Anti-ATP10A (aa 1301-1386) polyclonal antibody (DPABH-14648) This product is for research use only and is not intended for diagnostic use.

PRODUCT INFORMATION

Antigen Description This , which is upregulated in human umbilical vein endothelial cells, encodes a - coupled receptor. Variations in this gene can affect a persons stature. Multiple transcript variants encoding different proteins have been found for this gene.

Immunogen Recombinant fragment corresponding to Human ATP10A aa 1301-1386.Sequence: PTQLQLARQLTRKSPRRCSAPKETFAQGRLPKDSGTEHSSGRTVKTSVPL SQPSWHTQQPVCSLEASGEPSTVDMSMPVREHTLLE Database link: O60312

Isotype IgG

Source/Host Rabbit

Species Reactivity Human

Purification Immunogen affinity purified

Conjugate Unconjugated

Applications IHC-P

Format Liquid

Size 100 μl

Buffer pH: 7.40; Constituents: 44% PBS, 50% Glycerol, 0.88% Sodium chloride. Note: PBS without Mg2+ and Ca2+

Preservative 0.02% Sodium Azide

Storage Shipped at 4°C. Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

GENE INFORMATION

Gene Name ATP10A ATPase, class V, type 11A [ Homo sapiens ]

Official Symbol ATP10A

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]

Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Synonyms ATP10A; ATPase, class V, type 10A; ATPVA; ATPVC; ATP10C; probable phospholipid- transporting ATPase VA; ATPase, Class V, type 10C; aminophospholipid VA; phospholipid-transporting ATPase VA; ATPase type IV, phospholipid transporting (P-type);

Entrez Gene ID 57194

Protein Refseq NP_077816.1

UniProt ID O60312

Pathway Ion channel transport; Transmembrane transport of small molecules;

Function ATP binding; cation-transporting ATPase activity; magnesium ion binding; phospholipid- translocating ATPase activity

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]

Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved