DOCSLIB.ORG

Best Basic Part

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Best Basic Part Spider silk serves as a new material with superior properties that can be applied in medication, cloth, and aerospace fields. However, spider breeding is not applicable due to spider's fierce behavior. The current approach is to produce recombinant spidroins (silk proteins) from other chassis and spin them into silk. NT-2Rep-CT is the common architecture in two main types of spider silk proteins: major ambulate spidroins(MaSps) and minor ampullate spidorins (MiSps). NT is a non-repetitive N-terminal domain, as well as CT, the C- terminal domain, In between them is an extensive repetitive region. In the storage of spider silk protein. This year, Greatbay_SZ constructed recombinant spider silk protein NT- 2Rep-CT (spidroin) that can spin into artificial spider silk fiber. This part is in the part collection where we provide improved recombinant chromoproteins and spidroins based on the functions of different regions of naturally occurring spidroin. By carrying out different mixing of the proteins of different combinations, we can produce artificially spun silk of different colors and properties. Our part collection can help and inspire future teams to further design recombinant spider silks of more variety and give silks diversified color and property to fulfill the collection. Design Considerations NT can form stable dimers when pH decreases in the spinning duct. On the other side during the decrease of pH, the CT gets disrupted and unfold to turn in the beta- sheet amyloid-like fibrils. It is hypothesized that structural change of CT precipitate the change of the repetitive region to beta-sheet conformation. We found the amino acid sequence of NT domain, CT domain and extensive region Rep. Codon optimization was carried out by us to code the nucleotide sequence of NT-2Rep-CT according to the E.coli codon bias. The construct was cloned into a pT7 plasmid and transformed into BL21 (DE3) E. coli. The construction includes: 1. a 6× His tag (MGHHHHHHM) is added to enable us carrying out Ni-NTA protein purification 2. an N-terminal domain based on the E. australis MaSp1 sequence (SHTTPWTNPGLAENFMNSFMQGLSSMPGFTASQLDDM STIAQSMVQSIQSLAAQGRTSPNKLQALNMAFASSMAEIAASEEGGG SLSTKTSSIASAMSNAFLQTTGVVNQPFINEITQLVSMFAQAGMNDVSA; EMBL accession number AM259067) 3. a repetitive part consisting of two polyalanine and glycine-rich repeat regions from MaSp1 of E. australis (GNSGRGQGGYGQGSGGNAAAAAAAAAAAAAAAGQGGQGGYGR QSQGAGSAAAAAAAAAAAAAAGSGQGGYGGQGQGGYGQSGNS; EMBL accession number AJ973155) 4. a C-terminal domain based on the A. ventricosus MiSp sequence (VTSGGYGYGTSAAAGAGVAAGSYAGAVN RLSSAEAASRVSSNIAAIASGGASALPSVISNIYSGVVA SGVSSNEALI QALL ELLSALVHVLSSASIGNVSSVGVDSTLNVVQ DSVGQYVG; GenBank accession number JX513956). Also, the linker between the NT/CT and the 2Rep(repetitive region) is GNS Characterization We aimed to use a synthetic biology approach to combine standardized DNA part NT-2Rep-CT, and transform constructs to metabolically engineered E. coli for bioproduction. Purification and SDS PAGE In order to detect whether protein expression was induced by adding isopropylthiogalactoside (final concentration 0.3mM), we used SDS-page(12%) to determine the presence of target protein. The induced protein was initially 34kDa, which it consistent with the previous research (Andersson, Marlene, et al. 2017). Spidroin Production measure BCA protein essay kit give us the specified data of the average amount of protein we extracted in parallel sets of Ni-NTA purification (Fig.2). Result shows the amount of spidroin in shaking-flask E.coli cultures and yielded average around 336±49 mg protein/L, and 46±10mg/g, which is more than double of the yield in previous research (125mg protein/L) (Andersson, Marlene, et al. 2017) and most yielded protein among all spidroins we produced this year. Fiber spinning NT2RepCT has the feature of pH-dependent assembly, because lowered pH and shearing induce adjusts conformational changes that result in conversion from soluble protein to beta-sheet fibers. At