shops/Restaurants VA 703.818.2678 703.354.2600 vertised are available on an • Enourmous Balconies Near Dupont Metro 1430 Spring Hill Road, Suite 200 • Huge living rooms Studios from $1227 McLean, VA 22102 CORT FURNITURE equal opportunity basis. • Minutes to metro 1BR from $1370* Couch+loveseat+Chair(microfiber)-New in boxes 877-316-6297 2BR from $2272 Inc Utils* Arlington Campus $575. 301-343-8630 Aquia/Stafford—Renters Dream! Brand new 3 BR + 866-438-1277 D&F HOUSEKEEPING SERVICE 2 Bonus Rms, 3.5 Bath, 3 lvl TH. Near I-95. Military & DUPONT CIRCLE— Elegant Lg, 1BR, Total Remodel, 801 N Quincy, Suite 500 We do Commercial and Residual service. Pets welcome. $1700/mth. 571-265-7778 fab sunset 8th flr. Roof pool, sec bldg. Kit opens to Lg Arlington, VA 22203 301-459-8531 ARL/BALLSTON—Efficiency Garage Apt. $990 mo. DR across bkfst bar. New, self clean oven, auto-ice Elliptical Trainer—Professional quality. Paid $1900 Call 703-921-2202 mkr, dble sink, 1 blk to Metro $1850/m util incl. CALL: 866-698-9973 new. Sacrifice $400 Come test it out! 703-655-5788 ARL/Ballston Metro—Shr house. 1 BR, $595+utls 202-362-1222 / 202-421-3621 FLAT FILE CABINETS & FIRE SAFES-Call u Adkey NPEX625G or 2 Rms for 1 person w/prvt BA, $795+utl. FAIRFAX $1350/mo 703-455-5500, www.cofova.com. 703-599-7572 5 Room Condo (could be furn). GRANITE COUNTERTOPS SALE ARL N—-walking distance to Metro & shopping. PMA Inc, Call Oscar, 703-622-4340. MARTH 4TH - ONE DAY SALE Close to Key Bridge & Rt. 66. 2 BR’s, $1350, all utils & FAIRFAX— Male to shr SFH! $650 per mo, includes TRAIN TO BECOME A $23/per sq ft. 301-627-7630 RENTALS prkg incl.1 year lse. No dogs. 703-527-1991 many extras, very big room, N/S, N/P.703-277-9551 MEDICAL ASSISTANT AT Great color selection! FAIRFAX—Walk to Dunn Loring Metro. New lux GUITARS—Gibson ES335, natural finish, $2000/ ARLINGTON AWAITS! 1-BR. All amens, Pkng, $1295. 240-417-6093 agnt Eff fr $840 1BR fr $940 2BR fr $1190 PARKS COLLEGE OBO. Fender Telecaster, ’52 re-issue $900/OBO. 16th and L, NW $3200 FORESTVILLE—1BR from $819; 2BRs $954- wash/ No high school diploma or GED? Gretsch Tennessee Rose $1600/OBO. 301-253-3404 Fantastic Downtown Location All Utilities Included! dry, CAC, dw, w/w carpet, call 301-735-2322 Park- MATTRESS SALE—lge selec 3BR/2BA, 1,300sf ‘The Presidential‘ as shown in Mins from 395, near Pentagon City land Village. We have options! tion, all szs in plastic, $80-$280/Basic, Serta & ‘Best Addresses‘ Metro 2blks 202-393-2376. & Baileys Xroads, Swimming Pool , Pet Friendly (up to 25lbs), and FORESTVILLE— Nice 4BR home. $1850. Simmons. Make ofr Credit cards accepted. Warr. 3060 30th Street SE $1300 301-843-0331, 301-399-1457. 3Br Apartment Millitary Discounts! Tysons Corner Campus DC/MD/VA Same Day Delivery avl. A.J. 301-674-2843 Fort Washington EHO 1430 Spring Hill Road, Suite 200 www.mattress4less.biz Newly Renovated 3Br 1bath apartments. Section 8 CHESTERFIELD HOUSE MATTRESSES—(100). ALL SIZES. As low as $40. OK. Call Jerome 202 321 5596 1-877-437-2393 ASHFORD AT HENSON CREEK McLean, VA 22102 1356 Langley Way, Hyattsvl, MD. 240-421-5525 ALEX—1, 2, & 3 BR apartments available. Immedi- Arlington/Rosslyn Several Locations 1 BRs start at $824 P3 LAPTOPS With CD $249 ate occupancy. 1 mo. free rent. Call 703-370-6080 SPECIAL: MOVE IN BY 4/1/06 Ask about the spectacular savings on our unique Arlington Campus P3 DESKTOPS WITH 17” $59 ALEX—1BR new condo. Garage. Min. to Metro, 395, & GET 4TH MONTH FREE! ‘Signature Series‘, Spacious floorplans w/walk-in 801 N Quincy, Suite 500 www.PCRETRO.com 495. $1150 mo. 703-823-3923. On-Site Parking, Walk Metro closets, eat-in kitchens (avail), dishwashers. Min- Arlington, VA 22203 VA: 703-821-1400 MD: 301-931-6630 ALEX— 2 BRs avl in TH. Cls to 95, 495 & Van Dorn Upgraded Apts, 1&2BRs utes to downtown DC & AAFB. PIANO - One Price Clearance — $1399 (orig $2300 Metro. $650 & $450/mo. 703-395-8903; 703-671-4045 or 703-861-7605 Call today! 1-888-202-4586 www.carydale.com CALL: 866-300-9340 up), $1899 (orig. $2800 up), $2499 (orig. $3700 up). 703-463-4066. 75 pianos to chse frm. 1 wk only.10135 Colvin Run ALEX—2BR, 1 full BA condo, $1250 mo, Section 8 ok AU/WESLEY HGTS—2BR, 2BA, 1500 s.f., wdws Adkey NPEX625F Rd. Great Falls. 703-438-8840, M-Sa 11-7, Su 1-5. Call 703-508-2139 ovrlkng prk, $2400/incls utls. Call 202-483-1537 F43=4B30Hk " ! %k4G?A4BBk!& Classifieds

