Product datasheet Anti-CPA1 Antibody Catalog Number: A05985-1
BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China
Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected]
Basic Information Product Name Anti-CPA1 Antibody Gene Name CPA1 Source Rabbit IgG Species Reactivity human,mouse,rat Tested Application WB Contents 500ug/ml antibody with PBS ,0.02% NaN3 , 1mg BSA and 50% glycerol. Immunogen A synthetic peptide corresponding to a sequence of human Carboxypeptidase A (KRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLD). Purification Immunogen affinity purified. Observed MW 47KD Dilution Ratios Western blot: 1:500-2000
Storage 12 months from date of receipt,-20℃ as supplied.6 months 2 to 8℃ after reconstitution. Avoid repeated freezing and thawing
Background Information Carboxypeptidase A1 is an enzyme that in humans is encoded by the CPA1 gene. This gene encodes a member of the carboxypeptidase A family of zinc metalloproteases. This enzyme is produced in the pancreas and preferentially cleaves C-terminal branched-chain and aromatic amino acids from dietary proteins. This gene and several family members are present in a gene cluster on chromosome 7. Mutations in this gene may be linked to chronic pancreatitis, while elevated protein levels may be associated with pancreatic cancer.
Reference
Anti-CPA1 Antibody被引用在0文献中。
暂无引用
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC AND CLINICAL USE. 1 Product datasheet Anti-CPA1 Antibody Catalog Number: A05985-1
BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China
Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected]
Selected Validation Data
Figure 1. Western blot analysis of Carboxypeptidase A using anti- Carboxypeptidase A antibody (A05985-1). Lane 1: rat pancreas tissue lysates,Lane 2: mouse pancreas tissue lysates. anti- Carboxypeptidase A antigen affinity purified polyclonal antibody (Catalog # A05985-1)probed with a goat anti-rabbit IgG-HRP secondary antibody The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) . A specific band was detected for Carboxypeptidase A at approximately 47KD. The expected band size for Carboxypeptidase A is at 47KD.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC AND CLINICAL USE. 2
Powered by TCPDF (www.tcpdf.org)