pH>7, NT is in highly soluble state, which lead the spidroin to have high solubility. Due to the lock and trigger mechanism, when pH is lowered in the end of the silk duct, NT forms stable dimers and therefore interconnects the spidroins by applying pulling force alone the fiber via protein chains; CT, at the same time, unfolds to form amyloid-like fibrils that serves as the nucleation seeds of the conversion of the repetitive region (2Rep) into beta- sheet structures. (Andersson, Marlene, et al. 2017) To further substantiate the role of pH in fiber spinning, we carried out artificial fiber spinning in different aqueous buffers that valued from (pH2.0 to pH7.0) with same extruding speed. (Fig.4.A) sketches these relationships. When pH of the buffer bath is from 2.0 to 4.0 gelatinous substance forms and attach to the syringe until disappearing shortly in the solution. Continuous fibers formed when buffer pH is in between 5.0 to 6.0. Fiber is visually continuously formed in pH=7.0 buffer, but disrupted easily when we try to reach the fiber and lift. Besides the pH change, in our biomimetic spinning, we also used 100% isopropanol (Fig.3.A) in the fibre spinning solution and gained a continuous and uniformly-distributed fibre that would not be interrupted by lifting to collect. Scanning electron microscopy of fibers Aiming to verify the distribution uniformity of NT2RepCT after spinning into fiber, we looked at our artificial spun silks by NT-2Rep-CT spidroin and concocting NT-2Rep- CT spidroin with sfGFP chromoprotein under electron microscope (Fig.5), the role of sfGFP chromoprotein here is for us to clearly observe our silk under electron microscope. We randomly selected the cross section in our continuous silk, it is clearly shown that the fiber circularity is qualified as a uniformly distributed silk. Without sfGFP mixed, the spider silk spun by NT-2Rep-CT spidroin only can not be observed from the positive electron microscope image due to its lack of fluorescence. ———————————————————————————————————— Reference [1] Andersson, Marlene, et al. “Biomimetic Spinning of Artificial Spider Silk from a Chimeric Minispidroin.” /Nature Chemical Biology/, vol. 13, no. 3, Sept. 2017, pp. 262–264., doi:10.1038/nchembio.2269..
Load more

Recommended publications
  • Spider Silk for Tissue Engineering Applications
    molecules Review Spider Silk for Tissue Engineering Applications Sahar Salehi 1, Kim Koeck 1 and Thomas Scheibel 1,2,3,4,5,* 1 Department for Biomaterials, University of Bayreuth, Prof.-Rüdiger-Bormann-Strasse 1, 95447 Bayreuth, Germany; [email protected] (S.S.); [email protected] (K.K.) 2 The Bayreuth Center for Colloids and Interfaces (BZKG), University of Bayreuth, Universitätsstraße 30, 95447 Bayreuth, Germany 3 The Bayreuth Center for Molecular Biosciences (BZMB), University of Bayreuth, Universitätsstraße 30, 95447 Bayreuth, Germany 4 The Bayreuth Materials Center (BayMAT), University of Bayreuth, Universitätsstraße 30, 95447 Bayreuth, Germany 5 Bavarian Polymer Institute (BPI), University of Bayreuth, Universitätsstraße 30, 95447 Bayreuth, Germany * Correspondence: [email protected]; Tel.: +49-0-921-55-6700 Received: 15 January 2020; Accepted: 6 February 2020; Published: 8 February 2020 Abstract: Due to its properties, such as biodegradability, low density, excellent biocompatibility and unique mechanics, spider silk has been used as a natural biomaterial for a myriad of applications. First clinical applications of spider silk as suture material go back to the 18th century. Nowadays, since natural production using spiders is limited due to problems with farming spiders, recombinant production of spider silk proteins seems to be the best way to produce material in sufficient quantities. The availability of recombinantly produced spider silk proteins, as well as their good processability has opened the path towards modern biomedical applications. Here, we highlight the research on spider silk-based materials in the field of tissue engineering and summarize various two-dimensional (2D) and three-dimensional (3D) scaffolds made of spider silk.
    [Show full text]
  • Spidroin Striped Micropattern Promotes Chondrogenic Differentiation of Human Wharton's Jelly Mesenchymal Stem Cells
    Spidroin Striped Micropattern Promotes Chondrogenic Differentiation of Human Wharton’s Jelly Mesenchymal Stem Cells Anggraini Barlian ( [email protected] ) Bandung Institute of Technology Dinda Hani’ah Arum Saputri Bandung Institute of Technology Adriel Hernando Bandung Institute of Technology Ekavianty Prajatelistia Bandung Institute of Technology Hutomo Tanoto Bandung Institute of Technology Research Article Keywords: chondrogenesis, human Wharton’s jelly, mesenchymal stem cells, microcontact printing, spidroin Posted Date: April 23rd, 2021 DOI: https://doi.org/10.21203/rs.3.rs-445399/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Spidroin Striped Micropattern Promotes Chondrogenic Differentiation of Human Wharton’s Jelly Mesenchymal Stem Cells Anggraini Barlian*1,2, Dinda Hani’ah Arum Saputri1, Adriel Hernando1, Ekavianty Prajatelistia3, Hutomo Tanoto3 1School of Life Sciences and Technology, Bandung Institute of Technology, Bandung, West Java, 40132, Indonesia 2Research Center for Nanosciences and Nanotechnology, Bandung Institute of Technology, Bandung, West Java, 40132, Indonesia 3Faculty of Mechanical and Aerospace Engineering, Bandung Institute of Technology, Bandung, West Java, 40132, Indonesia *Corresponding author email: [email protected] ABSTRACT Cartilage tissue engineering, particularly micropattern, can influence the biophysical properties of mesenchymal stem cells (MSCs) leading to chondrogenesis. In this research, human Wharton’s jelly MSCs (hWJ-MSCs) were grown on a striped micropattern containing spider silk protein (spidroin) from Argiope appensa. This research aims to direct hWJ-MSCs chondrogenesis using micropattern made of spidroin bioink as opposed to fibronectin that often used as the gold standard. Cells were cultured on striped micropattern of 500 µm and 1000 µm width sizes without chondrogenic differentiation medium for 21 days.
    [Show full text]
  • Tarantulas and Social Spiders
    Tarantulas and Social Spiders: A Tale of Sex and Silk by Jonathan Bull BSc (Hons) MSc ICL Thesis Presented to the Institute of Biology of The University of Nottingham in Partial Fulfilment of the Requirements for the Degree of Doctor of Philosophy The University of Nottingham May 2012 DEDICATION To my parents… …because they both said to dedicate it to the other… I dedicate it to both ii ACKNOWLEDGEMENTS First and foremost I would like to thank my supervisor Dr Sara Goodacre for her guidance and support. I am also hugely endebted to Dr Keith Spriggs who became my mentor in the field of RNA and without whom my understanding of the field would have been but a fraction of what it is now. Particular thanks go to Professor John Brookfield, an expert in the field of biological statistics and data retrieval. Likewise with Dr Susan Liddell for her proteomics assistance, a truly remarkable individual on par with Professor Brookfield in being able to simplify even the most complex techniques and analyses. Finally, I would really like to thank Janet Beccaloni for her time and resources at the Natural History Museum, London, permitting me access to the collections therein; ten years on and still a delight. Finally, amongst the greats, Alexander ‘Sasha’ Kondrashov… a true inspiration. I would also like to express my gratitude to those who, although may not have directly contributed, should not be forgotten due to their continued assistance and considerate nature: Dr Chris Wade (five straight hours of help was not uncommon!), Sue Buxton (direct to my bench creepy crawlies), Sheila Keeble (ventures and cleans where others dare not), Alice Young (read/checked my thesis and overcame her arachnophobia!) and all those in the Centre for Biomolecular Sciences.