LAUREL PARK OXON HILL EHO SILVER SPRING—Beautiful 3 lvl TH, 3BR, 2FBA,- 2HBA,lg wlk out bsmt, hrwd flrs. $2300/mo. Great for DC/Baltimore Commuters! Studio from $670 1BR fr $750 RENTALS 2BR fr $870 3BR fr $1120 240-643-7627 SUMMER RENTALS • Mins from 95 & Rt1 Silver Spring EHO • Rents from $770 5% Milliatry & Fed Gov’t Discount, Instant Approv- FORESTVILLE EHO • Swimming Pool als/Move-ins, Plush Carpet, Central Air/Heat, Free Forest Park Apartments LEWES, DE—3.28 ac. 200 ft. water frontage on Love 1BR from $630 • Balconies or Terraces after-school program, Metro Access ‘A great place to live‘ Creek with 300 ft. pier with dock. Asking $575K. Call • Cats Welcome PARK FOREST 625 Audrey Lane Kathy at Crowley Assoc., 800-242-4213/office; 302- 2BR from $755 800-880-3923 • Beatifully wooded landscape 245-8574/cell. 3BR from $955 877-584-6151 OXON HILL EHO • Controlled access A Southern Management Community SOUTHVIEW • Mid-rise elevator bldg Near Bus/Metro/Shopping • Laundry on every floor ROOMMATES Student/Millitary Discounts LAUREL • Balconies & Patio So Spacious - up to 1200sf • Modern Kitchen • Wall-to-Wall Carpet 1-877-227-2890 • Spacious Bedrooms • Free Shuttle Bus ALEX—2-BR apt. to share. 7511 Snowpea Ct. MBR FREDERICK/Nr. Ballenger Crk—3BR/2BA, N/S. 1BR from $820, 2BR fr $960 • 2 swimming pools • Pools, playgrounds, bball court $1300. 201-232-8442 3BR from $1265 • Much, Much more! w/pvt BA $710. Living Room fully furn. Close to 877-316-6303 shopping malls. AVAILABLE NOW 202-329-9285 FT. DUPONT PK—4201 D ST SE Renov. 1BR’s Millitary Discounts BRING THIS AD IN FOR A Southern Management Community CAP HGTS — Share house, wlk to Metro, shr Kitc & w/cac/heat, w/d, hdwd flrs. Nr Metro $725 + util. PETWORTH—2BR 1st flr apt newly decorated WAIVED APPLICATION FEE! 301-430-0267 LAUREL SQUARE BA, Cable, 2 rms $125-150/wk. Call 202-330-9416. $991/mo + cooking gas & elec. Call 202-889-0179 Please call 301-434-8727 COLLEGE PARK—5 min. ride to Metro. BR avail for FT WASH—end unit TH, 3-BR 2.5-BA, LR, DR, fin. 1-877-227-2883 RESTON bsmt. w/4th BR w/pvt BA, avail. 4/1/06. $1800+utils. MANASSAS EHO SILVER SPRING TOWERS female in bsmt of TH. Free utils, cable, net. $400. REFINED LIVING! 240-383-7448 Shown by appt. only 301-248-7779 END OF WINTER SAVINGS! Up to 1560sf! Great location off the Tollway and The Perfect Location! ,$1,- Falls Ch/Merrifield—$675. F shr TH nr I495/66/ Ft. Washington—2BR/1BA condo, near metro mins to Reston Town Center. Small pets welcome. FREE UTILITIES 50/29 & Gallows. Prf UScitzn. 703 573-3855. 100/mo utils incl, no pets. Please call 240-381-2155 1BR from $895 1BR from $1030 Just a few steps from the Silver Spring Metro; [email protected] 2BR from $1070 3BR from $1340 2BR from $1205 GAITH SALE/RENT W/OPTION All Utilities Included walking distance to 2 new shopping centers, the AFI LORTON—Beautiful 3LVL TH w/4BR avail. 3½BA. 3BR from $1480 Silver Theater, the Discovery Channel building; and Brand New Luxury TH/Condo. Never Lived In COVERSTONE All UTILITIES INCLUDED From $600/ea BR 703-929-0268/703-928-5845 Brick End Unit. —3BR, 2½ ba, 2 fin. lvls., lux. soon-to-be neighbors with a brand new health club SE/2805 JASPER ST.—Prof to shr newly renov. 1-877-437-2384 Winterthur 877-437-2383 and Borders Books - you couldnt ask for a better MBR/BA, garage, deck, hdwd. floors, cherry kitchen, www.rimsi.com RESTON—Rent to Own/Lease Purchase. $1350. condo. Metro. Shopping. Fully furn’d. Jacuzzi tub, upgraded appliances, fireplace, recessed lighting. spot! w/d, all utils. Cable TV, phone, secured bldg.Exc Manassas- Shr 3MBR TH. Cln, wlk shppg. Mall, 2BR condo w/ fpl & balc. Walk Reston Town Center. 877-220-7136 Brian Re/Max 2000, 301-996-9695 hosp, 66/28. N/S, N/P, $650/$750+utls incl Call Marie Re/Max Distinctive. 703-749-0416 ext 54 neighbd. $175-$300/wk. Call 202-678-1101 SE/SOUTHERN AVE—Shr furn hse. Nr Metro/shop- Pics: www.ListOrBuyHomes.com 703-863-9023 RESTON TOWN CENTER — Luxury new 1 BR condo. A Southern Mgmt. Community [email protected] MINNESOTA AVE, SE—Cozy 1 bd room, recently SOUTHWEST EHO ping. W/D, cable, telephone. $165/wk. $1390. 703-932-1480 202-373-9464 Gaithersburg EHO remodeled. MUST HAVE RENTAL HISTORY. $675.00. RIVERDALE—2BR Specials, w/w crpt, balcony, laun- EAGLE’S CROSSING 202-561-7070 Great Location near Showings by appointment only. Call 240-464-1983 SPGFLD—Shr. 4BR, 2½ ba. house, w/d, fncd. bkyd., dry, d/w, hdwd flrs, close to Metro. From, GREAT PRICE • GREAT LOCATION! patio rm., cac. Wlk Metro. $130/wk. 703-971-9353 Rio, Metro, & I-270! NE—3 BR, 2 bath full bsmt: 1230 Farraday Pl. NE $925+electric. Also efficiency starting at $650 + UPPER MARLBORO—M/F share condo, Near 1BR from $765 $1,550. + util and 2005 Evarts St NE $1,750. + util electric. 6747 RIVERDALE ROAD DELWIN REALTY Call About Our Specials!! Home Realty, Inc. 202 547-7895 301-577-7917 1 AND 2 BEDROOM APTS. metro, Private large BR w/BA. No smoking. 2BR from $950 3BR from $1210 $695 utilities included. 301-442-2504 NE/917 19th St—1BR, LR, nr shopping mall. For RIVERDALE —4BR, 1½BA SFH. $1650+uts Avl now. An Edmondson & Gallagher Community Spacious Apts - to 1300sf, AC WALDORF—3BR 1½BA 2LVL TH. Like new applcs! Scenic Balconies, Pool info. 202 547-7895 202-421-3514; 301-277-7277, Byrd’s Real Estate SPGFLD—Huge furnished 1BR bsmt apt. Separate N.E. 922 6th St. N.E. —4BR, 1FBA, w/w carpet, entr., hdwd floors & crptg, fplce, kitchen, laundry, W-W carp. W/D. Backyd w/deck. Great neighbor- Mill Creek Gardens Riverdale hood! $1350 + utils. Housing voucher welcome. 17654 Amity Way 1-866-600-4369 $2000+utils. hot tub, patio, parking. Upscale nghbd. $1200. N.W. 624 Otis Place N.W.—3BR, 1½BA, full bsmt, FLETCHERS FIELD 571-265-2970 202-543-2905 Gaithersburg/Rockville $800 CAC, $2000+uts. 301-466-7026 STAFFORD — 3 level renovated THs, 3BR, $1425.- WALDORF—TH. Avail now, 1800 s.f. 3BR, 2½BA, Shr 2 BR/2 BA condo 866-805-0782 MBR w/ vaulted ceilings, fin bsmt., 1 car gar, deck, NE—Behind Stadium by Armory Metro. 2BR apts ALL UTILITIES INCLUDED. Spacious, Modern Apart- $1450/mo. 703-628-3075 All utls incl Call 410-708-9686 $825+utils are avail. Newly remodeled. Nice secure fncd-in yd, sec sys., 40 min frm DC/VA & Pax River. GAITHS/ROCKVILLE—1&2LgBRs.Wonderful 1BR ments Minutes to University of Maryland and DC SUITLAND A Great Place to Call Home! $1600/mo. Call 202-236-3291. quiet bldg. Manager: 202-388-1631 DIRECTLY ACROSS THE STREET FROM METRO! Specials start at $900; wlk in closets,eat in kit, balcs. Riverdale NE DC/1609 E St—1BR/den. avail now CAC. nr FREE PARKING! Nr park, grocery, restau,shops. Also furn w/linens, Hechinger Mall. $725/mo + utils/sec dep. PARKVIEW GARDENS 1 & 2 BR fr. $695. All utils. included! dishes & microw. 2BR start at $1100 301-948-0087. CONDOS FOR SALE 703-451-0595 888-251-1872 100% Renovated units available! HYATTSVILLE EHO NE DC—3BR, 2FBA, remodeled house in quiet Lily 1,2 & 3 Bedrm Apts. & Huge 2 Bedrm Townhomes SILVER HILL APTS. 866-864-1038 Call for Specials Ponds. Close to Metro. Gas cooking, W/D hook-up, Fitness and Day Care Centers on Property ALEX $268,000 1BR $860, 2BR $905 hrwd flrs. Private fenced yard, carport, front porch. Outdoor and Indoor Pool SW EHO GREAT BUY Instant Approvals $1600 mo + utilities + security deposit RIVERDALE Friendship Crossing 2BRcondo 1044 SF, in lux bldg. Feat. W/D, balc, grg, 5% Gov’t, County, & 202-299-4612 Studios, 1 2 & 3 BRs starting at $700 1BR for 735* walkins. Well managed bldg w/store, extra storage Sr. Citizen Discount NE DC Hechinger Mall—Furnished rms for rent ALL UTILITIES INCLUDED! FREE GAS & HEAT excersice rm etc. Seller pays $2500 of your closing • Nr Metro, shpng & restaurants from $150/wk incl cable, phone and utils. Call Oliver Wall-wall carpeting. Spacious eat-in kitchens. Pri- closts. Call Karrina 703-370-8670 today CALL FOR SPECIALS! at 202.460.0206 vate balcony or terrace. W/W Carpet www.taylorbrown.com QUEENSTOWN APARTMENTS NE EHO RIVER CROSSING APARTMENTS Modern Kitchen w/Breakfast Bar ALEX/$392,500— 3 BR, 2 BA, 1 Car Gar, 6 yrs old, Nr 1-877-278-3509 WARM UP TO WINTER SAVINGS! CALL TODAY! 1-888-349-3767 Gated Community w/Intercom 395. 6481 Cheyenne Dr #203. Call Jane Leeper, Mon-Fri 9-7, Sa 9-5, Su 10-5 Laundry Facility in Every Bldg Jobin Realty, 703-801-6604 ROCKVILLE, MD EHO Move in before March 31st HYATTSVILLE’S BEST! 1 & 2 BEDROOMS FR. $840 ALEX/DEL RAY $235,000 The Apartments at Miramount With no Application Fee SUN FILLED TOP FLOOR 1BR $865 2BR $925 3BR $1270 BENNING WOODS & a Free Move-In Gift 1BR BRICK GARDEN CONDO 4040 E. CAPITOL ST NE •Washer/Dryer in each home All Utilities Included • Pool and Tennis Courts Security Deposit Special Updated appliances, golden hardwood floors. Near Wash. Hospital Ctr, 877-883-2524 • Picnic/BBQ Area (202) 563-6800 700 Square feet. Near Metro. Walk to shops & UofMaryland, & PG Plaza NE/MICHIGAN PARK—4BR, 1.5 BA, renovated • Corporate Suites CIH Properties, Inc. restaurants. www.TracyGraves.Infre.com Parquet Floors, Roomy Floorplans kitchen, w/d, cac, offst pkg. Nr Ft Totten Metro. 888.324.8343 TAKOMA PK—1 BR apts avl. Starting $725. 703-629-9169 LONG & FOSTER 703-522-0500 QUEENS PARK PLAZA $1850 mo. 703 980-8275 6040 California Circle 301-937-0100 ALEX/WATERGATE AT LANDMARK CONDOS NE/SE— 1BR, 1BR w/Den & 2BR. $675 & up + elec. 1BR/1BA— Beaut remod, all marble BA, new kit- 2500 Queens Chapel Rd A Southern Management Community TAKOMA PK—Blair Rd. 1BR apt avail. Small porch. 1-877-699-0295 No pets. Call 202-265-4814 or 202-889-4083. $795 inc utils. 