    [Show full text]
  • Spinning and Applications of Spider Silk
    Frontiers in Science 2012, 2(5): 92-100 DOI: 10.5923/j.fs.20120205.02 Spinning and Applications of Spider Silk Kunal Singha*, Subhankar Maity, Mrinal Singha Department of Textile Engineering, Panipat Institute of Engineering & Technology, Harayana, India Abstract Spider silk is specially produced from the different species (sp.) of spider throughout the globe, specially the most fine and mechanically sound silk produced from nephila sp. The fibriller parallel model of spider silk gives higher mechanical properties with better Young’s modulus and lower stress than normal silk coming from the silk-moth. In this review work we dicuss about the collection, composition, spinning and molecular structure, mechanical properties with its application of the spider silk. Ke ywo rds Spider Silk, Nephila Sp., Fibrille r Pa ralle l Model, Young’s Modulus, Spinning, Mechanical Properties 1. Introduction Spider silk refers to a wide range of continuous filaments 2. Macromolecular Structure of Silk spun by the several species of lepidoptera & arthropoda. Spidroin Spiders have six or seven sets of glands spun different fibers. Major ampullate dragline silk is comprised of two proteins There is different type of spider species; but the most joined together via 3-5 disulfide bonds near their common species of the spider which produced the spider C-termini[12]; the two proteins which are found in spider dragline silk is Araneus diadematus[1, 2]. silk are : spidroin 1 and spidroin 2. There are various types of spider species available in the nature and their habitat, location, life cycle are also totally 2.1. Secondary Structure of Dragline Silk different.
    [Show full text]
  • Production and Purification of Synthetic Minor Ampullate Silk Proteins
    Utah State University DigitalCommons@USU All Graduate Theses and Dissertations Graduate Studies 12-2018 Production and Purification of Synthetic Minor Ampullate Silk Proteins Danielle A. Gaztambide Utah State University Follow this and additional works at: https://digitalcommons.usu.edu/etd Part of the Engineering Commons Recommended Citation Gaztambide, Danielle A., "Production and Purification of Synthetic Minor Ampullate Silk Proteins" (2018). All Graduate Theses and Dissertations. 7306. https://digitalcommons.usu.edu/etd/7306 This Thesis is brought to you for free and open access by the Graduate Studies at DigitalCommons@USU. It has been accepted for inclusion in All Graduate Theses and Dissertations by an authorized administrator of DigitalCommons@USU. For more information, please contact [email protected]. PRODUCTION AND PURIFICATION OF SYNTHETIC MINOR AMPULLATE SILK PROTEINS by Danielle A. Gaztambide A thesis submitted in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE in Biological Engineering Approved: ______________________ ____________________ Randolph V. Lewis, Ph.D Jixun Zhan, Ph.D Major Professor Committee Member ______________________ ____________________ Ronald Sims, Ph.D Richard S. Inouye, Ph.D Committee Member School of Graduate Studies UTAH STATE UNIVERSITY Logan, Utah 2018 ii Copyright © Danielle A. Gaztambide 2018 All Rights Reserved iii ABSTRACT Production and Purification of Recombinant Minor Ampullate Silk Proteins by Danielle A. Gaztambide, Master of Science Utah State University, 2018 Major Professor: Randolph V. Lewis, Ph.D. Department: Biological Engineering Spider silks long have been recognized as some of nature’s most impressive materials. By divergent evolution, orb-weaving spiders produce and utilize six distinct silk fibers and one glue for a variety of biological roles.