301-937-0100 $295,900. 1BR/Den,2BA—1100 sf-$335,900Pools, Fred A. Smith Co. SE—1 BR from $760; 1 BR + Den $770. W/W cpt, wlk tennis,shuttle, beaut gated comm 571-277-1831 KENSINGTON—Gorgeous 2BR, 1BA w/new carpet. in clst, blcny, Off st Pkng, Walk to Green Line Metro. TEMPLE HILLS $99 Security Deposit $1050. 301-949-9056 NEW CARROLLTON—2BR, 1BA; nr Metro. $1350. 1,2,3BR Apts for Immed Move In ARL/Ballston $475,000 Sect 8 ok. 301-459-8144 Please Call 202-562-3200 1/2 Block Metro. 2BR, 1.5BA 2 lvl, top flr, 1206 s.f., LANDOVER 1829 Belle Haven Dr SE/150 Xenia St — Lge 1BR, newly renov Kitc, off-st • Washer/Dryer & Fireplaces-Optional NW/California St— 1 BR av immed. $1100/ • Gas Utilities Included hdwd flrs, updated kit., new carpet, W/D, balc., 3 Landover’s Finest mo+elec. Heat & Hot water incld. Sec. dep $1K. prkg, secure bldg, nr Metro. $650 + gas & elec. skylights, ample closets/storage, parking space con- DELWIN REALTY, 202-561-4675 • Metro bus stop community Call about Free Rent! Renovated Apts. Breakfast 2BR newly remod. Avl Immed. $1650/mo+elec. Call 301-894-8524 veys. Tom, 703-527-8896 American Realty Group bars, w/w carpet, after-school program. Metro ac- Sec dep $1K. Call NRM Assoc Inc. 703-524-5200 SE/2328 25th St— 2BR 1BA apt, Nr Metro, hdwd ARL/Ballston $355,000 flrs, $850 + utils. TEMPLE HILLS—2-BR DUPLEX TH’s avail. from cess. Shopping center. ADA access. Free prvt stor- NW $910+utils. Move in special, call 301-423-1681 1/2 Block Metro. Priced-to-sell. 1 BR, 1 BA, gorg age. Near Sports Complex/FedEx Field. Call 202-486-7656. hdwd flrs, new ceramic tiles, W/D, 160 sf balc, prkg GOOD THINGS HAPPEN IN 3’S SE/3736 1st St. —Lge 1BR, back porch, pvt prkg, TEMPLE HILLS HUNTLY SQ— 2BR condo $1295/mo 301-579-5455 Three intimate bldgs. located on Historic Meridian & incl utils & 1 BR/Den Condo, $1180/MO incl utils. space, new hvac, pre-wired for cable, DSL & ADT sec secure bldg, nr Metro. $565 + gas & elec. syst. Tom, 703-527-8896 LANDOVER EHO Dupont Circle. DELWIN REALTY, 202-561-4675 +Sec dep Avail Now 703-580-5427 Washington House 2120 16th St. NW American Realty Group 1,2 & 3 BRS FR. $840, SE/4010 9TH ST—1BR $775 + elec. Nice, quiet, safe Tysons Corner EHO DC—1413 T ST N.W. Studio, Bath, Kitchen Mon. fee Ask about the spectacular savings on our unique Hightowerrs 1530 16th St NW bldg. Totally remodeled apt. Convenient to Bolling Park Square 2407 15th St. NW Enjoy the Luxury of the Renaissance $162.00 $269,500 or best offer. Sunday 1-5 P.M. ‘Signature Series‘. Gas heat & cooking included. AFB. Manager: 202-270-1319 CONDO WILL BE SOLD SUNDAY! (202) 256-3885. ASHFORD AT COOPER’S CROSSING PEABODY & THEOHARIS MGMT. Waggaman Corp. 202-537-8970 Spacious 1BR & 2BRs starting at $1400 GERMANTOWN $275,000 CALL TODAY! 1-888-459-5539 877-810 -6216 SE/4219 1st St.— Large 2BR, E-I Kitc, hdwd flrs, • Fully renovated high end units A MUST SEE!2BR, 2BA Condo, hdwd flrs thru-out. *See leasing consultant for details NW/LEDROIT PARK 8 Unit Bldg near Metro. Secure bldg. $675 + elec. • Deluxe fitness center with sauna Call for dirs: Teresa Tolson 301-928-8213. Landover Hills SUPERB CONDITION DELWIN REALTY, 202-561-4675 • Year-round pool & tennis facilities Re/Max Colonial Homes, 301-292-6800 EHO. CALVERT HALL APTS. Lovely modern 1BR on 2nd floor, HU/Shaw Metro, S.E. 5312 E ST. —1 & 2BR apts avail. $650-$740. • Fully equipped business center ROSEMONT STATION CONDO-Cor of 1 West Ma- new appls., cac, dble pane wndws, 10’ ceiling, 202-581-2500 • Just minutes from Tysons Corner Center ple & Commonwealth Ave. —4 Units Avl. Jr 1BR; 877-203-6036 internet & cable ready & on-site laundry. $1150. SE-CASCADE PARK APTS • Shuttle to Metro provided 3rd Flr 1BR; Lux 1/1.5 BA Unit, & Beaut 2BR. Katie 2&3BRAPTS. Near Route 450 & PW Pkwy. 202-362-2642 For appointment, Call Howard at 703-473-1050 Judy, 703-855-3312. www.rosemontstation.com, Gated Access • Individual Heat & A/C NW—Military Rd, effics and 1BR from $675 and up, 4256 4th St, SE. 5 Bldg, 132 Unit Community. Stout & Teague Mgmt Corp. Eat-in kitchens with Dishwashers utils incl, separate dining room, large walk-in closet, Extensive renov underway. New Mgmt. Immed Upper Marlboro $2100 SW OPEN Fri., Sat. & Sun. 11-5 $219,500 Landover newly redecorated apartments, laundry room, man- occupancy. 4BR $1395, 3BR $1250, 2 BR $895, 1 BR RENT or RENT w/ OPTION Spacious effcy, w/built-in bed, shelves, storage KINGS SQUARE APTS. ager on-site $695; renovated kitch, new applncs, wood & car- NEW 3 BD./2.5BA. end unit- 3 Metros, 3 lvls., Sep. space. Freshly painted & new kitchen applncs; balc. Manager: 202-744-5871 peted flrs, ac, on-site laundry rm, on-site mgmt. ktchn., DRM & FMR 3sidedfrpl., LVRM, MBD, wrlpl. & overlooks treed garden in beaut. landscaped ’’Har- 877-898-6958 NW—Near New York Ave. Metro, www.novodev.com. sep. shwr., W/W crpt., W/D, grnt. cntrtps., 1cr. bour Square’’. Indoor pool, exerc. area, cvrd prkng, ALL UTILITIES INCLUDED 2-3 BR, 1.5-BA, prkg, & more. $2495+utils. Must see. 202-562-1600 grge.Yeru 202-251-0598 24 hr. gatehouse, security; 2 blocks waterfront Walk to Metro. Call for Specials. Free 6 week Cofer Rlty, 202-291-1801 S.E. EHO UPPER MARLBORO — Beautiful 3 BR, 2½ BA garage metro, nr Arena Stage & restaurants. 500 N. St. at Summer Camp Convenient to shops, Bus NW—Nr Logan Cir, Luxry 1BR w/hrd wood flrs, W/D, THE HEAT’S ON US! TH. $1850. 301-627-0032 4th St., #S-214. Over view dates? 434-299-5845 Landover dishwshr, $1300+ elec. 202-722-6181 VAN NESS 4545 Conn Ave NW MAPLE RIDGE 888-583-3045 NW/PETWORTH—2BR. $975 + utils. Security dep. MEADOW GREEN COURTS THE BRANDYWINE Free 6 Week Summer Camp. No pets. N-smkg. JUST MINUTES FROM DOWNTOWN! Only 6 Apartents Left! HOUSES FOR SALE Individually Controlled A/C and Heat 5402 3rd St. 202-996-5088 ASK ABOUT GREAT SPECIALS 2BR/1BA - $1975 2BR/2BA - $2000 Fitness Center/Gated Access OAKTON—Lge bsmt room. Pvt FBA/entr/yd. Hse All Utils Included. Brand new kits & baths. Brand ALEX $599,990 Landover, Maryland priv. $900/mo+¼ utils. Nr. shps/restr/bus. CALL TODAY! 202-582-5250 An Edmondson & Gallagher Community new fitness & business ctrs. DC’s most desirable Stunning 3 lvl 2 car garage TH. 3BR, 2½BA, new 1BR Apts from only $750 Nsmkg/no pets. 703-405-7942 location. Conv loc to Van Ness Metro, shpng & hdwd flrs, granite countertops, 42 in. kit. cabinets, OXON HILL SE INCLUDING ALL UTILITIES!! TERRACE MANOR APTS. entrtnmt. 877-305-6433 morning rm, 3 sided fplc, lg deck, only 6 yrs. young. Ask about our financial COLONIAL VILLAGE Off street parking; On bus route. 24 hr. maint. VIENNA—2BR condo, walk to Vienna Metro, indoor Amit Kakar, 703-622-2306; RE/MAX Allegiance. counseling program 888-583-3047 Handicapped accessible. Washer & dryer in select prkg. $1,500. 703-978-4102 ALEX—Duplex 2BR 1BA. Hunt. Metro, Old Town, *Walking distance to Metro FREE UTILITIES homes. Wall to wall carpet. Vienna Metro (1 Block)—Brand new 2BR/2BA, Belvoir area. 0 down. Owner fin. $385K. *Central AC/Heat CLOSE TO SHOPPING AND METRO! 1 & 2 BEDROOMS AVAILABLE pool, fitness ctr., Cinema Rm. & much more. Gar. 703-926-1882 *Modern Kitchens Call Today for Rents & Specials! $1850. Laughlin-Miller 703-356-7227 ANNANDALE/Lafayette Village—End unit TH w/3 202-678-0721 fnshd lvls & W/O bsmt, 4BR, 3½BA, compl. renov., *Playgrounds OXON HILL EHO An Edmondson & Gallagher Community VIENNA, VA EHO *Beautiful Landscaping 1/2 Off 1st Month Rent hdwd., granite, new carpet/paint/windows & doors SIL SPG — 4BR, 2FBA, plenty of parking, large back VIENNA PARK & more. Gorgeous. $519,000. 202-498-1641 Kent Village 1.888.494.6956 $99 Security Dep (w/ apprvd credit) yard, 10 mins to dntn SS & Metro Sta. $2400. • Park-like setting A Southern Mgmt Community 1BR from $675 2BR from $765 ARE YOU TIRED OF RENTING? Do you want to Call 301-526-2178, 202-207-6036. • Wall-to-wall Carpet own? Bankruptcies, liens, judgements, foreclosures, LARGO—2-BR 2-BA, new appls, new carpet, fresh 3BR from $915 • Enormous Balconies Instant Credit-Check SIL SPG/GLENMONT—Shr hse, Fem. n/s, furnace, we can help. Call Berna Able at RE/MAX Alle- paint, W/D, 2 mi. to Metro, 1 mi. to schools, security nr Metro. $395+ shr utils. 301-580-7264; • Huge living rooms giance 703-649-0939 or sys. $1350. 301-922-8038 Metro Accessible • Swimming pool Near Shopping! 301-871-6654 ARL, S/NAUCK $440,000 LARGO— 2BR, 2BA condo $1650+ gas/elec Silver Spring/ Chevy Chase $1275 • Play areas The Oaks at Park South • Minutes to metro End unit TH 3BR 1.5BA, ceramic tile flrs, deck patio, 301-455-1971 GREAT 1 BEDROOM updated applis. Call 703-403-0748 JOBIN REALTY LARGO—2MBR, 2BA, condo at Lakepointe. Beltway, 866-381-2786 (toll free) For 4/1 Details: 240 533 1000 877-316-6306 Mon-Fri 9-6; Sat 10-5; Sun 12-4 ARLINGTON $405,000 & shopping. Great for roommates. Avail. 4/1. $1640. Silver Spring, Maryland A Southern Management Community Call 202-369-0018 CHEF’S KITCHEN 2BR Apt Available Immediately WOODBRIDGE—TH avl immed. 4BR, 2½BA, wlk out Gorgeous 2BR brick Townhome LARGO— Condo. 1 BR, 1 BA. LR, DR, $1075/mo incl All Utilities Included bsmt. $1500/mo. 703-395-8903; 703-463-4066. Hardwood floors, deck off kitchen, pvt crtyrd. utls. 301-577-9062. 1 Blk from Silver Spring Metro Minutes to Navy Annex, Pentagon, Metro, LAUREL— TH, 4BR, 4BA avail 3/1. $1700/mo. Free Parking & Fitness Center Clarendon & I-395. www.TracyGraves.Infre.com 301-937-1142 Call Today: 866-274-7193 703-629-9169 LONG & FOSTER 703-522-0500 Classifieds

Near Bath NC HOUSES FOR SALE MI/HOMES WATERFRONT

Arlington—FSBO,GRT LOC, DUAL USE 3BR,2FB,LG NOW SELLING 2 AC +/- $159,900 KIT,LR, DR,W/D MAIN LVL. LOW LVL/3BR,1FB,LRG Gorgeous acreage w/ great views, pristine shoreline LR,W/D,KITNET,8/Yrs In Use Home/Physicians Ofc Cambridge Crossing & deep boatable water! Enjoy access to ICW, Sound W/2 DRVWAYS & 4 OFC PRKNG SPCS,CLS TO MANY Stafford, VA & Atlantic. Paved rd, underground utils, well water, MAJ RDS,METRO,GRT $$ POTENTIAL! 7015 Williams- septic approved. Excellent financing. By app’t only. burg Blvd. 703-606-4819, $1,390,000, OPEN 2/25 & Single Family Homes Call now 1-800-732-6601, x. 1491 3/4 1-4 PRICED FROM NEW MTN RETREAT ATTENTION BUYERS——SELLERS are giving you money to buy their homes. Credit approval. For THE MID $500’S 20+ AC / Mins to River more info Call E. Veney, Metrostar Realty, 202-330-8711 MD only. Call Tina at PRISTINE VIEWS BALTIMORE CITY 489,000 703-493-9960. New home on private parcel w/ wrap around deck. Brand new, 3000sqft, 4BR, 2.5BA, 2car gar, 9ft Ready to move in. All upgrades. A steal at $549,900. clg, maple/granite kit. 1/2acre lot, nr Rte 70 NO ONSITE SALES Only one. CALL OWNER 304-262-2770 443-255-0697 OWN THE MTN TOP! BROOKLAND $430,000 WALK TO METRO! Dirs to site: Take I-95 So. to Exit 136, follow to Left on Rte 4BR, 2BA, end unit on pvt cul de sac. Huge lot 1 South, Approx 1 mile L on Manning Drive, R on Forbes TOP of the WORLD VIEWS! w/prkg. Bsmt in-law suite, great for investor or St. Community on Right. roommate. Ready to Move in. 900 PERRY PL. N.E. 25 AC - $169,900 Suzanne DesMarais 202-521-9155- www.2hdb.- Best mtn. piece available anywhere! New rds, com/searchbysuzanne Re/Max Allegiance NW—$560K obo. Huge Victorian, 4BR, unique open survey & perc. Ready to enjoy! Lowest financing CAP HILL/STAD. ARMORY $369,900 floorplan, lg. kit., Eng. bsmt., nr. downtown. Call rates! Call 1-800-888-1262 TOP NOTCH RENOVATION—WalktoMetro.Brick David 301-434-9490 X336, Long & Foster semi-det., 3BR, 1½ ba, offst pkg, granite, S/S, REAL ESTATE FORECLOSURES & FIXER UPPERS RESORT PROPERTIES wood/marble. CLOSING PAID. 310 20th St. NE. L. —For free list call 703-821-2555. Annie Lauler Corp. Explore Baltimore Burton, Re/Max One, 301-335-7687 RENT TO OWN/RENT TO OWN CAP HTS—$235,000. 3BR 1½BA w/bsmt, new ARE YOU PAYING $1250 +in rent. HILTON HEAD/Marriott Barony Beach—Deluxe appls, closing help. LANETTE BROOKS Start the process of purchasing a home.Go from accommodation. Avail. May 7 to 14. $1,200. 301-806-9646, Exit Premier Realty 301-560-6700 renting to owning. Call Jody Davis 301-772-5144/ 703-978-4102 A special section in Express, Capitol Hill $575,000 X111. OCEAN CITY—36 condos available now. $138K- 22913thSTSE SEVERN— 3 lvl TH. Yr built 2000. 3BR, 2½ BA. Eat-in $200K. Call Frank K. @ RE/MAX 240-271-5552 Charming 2br 1.5 bth+garage. kit, fin bsmt, laminate flrs. Shows very well. $310K 866-4REMAX1 View online photos at: w/$5K in seller closing asst. Edward Cunningham, Wednesday, March 22 www.JTPrealestate.com Exit Premier Rlty, 301-669-0063; 301-560-6700. CLINTON $380,000 SMITHSBURG, MD. —Captivating south mtn sun- REAL ESTATE SERVICES Beaut SFH. 5 BR w/ 2 Mstr Suites, 3 BA. Lots of living sets & capacious accommodations (6000 sf), 3 lvl, space. A must see. Call Shante Briscoe, Exit Premier 4BR, 3.5BA, 2 Kitcs, 3 Fps, libr, custom J-shaped ARE YOU BEHIND ON YOUR MORTGAGE? Use this upcoming Express special section as your Realty, 202-498-3081 or 301-560-6700 inground heated pool. $725K. 301-796-1103. WE CAN STOP YOUR FORECLOSURE! COLUMBIA HGTS $500,000 SPGFLD $345,000 Free Application Process 3BR, 3BA, bsmt apt w/sep. entr. 757-438-1777. Spacious 3 lvl TH. 2BR, 1½BA, hdwd flrs, updated kit. www.freedomforeclosure.us guide to discover everything that makes Baltimore DIST HTS— 3 lvl TH. 3 BR, 2½ BA. Built 1992. End & BAs, fresh paint, fpl, custom brick patio. Updates unit. Very clean. $275,000. Edward Cunningham, thruout. Amit Kakar, 703-622-2306. TOO MUCH DEBT? Exit Premier Rlty, 301-669-0063; 301-560-6700. RE/MAX Allegiance We can help. Homeowners call 866-EASY-HOME great…whether for a fun weekend getaway or as a DISTRESS SALE/FIXER UPPERS STOCKS STILL LOW WE BUY HOUSES Starting Price $250,000 & Above Invest in the booming Atlanta mkt. Buy investment Stop Foreclosure Now, Stay in your home, Don’t lose Recieve free list, some need minor repair. 24-hr properties and sell with 45 days for a quick profit. your equity. Fast Cash, close in 3 days. recorded msg. 1-800-681-9853 enter ID#1079 $5k min inv. 25% return w/n 45 days. Not an Call 301-736-6199 place to call home. www.tyreerealestate.com IPO-IRA’s Welcome Serious inquiries only. WE DO REFI LOANS NO ONE ELSE CAN DISTRICT HEIGHTS,MD— $265,000 MUST SEE!!Yr www.pinnacledevpartners.com We accept scores below 500 and do unique deals. built 1995 TH 3BR, 2FB, 1½ BA, Bsmt & Deck. Seller 866-871-3226 All situations considered for residential real estate Offering $3.5K Cls Cost. Exit Premier, Victoria SUITLAND $269,985 refinancing w/equity. We save homes from foreclo- Carmon-Brown202.438.8785/ 301-560-6700 3 lvl, 3 BR, 2½ BA, TH. FP,2 Car Driveway, Fin bsmnt, sure, bankruptcies & payoff high debt. DISTRICT HTS —$3500 S-hlp, 3-lvl TH, b’95, 3BD, Seller Credit $5,000. Call India, 240-472-2119 Call 240-314-0319. 2½BA, fnsh bsmnt, fncd yard, near Metro,$265,000. Exit Premier Realty, 301-560-6700 What’s inside... Tanya M-Simmons 202-997-9997 UPPER MARLBORO $330,000 EXIT PREMIERE REALTY 301-560-6700 SFH 5-BR 2-BA, nice yrd. 301-789-1628 Amber COMMERCIAL REAL ESTATE FAIRFAX $599,000 Williams, Re/Max, www.unlockingdreams.com ● Cool things to do and see HOME FOR SALE NW/DOWNTOWN/Convention Center - Lease 17 YEAR YOUNG NEWLY REMODLED 4BR 3.5 BA Office/warehouse/loft. Excel. work/living space. CONTEMPORARY NESTELED AMONG $1MIL+ WE BUY HOUSES 2000-3000 sf. Craftsman, artist or prof. Conv. Metro. HOMES JUST 2 HSES FROM MAIN ST IN FAIRFAX 202-289-4909 ● CITY. WITHIN WALKING DISTANCE OF SHOPPING, ANY PRICE OR COND Great places to shop METRO BUS, BANKS, DRS AND OLD TOWN CITY OF FAIRFAX. ALL APPLIANCES CONVEY, HOME WAR- Do You Need To Sell Quickly? WHEELS RANTY. OPEN HOUSE SUNDAY, FEB 26TH FROM 1-4. WE BUY HOUSES FAST ● CALL BARBARA FOR MORE INFO 540-539-9484. All cash, no contingencies, no commission, no fees Where to eat Fairlakes—New TH 3BR 3.5 Bath 2400 SF All of the You Save $. Buying in Maryland, DC & Virginia. $$ CASH $$—paid for cars, trucks, SUVs. upgrades HW Granite Stainless Finished Bsmnt. Brian, Re/Max 2000, 301-996-9695 301-442-2711, 301-646-0083 ● 4651 Red Admiral Way 22033. 301-610-7979 www.listorbuyhomes.com. BMW ’96 740il—Green, Beige int., fully loaded, Where to stay FREE HOMEBUYER & CREDIT ANALYSIS WORK- [email protected] sunrf, 23’’Foose rims, clean, 108,000 miles. $10,500. SHOP March 4, 10:30-Noon— Increase Credit 202-345-1383 Scores, 1st Time Homebuyers Prog, Pre Approvals. BUICK ’99 Park Avenue—Like New! White, Gray ● call: Real Estate Development Inst 301 560-6797 LOTS & ACREAGE Leather, Full Luxury Package, 92K, $6000, Getting there FREE HOMEBUYER & CREDIT 703-258-9299 chevy ’04 silverado— 1500 ex/cab, ls package, ANALYSIS WORKSHOP 20 Acres and Larger parcels, with Hardwoods, Saturday March 4, 10:30-Noon spray inliner, 49k mi, white ext/gray int, $15,250 Streams, minutes to C&O Canal and Potomac 301-932-8272 ● Learn how to increase your Credit Scores, 1st Time River. Great Retirement and Second Home. Less Plus, the inside scoop on Baltimore real Homebuyers Program, On-site Pre Approvals. Inter- FORD ’03 Focus—5 spd, 43k mi, Silver, AM/FM, 2hr Beltway. Cassette, Insp, AC, $6200, 703-582-1086 est Only Loans & More. Limited Seating. To register LandinWV.com estate and great neighborhoods call: FORD—’95 Taurus, 4-dr, auto., 76K! All pwr. Exc. car. Real Estate Development Institute 360 VIEW! MD insp. $1350. Call 301-505-7034. 301 560-6797 HONDA ’01 CIVIC LX—2DR, auto, 60K, 1 owner, GAITH/NO. POTOMAC $589,000 APPRAISED AT $182,000 black, Md insp. Excel cond. $8499. 301-370-4564. HYUNDAI ’05 Santa Fe GLS—4spd,5kmi,Cran- 30 +/- AC - $129,900 berry, 2.7L, 21mpg city/28mpg hwy; AM/FM, Cas- PRIVACY Immediate $53,000 equity! Chance of a lifetime. sette, CD, Insp, AC, PW/PDL, PS, ABS, Alloys, Cruise, Certified appraised. Excellent financing. Call owner Tilt, $18800, 571-333-1330 PRICED RIGHT directly 1-877-777-4837 INFINITI ’05 G35 Coupe—Auto, 10k mi, Lakeside Gorgeous Mtn. Property Slate, CD, Insp, Snrf, AC, PW/PDL, PS, ABS, Alloys, Hidden by trees, this 4BR, 2½BA colonial in Pheas- Cruise, Tilt, $34,700, 540-752-5724 ant Run is located on a quiet cul de sac. Huge level AC - $129,900 JAGUAR ’02 X-type—5 spd, 3.0, 29k mi, Gold-tan walk out unfin bsmt, 1st flr famrm w/frpl, great for lthr, AM/FM, Cassette, CD, AC, AWD, PS, Alloys, lge family. Dirs: Off Clopper, follow signs to 11 Trudy 270 VIEWS Cruise, garaged, like new, warranty, $16500, Way. Call Rich at RE/MAX 301-717-9767. 301-275-1248 GERMANTOWN—TOWNHOME-EOG, 2BR. Dan Krell, End of road privacy! All wooded, usable parcel. Just 5 mins to C&O Canal w/access to Potomac River. LAND ROVER ’03 Discovery—Auto, 31k mi, silver, Realtor, Fairfax Realty, Inc., direct-301-529-8475; AM/FM, Cassette, CD, Insp, Snrf, AC, PW/PDL, PS, (Office)301-881-9800, Equal Housing Opportunity. Long term financing avail. For app’t Call Now 1-800-888-1262 ABS, Alloys, Cruise, Tilt, $23999, 301-233-2667 GaithersburgHomeSearch.com Daily Listings by Email LEXUS ’06 GS430—Auto.Slate grey.Exc cond!760 LAND BARGAIN MI.Fully loaded! Nav Cam.XM Radio.$50,000. K40 Laurel $424,000 opt. GRANDE TOWNHOME 28+ ACRES J. York:301-788-0702. XR Montpelier Hills Calif. Contemp TH! Huge 3 BR, 3.5 BA, End-unit, garage, 2 FP,2 Kitchens, LR, DR, FR, $99,900 MERCEDES-BENZ ’95 E-Class—Auto, 123k mi, 2 lvl foyer! 9330 Ispahan 295 Blue, AM/FM, Cassette, CD, Insp, Mnrf, AC, PW/PDL, ONLY ONE AT THIS PRICE! Forest property. Best PS, ABS, Cruise, $8000, 703-863-5203 Call Jolan ReMax. 301-442-0405 access anywhere - seconds to state forest! www.findyourwayhomeonline.com MERCURY ’97 MOUNTAINEER, 4Dr, Auto, AWD, 1-877-777-4837 All Pwr, Lthr, CD Chngr, Airbag, AC, Sunrf. $4700/ LITHONIA, GA $173,500 Large Mtn. Land Bargains, High Elevation. Ad- obo 240-381-0014 Lovely 4BR, 3FBA 2 story, FR, bonus rm, wood frame. joins Pristine State Forest, 20+ AC to 350 AC, Call Carolyn 404-667-4856 SAAB ’03 9-3 Arc 2.0T—SAAB ’03 9-3 Arc 2.0T -- Sweeping Mtn. Views, Streams. 19k mi, auto w/Sentronic, maroon, grey lthr, sun- Lorton $599,900 www.liveinwv.com roof, pwr everything, exc cond. $19999, Brand New Luxury TH 703-338-2620 2 Car Gar w/6 ft ext. on 3 lvls w/lots of upgd, LAST GREAT LAND DEAL gourmet kit. Must See!!! IMMEDIATE EQUITY SALE TOYOTA ’06 Solara—2 dr Coupe, SE, automatic, • 3 Bed, 3.5 Bath, W/O bsmt black, less than 5000 miles. $20,000/obo. DIR I-95 (S)R-LORTON, R- SILVER BROOK, R-LAUREL 28 +/- ACRES 202-302-4330. CREST, L-GILROY DR, R-FUREY to 9107 Appraised at $172,900 TOYOTA ’88 Celica—5spd, runs looks great, No UNITED REALTY,INC. rust. $950. 202-744-7187 703-975-2485 www.vgoel.com NOW $124,900 MANASSAS PARK $409,000 Long rd frontage w/ nice flat ridge. New long term BOATS AND AVIATION Brand new 2-story brick TH, 2BR, 2½BA, 1-car low rate financing. Limited viewing, call immediately garage, luxurious & spacious. 9514 Walker Way. before it’s gone! 1-877-777-4837 703-304-1600. Hana Realty. MOTORHOME COUNTRY STAR ’97—37 1/2’w/sli- MAR HTS—Branch Ave./495. 1 ac. storage/prkg lot deout. Gas, Ford¬¬Chasis, 39K miles, Good cond, + bldg for rent $1800/mo. 703-926-1882 many new parts, 10K below NADA, La Plata area $49500, 301-638-2133 NORTHERN NECK OF VA—A great place to retire! X078C 2x12 Call for FREE Visitors Guide and SEA RAY ’03—300SD 320hp B3 all options 180Hr Real Estate Review...... 804-493-8500 extended warrant $131900, 703-690-4879 F43=4B30Hk " ! %k4G?A4BBk!(