    [Show full text]
  • Silk-Based Biomaterials for Tissue Engineering
    C H A P T E R 1 Silk-based Biomaterials for Tissue Engineering V. Kearns, A.C. MacIntosh, A. Crawford and P.V. Hatton* Summary ilks are fibrous proteins, which are spun by a variety of species including silkworms and spiders. Silks have common structural components and have a hierarchical structure. Silkworm silk must be S degummed for biomedical applications in order to remove the immunogenic sericin coating. It may subsequently be processed into a variety of forms, often via the formation of a fibroin solution, including films, fibres and sponges, and used in combination with other materials such as gelatine and hydroxyapatite. Spider silks do not have a sericin coating and may be used in natural fibre form or processed via formation of a spidroin solution. Both silkworm and spider silks have been reported to support attachment and proliferation of a variety of cell types. Silks have subsequently been investigated for use in tissue engineering. This chapter provides a general overview of silk biomaterials, discussing their processing, biocompatibility and degradation behaviour and paying particular attention to their applications in tissue engineering. KEYWORDS: Silk; Fibroin; Spidroin; Tissue engineering. *Correspondence to: Professor Paul V Hatton, Centre for Biomaterials & Tissue Engineering, School of Clinical Dentistry, University of Sheffield, Claremont Crescent, Sheffield, S10 2TA, UK. Email: [email protected] Tel: +44 (114) 271 7938 Fax: +44 (114) 279 7050. Topics in Tissue Engineering, Vol. 4. Eds. N Ashammakhi, R Reis, & F Chiellini © 2008. Kearns et al. Silk Biomaterials 1. INTRODUCTION Silks are fibrous proteins, which are spun into fibres by a variety of insects and spiders [1].
    [Show full text]
  • One-Step Heating Strategy for Efficient Solubilization of Recombinant Spider
    One-step heating strategy for ecient solubilization of recombinant spider silk protein from inclusion bodies Hui Cai Soochow University Gefei Chen Karolinska Institutet Ying Tang Soochow University Hairui Yu Soochow University Sidong Xiong Soochow University Xingmei Qi ( [email protected] ) Soochow University https://orcid.org/0000-0001-6356-4055 Research article Keywords: heating, recombinant spidroin, inclusion body solubilization, NM IBs Posted Date: October 31st, 2019 DOI: https://doi.org/10.21203/rs.2.16637/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Version of Record: A version of this preprint was published at BMC Biotechnology on July 10th, 2020. See the published version at https://doi.org/10.1186/s12896-020-00630-1. Page 1/16 Abstract Background Spider silk, an ideal biomaterial with remarkable mechanical properties, is built of spider silk proteins (spidroins). Engineering spidroins have been successfully produced in a variety of heterologous hosts and the most widely used expression system is Escherichia coli ( E. coli ). However, recombinant expression of spidroins often results in water insoluble inclusion bodies (IBs). Target protein solubilization from IBs in a traditional way is often solved under extremely harsh conditions, e.g. 8 M urea or 6 M guanidine hydrochloride, which highly risk to poor bioactive protein recovery as well as precipitation during the following dialysis process. Results Here we present a new mild solubilization strategy called one-step heating method to solubilize spidroins from IBs, with combining together spidroins’ high thermal stability with low concentration of urea. We expressed a 430-aa recombinant protein (designated as NM) derived from the minor ampullate spidroin of Araneus ventricosus in E.coli ; the NM proteins are present in the insoluble fraction as IBs.