Bch[ Tb)FWh_i

;064A;08A )6ICTORIANSTYLEANDFURNISH CA4=3B2D;CDA438B2>E4A84B8340B?4>?;4 INGSHAVEBEENPRESERVEDIN$UPONT #IRCLE S(EURICH(OUSE WHICHISOPENTO PUBLICUNLESSITISSOLDLATERTHISMONTH

mhmaîn[eb\ ZlZf nl^nf' ; n mma ^\Zlme ^Íl_nmnk^blng \^k& ?aTbTaePcX^] mZbg'Nge^ll+.)%)))bliZb][r FZk\a*.h gZf h km`Z`^_ h k ma ^ 1aTf\PbcTa½b \ P]bT [ nbe ]bg`%bmpbee[^lh e ]Zg ]\h g & o^k m^]bgmhZgh_ _b\^%k^lmZnkZgm X] 3d_^]c 2XaR[T W Pb hk^f[Zllr' P]d ]Z]^f]UdcdaT ÊBgZOb \mh kbZg[ nbe ]bg`maZmÍl [^bg`nl^]_hkfh]^kginkihl^l% Ob lbmhklmhma^;k ^ pf Zl m^kÍl< Zl me^ g^Zk=nihgm5C7420BC;4 blZghma^k' :emahnàma^l Zrbg`lfb` am paZmrhnÍk^`hbg`mhl^^blgh]b_& ô h d ^ma ^Zf [bZg \^h _Zg ^bà [h k& _^k^gmmaZgpaZmrhnÍ]l^^bgZgr a hh] [Zk%ma ^;k^pfZlm^kÍl ;;H0?

GET THE WEIGHT OFF NOW! REDUCE BODY FAT NOW! Software. Hardware. Intense Strength Training, High Protein - Carb Conscious Get Your Shape Back! Get Firm And Tight! Systemware. Avoid the crowds Lose 3–4 dress sizes Adapt you. – 6 per group MEN Get Your Physique Back Be There. to 12 per group Fitness programs for Special classes for 40+ obese children ages 12-17 Kids, get in shape for back Cardio to school & sports Call G.I. Jane and buy a spot! Open Mon-Thu 6 am – 8 pm “Personal Tech” can give you cool and 30 Years of bringing technology to the government GI JANE BOOTCAMP useful tools. Mondays. Washington DC 202-547-7906 March 7–9, 2006 Convention Center 426 8 th St. SE, Eastern Market Metro www.GIJanefit.net Register at www.FOSE.com Priority Code: S6EX X017e 1x3 " k4G?A4BBk " ! %kF43=4B30H

likbg`m^fi^kZmnk^l%bgma^\hg& l^koZmhkb^l' :gZk]hk_hkZk[hk^lblpaZm bglibk^]bg]nlmkbZeblmIb^kk^L']n Ihgmmhink\aZl^ZgZk[hk^mnf maZmphne]eZm^k[^\hfÊhg`phh] 6aaNZVghAdc\lddY @Zk]^gl'A^[hnàmbmmhlZo^mk^^l a^dg^pp^k^hma^kpblâ^Z]^]_hk ma^lZpfbee%Zg]bgma^\^gmnkrlbg\^ 6PaST]bBdQYTRc bmlink\aZl^%]nIhgmÍleZg]aZl[ehl& lhf^]bgmhZ*%).)&Z\k^^qiZgl^' 5P\TS?PPaQâTcd\ Ehg`phh]Íl+)bg]hhkZg]+) hnm]hhk`Zk]^glZmmkZ\mZ[hnm RT[TQaPcTbRT]cT]]XP[ 1))%)))oblbmhklZr^Zk' fXcWU[âP[UTbcXeXcXTb Mablr^Zk%mahlôblbmhklpbeeZelh [^Z[e^mhiZkmZd^bglhf^li^\bZe MZeeiZef_khg]lk^Z\amakhnà [bkma]Zrkôêkr' ma^[ZefrZbkmhpZk]ma^lngebàm% <^gm^ggbZeô^gmlfZd^nima^ cnlmrZk]l_khf_nssr_^kgl]kbi& l^\hg]eZr^kh_\ê^[kZmbhglÉ_khf

ibg`pbmaanfb]bmrZg]Zg^qhmb\ '%/2'%7)$-!.!0 \abe]&_kb^g]er_Zfber]ZrlbgFZk\a _knbm`Zk]^gpa^k^dnfjnZml`khp mhZ]Zr_hkl^gbhklbg^Zker:ikbe' bg[kbàmhkZg`^[nklml' ÊMa^fZbgma^f^_hkma^\^gm^g& =nkbg`ma^\e^fZmbl\ê^[kZ& CnlmZghma^kpbgm^kÍl]Zrbg gbZebleZr^kl%ËlZb]lihd^lphfZg mbhgbgFZk\a%KZrfhg]>oblhg% D^gg^mmLjnZk^%IZ'8 :frLa^Zk^k'ÊBmÍllmkn\mnk^]mh +ANAKANUIORANGEBLOSSOMSAREONEOFMANYVARIETIESOFFLOWERSATTHE,ONGWOOD ZgZnmahkbmrhgma^_ehp^kl%pbee Bmbl_hkoblbmhklZmmaâblmhkb\ `bo^ô^krhg^ma^hiihkmngbmrmh 'ARDENSCONSERVATORY WHICHISCELEBRATINGITSTHANNIVERSARYTHISCOMING*ULY \hZqma^fmh`khphnmh_l^Zlhg% Ehg`phh]@Zk]^gl%pa^k^`n^lml ^gchrma^_^lmbobmb^lfZgrmbf^l bgmkZbg^][Zld^ml%nih[êbldlZg] mablr^ZkZk^[^bg`mk^Zm^]mhZr^Zk& makhnàhnmma^r^Zk'Ë ^Zkerlikbg`%pa^gfhlmh_ma^mk^^l oblbmhklZeema^fb]r^Zk[ehllhfl Zkhng]libkZe_kZf^l' ehg`[bkma]ZriZkmr' Ma^_bklmeZr^kblmaîeZgmeb_^ Zk^lmbee[Zk^%oblbmhkl\Zg^gchrma^ maZmma^hnmlb]^phke]pbeeaZo^mh ?hkFhma^kÍl=Zrp^^d^g]%FZr Ehg`phh]blmnkgbg`*))%Zg] bmlê_'Ehg`phh]pbeeahlm^bàmahk& [^lmma^`Zk]^glaZo^mhh__^k' pZbmfhgmalmhl^^' *+&*-%hk\ab]o^g]hkl_khfmakhnà& Zemahnàma^h__b\bZeZggbo^klZkrblgÍm mb\nemnkZe]blieZrlmakhnàhnmma^ :ÊPê\hf^Likbg`Ë]blieZr% Bg]^^]%bmÍl^Zlrmh_hk`^mma^ hnmma^Ngbm^]LmZm^lZg]Lhnma ngmbeCner%oblbmhklpbee[^\ê^[kZmbg` r^Zk%\hkk^lihg]bg`khnàerpbma knggbg`makhnà:ikbe0Zg] [enlm^krp^Zma^khnmlb]^pa^g :f^kb\ZpbeeZkkbo^ZmEhg`phh] pbmaô^krg^p[n]maZm\hf^lmh ma^]b__^k^gml^Zlhglh__ehkZ' ahnl^]bgEhg`phh]Íl_hnkZ\k^l lnkkhng]^][rma^likbg`mnebil% _hkZcn]`^]hk\ab]lahpZg]lrf& [ehhfÉ[hmabg]hhklZg]hnm' MaZmpZr%ô^gbgpbgm^kZg] h_a^Zm^]`k^^gahnl^l%ikhob]^l ebeb^l%]Z__h]belZg]%maZgd_neer% ihlbnf'0;8B>=;0??0? Your first stop for information.

Express is the fastest way to get news and entertainment en route to your destination. And the best place to catch Express is in the bright yellow news racks at area: Metro stations on-street locations college campuses apartment buildings restaurants Day or evening classes Classes health clubs Financial Aid if qualified enrolling So grab your copy at the news rack, Job placement assistance now! and read the ride away. Work in a rapidly expanding field! Aviation Institute of Maintenance Call today! (703)257-5515 read. ride. Manassas, VA • FAA Approved A&P Program recycle. XX208 3x5 This school is authorized under Federal law to enroll nonimmigrant students. F43=4B30Hk " ! %k4G?A4BBk"

5aPVaP]RT

05[âP[CWPc½b =^cC^ ^5[^fTah 7j=24?C2;>C78=650 243>55Z`Zbglmk^Ze&phke] :labg r\k^Zflabkmph kgpbmaZpZblm & 8=2 0= C > 270A o^gZibgdf^mZeeb\ikhf]k^ll SOMEONELOOKINGTOBEGIRLYWITHOUT FZkZg mh __ ^k^]mk^ g ]r\e hma ^l_h kph f ^ g pZl]k^ll^]]hpgpb maZgho^klbs^]p hh e SMELLINGLIKEABRIDESMAIDSBOUQUET hgma^`h' l\ Zk_Zg]e^`pZkf^k l' 5024>55) 7ORRIED 4HEHONEYSUCKLE JASMINEBLENDIS FZkZgmaZlk^_bg^]Z[kZg]h_ FZkZgm blh g ^ h _Zkblbg` `^g ^kZ& ABOUTHO WTOH IDE LACEDWITH A FRUITYTOPNOTE WHICH ^__hk me^ll\hhemaZmaZlfZ]â^k mbhgh_rhng`_^fZe^]^lb`g^klÉ THATHUGEZITAT CUTSTHESWE ETNESS WHILEMUSK Z_Zohkbm^h_[hahIZkblbZglZg] _k hf?kb]Z@b ZggbgbZm@n\\bmh PROM !LATTICE ADDSSEXINESS7HILETHES TAUNCH Aheerphh]lmZklebd^Dbklm^g BoZgZHfZsb\Zm<êbg^Ép bma WO RKFACEMASK LYANTI FLOWERSTILLWONTLIKEIT THOSE =nglm'ÊB]h gÍ mfZd^fZgb_ ^lmh ma ^bk_bg`^kh gma î nel^h_p h f & OFBRAIDEDACRYLIC LOOKINGTOTRADEINAHEAVYWINTER _Zlab h g% B fZd ^_Zlab h gBpZgm ^gÍlp Zk ]k h[ ^g^^]l' HAIRI SJUSTT HE SCENTNO WHA VEANOPTIONFORSPRING mhp^Zk%Z[ho^ô^krmabg`%Zg]bmÍl ÊBgma ^*2 1)lZg ]bgk^\^g mr^Zkl%b m THING)TWASCENTER :A8BC4 =?0 64:8A1H 4G?A4BB mkn ^ maZmBebd^mh[^\h f_h kmZ[ e ^ bgf r pZlZ[h n mla hpbg`h__Zg ][^bg`ho^kmer STAG EATTHE6IKTOR \e hma ^l%Ëma ^]^lb`g ^klZb ]Z_m^ ka ^ kZnmnfg& l^qr%[ n mBmabgdma ^k^Zk^fZg rp h f ^gpa h 2OLFSHOWIN pbgm^kk^Z]r&mh&p^Zklahp' Zk^ g h m mkh i a r p h f ^ g Zg ] pa h aZo^ Zg Z\mbo^ 0ARIS ALONGWITH 1TPd ch ?h k_Zee%la ^ln``^lm^]eZ r^kbg`Zlebgdr eb_^lmre ^Zg ]g ^^] k^Ze\e hma ^l%Ëla ^lZb ]' SOMESERIOUSLY \k^Zf lZmbg ]k^ll ho^k Z[ eZ\d ih e h g ^\d':g ] Obdmhk Khe_aZo^gô^k[^^gZ[hnmk^Ze WEIRDCOCKTAIL pa rg h mZ] ]Zmab\ddgbmaZmZg ] \angdrlh\dl \e hma ^l'=nkbg`ma ^_bklm]^\Z]^h _ma ^bkiZkmg ^ k & D R ESSES CWXb8b=^cP ph kgpbmaM&lmkZila h^l8 lab i %ma ^r\ZimboZm^]_Zlab h g^]bmh klZg ]fnl^ & 2[TPaPbX[BcXRZ nf \nkZmh klpb ma \k^Zmb h glln \a Zlfnlakhh f& h(EALINGCONCEALERSvEVOKEHORRID laZi^]hnm_bmlbglibk^] [rZmhfb\ ^qiehlbhgl' MEM O R IESO FCH ALKY Mahnàma^raZo^lbg\^l^mhnmmh\Zimnk^ @n^lml`Zma^k^]bgZm^gmbgma^Mnbe^kb^l GOOP Y U N SU BTLE ZfZbglmk^ZfZn]b^g\^%ma^bk\ZmpZedlahpl `Zk] ^glpZm\a ^]f h] êl^ f ^ k`^bg_ ^g \ & hT INTEDAC NEMEDI \hgmbg n^mh [hk]^khg i^k_hkfZg\^ Zkm' bg`&lmre ^fZldlmaZmmnkg ^]h n m% h g\e hl^k CATIONv"UT2EVLONS bgli^\mb h g%mh[^fZ]^_kh feZmmb\^][ kZb ]lh_ NEW 2>;>ABC0H Z\kre b\aZb k' 1;4<8B72>=240; Ma ^h n meZg ]blaZ\\^llh krpZlma ^lmZkmbg` 4A WORKST O ih bgm_h kZk^_e ^\mb h gh g[h nk`^h bllh i ablmb \Z & HEALP IM PLESW IT H 8=C741;0 2:) mbhg%ZloZkbZmbhglhgmaêbmme^[eZ\d]k^llp^k^ O UTERECTI NGT HE &RENCHDESIGNER l^mh__pb ma_blag ^mmbà mlZg ]abàa ^êl' COSMETICEQ U IVA )SA BEL- ARA N T Ma ^mpbg&ebd ^]^lb `g ^kliZb ]a h fZ`^mhRo^l LENT OFAh(5'%:)4 PAIREDANUMBER LZbgmEZnk^gmpbmaZlZmbglabkm]k^llpbmaZpb]^ (% 2%vSIGNONY OUR OFHERTOPSWITHA [êmmb^]bg mhZ[hp'An `^lbeo^kkhl^lZg ]ho^k& FACE ) TSPER CENT SIMPLEBLACKTUR lbs^]kn__e^likhob]^]Zobob]\hngm^kihbg mmh SALICYLICACID SO TLENECK BUTTHEN ma ^l^Zh_[ eZ\d \ab__h g% p hh eZg ]lZmbg' ITDRIESOUTTHELIT SHEISBEL OV ED Bglibk^] i^k aZ il [ rma ^bkk^\^ gm \h eeZ[h & TLEBUGGERSABOUTA BY "OHEMIAN kZmbhgp bmaBmZebZgkZbgp^ZkZg]hnm^k p^Zk DAYFASTERTHANTHEYD FASHIONISTAS li^\bZeblm :ee ^`kb%ma ^]n h^f [^ eebl a ^]Z\eZl & GOAWAYONTHEIROWN /THERLOOKS lb\[^b`^mk^g \apbmalbeo^keZf ^mkbffbg`h k 7EDIDHAVETOREAP "L ACKLEAT H ER khplh_ [êml Zkhng]ma^le^ô^l' PLYAFEWTIMESADAY OPERAGLOVESWITH B_maZmlh ng ]lp ^ZkZ[ e ^^g h n à%ma ^_bgZe ^ TOM AINTAINC OV ER APUFFED SLEEVE pZli nk^ ma ^Zm^k':f h]ê^f ^k`^]bg Z lmb__ lbe& AGE SOTHEhLASTS TEELEGWARMERS o^k[ nlmb^k]k^llpb maZeZfilaZ] ^ldbkm%e hh d & AL LDA YvCLAIMISNT WITHFORMALPARTY bg `cnlmebd^Z[Zee ^kbgZ_b `nk^h gZfnlb\[h q' SOM UCHhTRUEvAS SHOES 9>4;;43834A8270? hHOPEFULv:?: "!k4G?A4BBk " ! %kF43=4B30H