    [Show full text]
  • Efficient Protein Production Inspired by How Spiders Make Silk
    ARTICLE Received 8 Sep 2016 | Accepted 4 Apr 2017 | Published 23 May 2017 DOI: 10.1038/ncomms15504 OPEN Efficient protein production inspired by how spiders make silk Nina Kronqvist1,Me´doune Sarr1, Anton Lindqvist2, Kerstin Nordling1, Martins Otikovs3, Luca Venturi4, Barbara Pioselli4, Pasi Purhonen5, Michael Landreh6, Henrik Biverstål1,3, Zigmantas Toleikis3, Lisa Sjo¨berg1, Carol V. Robinson6, Nicola Pelizzi4, Hans Jo¨rnvall7, Hans Hebert5, Kristaps Jaudzems3, Tore Curstedt8, Anna Rising1,9 & Jan Johansson1,9,10 Membrane proteins are targets of most available pharmaceuticals, but they are difficult to produce recombinantly, like many other aggregation-prone proteins. Spiders can produce silk proteins at huge concentrations by sequestering their aggregation-prone regions in micellar structures, where the very soluble N-terminal domain (NT) forms the shell. We hypothesize that fusion to NT could similarly solubilize non-spidroin proteins, and design a charge- reversed mutant (NT*) that is pH insensitive, stabilized and hypersoluble compared to wild- type NT. NT*-transmembrane protein fusions yield up to eight times more of soluble protein in Escherichia coli than fusions with several conventional tags. NT* enables transmembrane peptide purification to homogeneity without chromatography and manufacture of low-cost synthetic lung surfactant that works in an animal model of respiratory disease. NT* also allows efficient expression and purification of non-transmembrane proteins, which are otherwise refractory to recombinant production, and offers a new tool for reluctant proteins in general. 1 Division for Neurogeriatrics, Department of NVS, Center for Alzheimer Research, Karolinska Institutet, 141 57 Huddinge, Sweden. 2 Spiber Technologies AB, 106 91 Stockholm, Sweden. 3 Latvian Institute of Organic Synthesis, Department of Physical Organic Chemistry, Riga 1006, Latvia.
    [Show full text]
  • Optimizing Production Methods for Artifical Silk
    Clemson University TigerPrints All Theses Theses 12-2006 OPTIMIZING PRODUCTION METHODS FOR ARTIFICAL SILK PROTEINS THROUGH BIOREACTOR AND PURIFICATION STUDIES OF RECOMBINANT PROTEINS EXPRESSED FROM Pichia pastoris Aaron Ramey Clemson University, [email protected] Follow this and additional works at: https://tigerprints.clemson.edu/all_theses Part of the Materials Science and Engineering Commons Recommended Citation Ramey, Aaron, "OPTIMIZING PRODUCTION METHODS FOR ARTIFICAL SILK PROTEINS THROUGH BIOREACTOR AND PURIFICATION STUDIES OF RECOMBINANT PROTEINS EXPRESSED FROM Pichia pastoris" (2006). All Theses. 46. https://tigerprints.clemson.edu/all_theses/46 This Thesis is brought to you for free and open access by the Theses at TigerPrints. It has been accepted for inclusion in All Theses by an authorized administrator of TigerPrints. For more information, please contact [email protected]. viii OPTIMIZING PRODUCTION METHODS FOR ARTIFICAL SILK PROTEINS THROUGH BIOREACTOR AND PURIFICATION STUDIES OF RECOMBINANT PROTEINS EXPRESSED FROM Pichia pastoris __________________________ A Thesis Presented to the Graduate School of Clemson University ___________________________ In Partial Fulfillment of the Requirements for the Degree Master of Science Polymer and Fiber Science ___________________________ by Aaron Thomson Ramey December 2006 ___________________________ Accepted by: Dr. Michael Ellison, Committee Chair Dr. Sarah Harcum Dr. Gary Lickfield vi ABSTRACT Advancements in the field of biomaterials are soon to make the production of a recombinant silk fiber a reality. A gene was constructed which utilized components from both the dragline silk of Nephila clavipes and nematode collagen. For this engineered protein, the yeast strain Pichia pastoris was chosen to be the host organism due to its ease of genetic manipulation and its ability to secrete proteins in soluble forms.