1PVVPVT2WTRZ 1XiPaa^u=ZgIbkZkh 2^a]TaTSuFbd^;Ze]pbg

0=3A401>=8>A?73

6PX]FTXVWc _Zfberbl\hg\^kg^]Z[hnm' eTacWT_PbcUTfhTPab8WPeT_dc bTTZR^d]bT[X]VCWT[Xcc[TbccWX]Vb ^]PbXV]XUXRP]cP\^d]cÛfTXVWc bTcWX\ÛU[XZTb_X[[TSRÛUTTâ <0=>5B8I4 RhnÍkâb]bg`bgrhnkhpgahf^ _khfZanl[Zg]pahoZen^l\h__^^ R^l%]bl\kbfbgZmbg`Z`Zbglmlhf^& Zg]laZfihhfhk^maZgfZkbmZe hg^_hkahplaêhhdlblZ[lhenm^& i^Z\^'Rbd^l' erpkhg`%[nmpaZmrhnÍk^mZedbg` Ablk^_nlZemh`^maêifbàm[^ Z[hnmbli^hie^paheho^rhnaZobg` _bg^_hkabflê_';nmma^mphh_rhn ?^^RW2PUTuIZne@beeb`Zg \hg\^kglZ[hnmrhnkeb_^lmre^Zg] Zk^mh`^ma^kbgmablfZkkbZ`^%Zg] a^Zema'L^mZlb]^ma^p^bàmblln^ hg^h_rhnblankmbg`!Zg]ihllb[er Zg]mabgdZ[hnmpa^ma^kmaêZlm_^p l\Zk^]É\Zee*&1))&022&L:?>b_ r^ZklaZo^k^Zeer[^^gZlaZiir_hk rhnô^k_^Zk_hkrhnklZ_^mr"'A^ rhnZl[^_hk^'Ma^mknmabl%ZÊcngd ^bma^k\Zk^lZ[hnmmaZmhka^]h^lgÍm' _hh]aZ[bmËblgÍmcnlmfZ]^h_Ah& B_a^]h^l%a^lahne]Z`k^^mh`hmh AhlZg]?ngrnglÉbm\hne]bg]^^] \hnglêbg`pbmarhn'Rhn\Zgmkrmh [êbgd^]mh_Zmb`n^%lmk^ll%ehg^& iZo^ma^pZr[rZldbgàbfmh`h ebg^ll%[hk^]hfhkZgqb^mr'Bm\Zg pbmarhnmhZgZiihbgmf^gm%Zg][r Zelh[^\h]^_hkZl^kbhnl[bg`bg` _h\nlbg`hgrhnk_^êbg`lkZma^kmaZg ikh[e^fmaZmiZ\dljnbm^Zg^fh& Z\\nlbgàbfh_[Z][âZobhk'>o^g mbhgZepZeehi':g]eZ\dh_iarlb\Ze b_a^k^_nl^lmh`h%hkmZd^l_hkô^k Z\mbobmrblghmlh`k^Zm_hkma^libkbm' mhZ\\hfiZgrrhn%\hnglêbg`\Zg RhnZk^Zeehp^]mh[^Zgrp^bàm aêirhnbgma^f^Zgmbf^' ?TPa[b1TUâTBfX]TuLmîaZgIZlmbl rhnpZgm%Zg]]^l^ko^mheho^rhnk [h]rghfZmm^kpaZmbmllbs^Zg] 3ENDYOURMENTALHEALTHANDEMOTIONAL WELLNESSQUESTIONSTO!NDREA"ONIOR 0H$ mh[êho^]_hkpahrhnk^ZeerZk^' ATBAGGAGE READEXPRESSCOM4HISCOL ;nmbmÍlmaZmk^Zei^klhgpahfrhnk UMNISNOTASUBSTITUTEFORONE ON ONECARE

r^ZklZm\hee^`^'L^f^lm^kZmL^Zbl ;TccTab Z[hnm\aZee^g`^%^qiehkZmbhg%Zg] ikhob]^lZngbjn^e^Zkgbg`^gob& khgf^gm'Ma^ikh`kZfpZlma^ ;TPeTBT\TbcTaPcBTP0[^]T \ZmZerlm_hkfr]^lbk^mh^qiehk^ 0B0=0E83lniihkm^kh_lmn]rZ[khZ] ma^phke]' ikh`kZfl%BpZllZ]]^g^]mhk^Z] Bnk`^mahl^pahZk^Êjn^l& u@e^ggF\

qik^llmaZmma^ mbhgbg`ma^Z\Z]^fb\bgm^`kbmrËh_ CWT3d_[Tg Ngbo^klbmrh_Obk`bgbZpZlÊjn^l& L^f^lm^kZmL^Zmhk^\hglb]^kma^bk mbhgbg`ma^Z\Z]^fb\bgm^`kbmrh_ ]^\blbhgZg]ZeehpZ\\k^]bmZmbhgmh Zikh`kZfmaZmZeehpllmn]^gmlmh lmn]^gmlpahpblamhiZkmb\biZm^ lmn]rZ[khZ]Z\knbl^labi'Ë bgmablikh`kZf'Bg]hbg`lh%ma^r :lZ*220L^f^lm^kZmL^ZZenf% Zk^Zeehpbg`\nemnkZe]bo^klbmrZg] B\Zgpbmahnmk^l^koZmbhglZrma^ ^q\aZg`^Zfhg`ZeepahZk^\nkb& l^f^lm^kBli^gmZml^ZpZlma^ hnlZ[hnmma^bkphke]' fhlmf^fhkZ[e^Zg]ng_hk`^mmZ& ÉDBF;HABG<> [e^mak^^fhgmalh_fr^gmbk^_hnk PZlabg`mhg%='<'

FA8C4C>4G?A4BB)8]R[dST]P\TW^\Tc^f]P]ScT[T_W^]T]d\QTaBdQ\XbbX^]b\PhQTTSXcTS 4\PX[c^X]Q^g/aTPSTg_aTbbR^\^a\PX[c^4g_aTbb;TccTab?>1^g &"& 0a[X]Vc^]E0!!! % F43=4B30Hk " ! %k4G?A4BBk""

YOUEXPLOREEVERYASPECTOFYOURCUR 0= =0= 82>;46>4BC >F0B78=6C >= RENTENDEAVOREVENATTHEOUTSET 7^a^bR^_T E8A6>0dV!"BT_c!! 9OUREALWAYS ? Z[cWdZWd [dZ jej^[ÉQCi$SIc_j^ WILLINGT OFIGHTFORWHATISRIGHT ANDACAUSE 7nHiZaaVL^ aYZg DESERVESYOUR PERCENTDEDI CATION =e [ijeMWi^_d]jedÊ^[WZb_d[i$ -AKEAPLANANDSTICKTOIT ?8B24B 5TQ (Rc!! 9OURELIKELYTO I[h_ekibo"Ykj_jekj$M[ Wbb ][j _j$ ?jmWil[ho Ykj[ SION ITSUNUSUALCAREYOURETAKING9OU GETABIGSURPRISEIFYOUEXPECTEVERY DONTWANTTODOANYT HINGPREMATURELY ONE TORESPONDTO YOU INTHESAME WAY j^[\_hijj_c[ ? h[WZ%^[WhZ%iWm_j$L[ho Ykj[$È 7AITBEFORESETTINGANYTHINGINSTONE 3OMEONEISSURETOBREAKTHEMOLD

F7H870C4321;>6B?>C2><>= 0= =0=82>;4B<8C774038=6 C>C74BD?A4<42>DAC>= CD4B30H 8= 0=455>AC C>B42DA474A 0A84BA?8>>Rc!"=ê! 9OURMEMO ;0C47DB10=3½B5>ACD =405C4AH40AB>5 ;8C860C8>= YOUDONTPUTSOMEONEOFFSIMPLYBECAUSE RYMAYBECHALLENGEDBYSOMEONEWHO YOURAPPROACHISALITTLETOOAGGRESSIVE4RY CLAIMSTOKNOWBETTERTHANYOUJUST 544;C741DA= TOBEALITTLEMORERELAXED CASUAL WHATWENTONINTHEDISTANTPAST4AKE C74 ;>6 h)AMINSPIREDTOWORKALITTLE C0DADB 0_aX[! < Ph! 9OU MAY BE ALOOKBACK 1[^V HARDERINTHEGYMAFTERSPEND TRAVELINGFARMORETHANUSUAL ANDYOULL B068CC0A8DB=ê!!3TR! 3OMEONE INGAWORKOUTSESSIONWITH 3ECRETARY OF WANTTOBEREADYFORACHANGEOFPLANS YOUKNOWWELLWILLBEAFTERALITTLEMORE 1A>:4=A42>A3 3TATE#ONDOLEEZZA2ICE,ASTNIGHT) WHENYOULEASTEXPECTIT THANYOUVEBEENOFFERINGRECENTLY4RYA h)TSGETTINGTOAPOINTWHEREALL)HAVE SPENTANHOUROFCARDIOANDWEIGHTSAND 64<8=8 A=3TR!!9P] (!S URPRISE "ABYSHAMBLESSINGERDOPEFIEND0ET E EXTRAFOODONMYPLATE/FCOURSETHAT BUTWITHASMALLADJUSTMENTYOUSHOULD ISINSTORE ANDYOUDBETTERBEPREPAREDTO $OHERTYWASARRESTEDYETAGAIN THISTIME DEFEATSALLOFTHEENERGYANDTIMESPENT BEABLETOGETRESULTSNOTWITHSTANDING FACEAFAST ARRIVINGDEVELOPMENTASWELLAS FORPINCHINGSOMEONESCARANDGASP WORKINGOUTv 20=24A9d]T! 9d[h!!9OULLBE APASTERRORRETURNEDTOHAUNTYOU POSSESSIONOFDRUGSv F0C27FA2=12#½B10A10A070AA8B>= ATTRACTEDBYEVERYTHINGFROMTHEORDINARY 0@D0A8DB9P]! 5TQ '&EELFREE 64C740;C7H0C=12#2><740;C71;>6 4=6;8B7A>2:4A?4C43>74ACH½B TOTHEOUTRAGEOUS7HATREALLYCOUNTS TOCHANGEYOURMINDNOTONCE NOT A4 ?4C8C8E4;460;0=C8 2B1 > A 4 67>BC<4380CH?4?03 2>< HOWEVER ISYO URWILLINGNESST OEXPLORE TW ICE BUTEVENTHREETIMES9OULLFIND CA0=B?0285820A;8=6C> =5DB8>= ;4>9d[h!"0dV!! $ONTSKIPOVER THATOTHERSWILLBEMORETHANPATIENTAT 102:8 =1DB8=4BB THEPRELIMINARIESITSIMPORTA NTT HAT THISTIME h4OTHESURPRISEOFSEVERALNEWSORGA º?74A <0 k 64=4A0; <0=064A¹ 0A=84 0??;410D< THEMSELVESOUTFORPLASTICBEADSv _XPcPfXcWb^\T0bXP]b.» 438C>A¹30= 20 220E0A> k=4FB438C>A¹6A46 10A14A k 0AC 38A42C>A¹ B2>CC <220AC7H k B42C8>= 438C>AB ¹ 0A8>=14A64A<82704;6A0BB <8:40=33><8=822><>==4F >A;40=B½ < > =C42>A4C7 4C864A2><38B2>E4ABC74= ?>=34AB 0A;8 =6C>=½Bº58 4BC0>A8 4= E82:H70;;4CC<0DA44=7>277>;;H<>AA8B:A8BC4=?064:8A1H<0CCBF4=B>=208C;8=C7>= 58ABC?>BC:0CA8=0<0A 386 A0B C0;BC>A4»06A>24AHBC>A4>= BCBCA44C=>AC7 438C>A80;3 4B86=¹78;810=9>k?A>3D2C8>=¹<0CC74F;8 338k?7>C>¹<0A28070A34Ak 2>?H27845¹2>;;44= <0AI42k?7>C>6A0?74A¹<8274;;4A4?8B>k2>=C4=C34E4; >?4A B¹27A8B<8=274A30A>=0F8;;80=B 2> 1>G &"& 0A ;8= 6C>= caP]bUT aPcATca^2 T\T]c>]RT h^d½eT\T\âXiTScWT5 C74 F0B78=6C>= ?>BC 2>=) ! !""#%((! k >A 4 <08; 3> 28A2D;0C8>=/A4034G?A4BB2>< k 03E4AC8B8=6) 20;; 1>1 :44=0= 0C ! !""# 7PaeTh½b3^Vc^VTcc^8RhB`dXS9Pa]hdZ]hdZ2WTRZ^dc^]T P]PVaP\Tca^\P_PcVT]TR^fP]R^\ % !$ >A 4<08; 03B/A4034G ?A4BB2>< k 2;0BB858 43 03E4AC8B8=6) ! !""#%!

! ! 5 $ ! " $ $ !" $ "$ ,,%,,% 5 #%%#'!+#%%#'!+ 5 #''#'' )(%#+)(%#+ //(*$(*$ 5 ,,*(#,*(#, 5 '*' #+ ('*' #+ ( "# !("# !( $"$ !$"$! $"$ !$ "$ !$ "$ !$ "$ 5 +"#'!,('+"#'!,(' ! # # $ ''.. * '++#,0'++#,0 5 5 (+ '!(+ '! % + ,%',,%', %+(%+( 5 5 ,29)45 5 !562405 (-+,('(-+,(' ,-/%()/3,-% #%5,-1+6216,427+, 30!7)5 )642 !2(%:-1'4)%5-1+/: 2/(4216 70&)4/%1( %-1 #&##&# 5 24+%16291 '/27(:-+, #-1(9)56 /744-)5 #%404216 03,!21-+,60256/:'/27(: ,291%4)1221325-6-2152*9)%6,)45:56)05%1(34)'-3-6% 5 %/6-024) -+, ; 129 %/-66/)4%-129 #-1(/-+,6 6%6-21%4: 6-21!)03)4%674)&%1(5%4),-+,5*246,)(%:24)'%56 #-1',)56)4 29 ; ') 4216 ,-+,/296)03)4%674)5%4)+-8)1*245)/)'6)('-6-)5 5 %1(8%4-%&/) #%5,-1+621 240%/,-+, ; 240%//29 ; 8 )4%+),70-(-6: !2(%: !,74 !2(%: !,74 ,%4/)5621 !$ !$ ,%4/266)58-//) 6/%16% 5 3' 056)4(%0 51 5* ,2745)1(-1+ 30 !4 %') 714-5)62(%: %0 25621 3' 51 6,)15 3' 5, 216,62(%6) = 715)6621-+,6 30 ,-'%+2 ' 3' )4/-1 5* 3' 240%/0216,62(%6) = 2214-5)62(%: %0 %//%5 3' 6 7)125 -4)5 3' ' :1',&74+ -',021( )18)4 3' 5 %/+%4: 3' 51 $)%462(%6) = 2215)662(%: 30 %56:)%462(%6) = 212/7/7 ' 5, 7&/-1 3' 3' 251+)/)5 5 3' )1)8% 51 5* ,291-562(%:>59)%6,)4 240%/:)%462(%6) = -456 7// %56 )9 !)03)4%674)5%4)62(%:>5 -%0- 5 5 25'29 3' 51 "-4+-1-%)%', )9$24.-6: 3' 4 20) 3' 4 ,-+,5%1(621-+,6>5/295 "! !"!#! 4/%1(2 5 5 :(1): 3' 3' %4 %4 %4 %4 )%66/) 4 ' !2.:2 4 4 24)'%565%1(+4%3,-'53428-()(& :''7#)%6,)41' < "#k4G?A4BBk " ! %kF43=4B30H

B;>F=4FB30H gbàm_heehpbg`Zkîhkmh_Zoâb& FWT]DB2T[TQb0aT \e^[^bg`lmhe^gbgEhg]hg%P^lm 1âX]VFTCda]c^?TcT Fb]eZg]lIheb\^lZb]':eep^k^ ?4C43>74ACHaZl[^^g kê^Zl^]hg[Zbe'>Zkeb^k Zkk^lm^]Z`Zbg%hglnl& mablfhgma%=ha^kmr ib\bhgh_lm^Zebg`Z pZll^gm^g\^]mh*+ \ZkZg]ihll^ll& fhgmalh_\hffn& bgàZk]]kn`l% gbmrl^kob\^_hkihl& ;kbmblaiheb\^ l^llbg`]kn`l'A^ lZb]'=ha^kmr%ma^ ie^Z]^]`nbemrmh

+%6).7).4%2'%449)-!'%3 mkhn[e^]+/&r^Zk& ma^\aZk`^lhgCZg' +ATIESAVESHERACTINGFOR4OM USUALLY he]_khgmfZgh_ma^ +0'Ma^fZqbfnf `khni;Z[rlaZf[e^l l^gm^g\^_hkihll^l& DB Zg]^q&[hr_kb^g]h_DZm^ lbhgh_;<4Bl^ql\^g^

lZb]3ÊMaZmÍlZ_nglmhkr'Ë0? !,%8"2!.$/.!0 :g`^e^lFhg]Zrpa^k^Zcn]`^ ^]eZlmfhgma_hk hk]^k^]ma^abi&ahifh`neZg]abl \Zkkrbg`ngk^`bl& A4E4;0C8>=B BDA?A8B4 rhng`^k[khma^kmhlmZg]mkbZehg m^k^]`ngl'0? 0CX\T[hAT\X]STa) BcPab0aT?T^_[TC^^ Ê@k^rÍl:gZmhfrËlmZk?0CA82: ¼7ThH½P[[1TPSb½ 18I0AA>F>A;3 34

Master’s Programs Open House Wednesday, March 8, 6:15 p.m. 3401 Fairfax Drive, Room 329, Arlington 6^^S3Ph u>]bm^][rMbfhmar>'IZkd^k Innovative Programs 02A>BB (OLDEROF World Class Faculty &LATFIXER NOTIONS Convenient D.C. area Location )TCANCOMEAFTER 1UARTERBACK Affordable Costs NOONEORSOMEONE 7HEN"RUTUS Meet our !RGUMENT STRUCK (ILOHELLO 4ASSEORGOD faculty and staff !CQUIRESINTHE STARTER to learn more about our END 6ISCOUSMUD exciting graduate programs $AYPART and certificates. -USEUMITEM 3>F= 0OTASSIUMAND 7IFENUMBER6) To reserve your place at this session or FOR(ENRY6))) SODIUMHYDROXIDES to find out more about our program, please #ATOSYEAR /UTOFHARMS 3TARTOFA WAY NAUTICALLY visit policy.gmu.edu/admissions. We are accepting SAILORSWARNING 7ASNTDISCREET applications for the fall 2006 semester. ,IKEPOLTERGEISTS ,IKEAMANLY ,ICENSES CHIN (ANDLESA "ROKETHROUGH Master’s programs are offered in: GROUNDER SECURITYCODE EG Public Policy Peace Operations !CCELERATES AS #HOU??? International Commerce Organization Development ANENGINE 0HILIPPINE Transportation Policy, Operations, and Knowledge Management and Logistics Telecommunications Policy -AN&RIDAY EG INVASIONSITE 3TAGEPRESENCE 3TALKOFBANANAS 7EEWAY /LDPUMPSIGN 0ACINODRAMA )TSGIVENIN $IMSUMDIP .OVEMBER (EROINEOF !NCIENT'REEK REGION 7AGNERSh4HE 2EGULARLY TOA 6IOLINISTS #OMICAL &LYING$UTCHMAN RHYMESTER HEIRLOOM HTbcTaSPh½bB^[dcX^] %XODUSPLAGUE 3PUMANTE h&RIENDS !WAITWITH 4HEYGOBYFAST SOURCE CHARACTER TREPIDATION !BBR 3TARTOF -ALLBAG h???-IO .AMEFOR AWHISPERED 7IFEOF'ERAINT !BHORRENCE ADOG PERHAPS COMMENT PERHAPS 7ORTHWHILE !RMBONES 0ASSINGFANCIES 4ICKLED THING .OLONGERMINT -# )DOLIZE #ERTAIN -ORTGAGE NUMERICALLY #HOICEWORDS DEFINITIVERESPONSE CONSIDERATION Write With Confidence 5PTIGHT /NE TIMETITLE -ARITIME ,ESLIE#ARON (AYWORTHOFFILM FOR"ILLY#RYSTAL -ONKEYSHINES FILM Improve your business writing skills through an interactive, 3UFFIXWITH h???&LUX .OTAPICKY 0LACEFORA 6IETNAM results-driven seminar at Georgetown University. %GYPTIANPORT SPECIFICATION LEADER "EAFFECTEDBYA -OREALOOF 4HEYREALL 9OURFAMILYIS LONGRUN PERHAPS Business Writing Seminar #HEWTHEFAT TENDER PARTOFONE Become an effective writer by participating in a program that will lead you through a six-step process designed to energize, clarify, and focus your writing. Bd k S^ k Zd u ¡Insse^l[rIZiih\hf $EGREEOF$IFFICULTY-%$)5- C^SPhX]7Xbcâh Join this one-day seminar and complete one of your current &ILLINTHEBOXESSOTHAT writing assignments while learning to: 4HE#ONTINENTAL#ONGRESS EACHROW COLUMNAND BY SQUAREINCLUDES Clarify Your Purpose ADOPTEDTHE!RTICLESOF &' THEDIGITSTHROUGH Design Your Message #ONFEDERATION &ORSOLUTION TIPSAND Draft Effectively #ONGRESSAUTHORIZEDTHE COMPUTERPROGRAM SEE Edit Globally FIRST53#ENSUS WWWSUDOKUCOM &( Clutter Bust 2EBECCA,EEBECAME HTbcTaSPh½b Sound Check and Proofread '%#THEFIRSTBLACKWOMANTO B^[dcX^] RECEIVEAN!MERICANMEDICALDEGREE Friday, March 10 FROMTHE.EW%NGLAND&EMALE-EDICAL 9:00am-5:00pm #OLLEGEIN"OSTON Tuition: $350 #ONGRESSAUTHORIZED '&!CREATIONOF9ELLOWSTONE To register, please visit cpd.georgetown.edu .ATIONAL0ARK or call (202) 687-7000 MONTH OLD#HARLES !,INDBERGH*R THESON ("! CENTER for OF#HARLESAND!NNE,INDBERGH WAS Georgetown PROFESSIONAL KIDNAPPEDFROMTHEFAMILYHOMENEAR UNIVERSITY DEVELOPMENT (OPEWELL .*2EMAINSIDENTIFIEDAS

THOSEOFTHECHILDWEREFOUNDTHEFOL 2P]½cVTcT]^dVWBdS^Zd.5X]SP]^cWTaBdS^Zd_dii[TX]cWT2^\XRbbTRcX^]^U 06F25 cWT?^bcTeTahBd]SPhP]SX]cWTBch[TbTRcX^]TeTah<^]SPhcWa^dVWBPcdaSPh LOWING-AY TRANSFORMING LIVES AND CAREERS 36 EXPRESS 3.1.2006 WEDNESDAY asv e neighborhood new massive 555massiveparty.com asv opportunity massive ac 8th march