    [Show full text]
  • Transient Expression of a Major Ampullate Spidroin 1 Gene Fragment from Euprosthenops Sp
    CANCER GENOMICS & PROTEOMICS 3: 83-88 (2006) Transient Expression of a Major Ampullate Spidroin 1 Gene Fragment from Euprosthenops sp. in Mammalian Cells STEFAN GRIP1, ANNA RISING1, HELENA NIMMERVOLL1, ERICA STORCKENFELDT1, SIMON J. MCQUEEN-MASON2, NATALIA POUCHKINA-STANTCHEVA2, FRITZ VOLLRATH3, WILHELM ENGSTRÖM1 and ARMANDO FERNANDEZ-ARIAS1 1Department of Biosciences and Veterinary Public Health, Faculty of Veterinary Medicine, Swedish University of Agricultural Sciences, PO Box 7028, 75007 Uppsala, Sweden; 2CNAP, Department of Biology, Area 8, University of York, York YO105YW; 3Department of Zoology, University of Oxford, Sourth Parks Road, Oxford OX13PS, U.K. Abstract. Spider silk possesses extraordinary and unsurpassed mass, the proportion of the implant relative to the mechanical properties and several attempts have been made to remaining bone increases, generating a biomechanical artificially produce spider silk in order to manufacture strong disadvantage to the limb (3). Finally, grafted bone does not and light engineering composites. In the field of oncology, always succeed in replacing the deficient bone mass (3). recombinant spider silk has the potential to be used as a Most attempts to replace bone have been based on biomaterial for bone replacement after tumour surgery. In this transplantation of homologous bone tissue. However, the study, a 636-base pair gene fragment, coding for a part of use of allograft bone has a number of potential risks, e.g., major ampullate spidroin 1 from the African spider, the transfer of viruses or prions. Even though autologous Euprosthenops sp., was cloned into the expression vector bone grafts, fresh-frozen allografts, freeze-dried allografts pSecTag2/Hygro A, designed for the production of protein in and demineralised bone matrix are still frequently used, mammalian cells.
    [Show full text]
  • High-Yield Production of Amyloid-Β Peptide Enabled by a Customized
    www.nature.com/scientificreports OPEN High-yield Production of Amyloid-β Peptide Enabled by a Customized Spider Silk Domain Axel Abelein1, Gefei Chen1, Kristīne Kitoka2, Rihards Aleksis2, Filips Oleskovs2, Médoune Sarr1, Michael Landreh3, Jens Pahnke4,5,6, Kerstin Nordling1, Nina Kronqvist1, Kristaps Jaudzems2, Anna Rising1,7, Jan Johansson1 & Henrik Biverstål1,2* During storage in the silk gland, the N-terminal domain (NT) of spider silk proteins (spidroins) keeps the aggregation-prone repetitive region in solution at extreme concentrations. We observe that NTs from diferent spidroins have co-evolved with their respective repeat region, and now use an NT that is distantly related to previously used NTs, for efcient recombinant production of the amyloid-β peptide (Aβ) implicated in Alzheimer’s disease. A designed variant of NT from Nephila clavipes fagelliform spidroin, which in nature allows production and storage of β-hairpin repeat segments, gives exceptionally high yields of diferent human Aβ variants as a solubility tag. This tool enables efcient production of target peptides also in minimal medium and gives up to 10 times more isotope-labeled monomeric Aβ peptides per liter bacterial culture than previously reported. Orb-weaving spiders manufacture up to seven diferent silks, e.g. dragline silk derived from major ampullate silk proteins (spidroins, MaSp) and fagelliform silk derived from fagelliform spidroins (FlSp). Te various spidroins share a common architecture - a large core repetitive region capped by globular N- and C-terminal domains (NT and CT)1. Te divergent and large aggregation-prone repetitive regions of the spidroins determine the mechanical properties of the respective spider silks, while the terminal domains regulate silk fber formation2,3.
    [Show full text]
  • Artificial Spider Silk
    Artificial Spider Silk Recombinant Production and Determinants for Fiber Formation Stefan Grip Faculty of Veterinary Medicine and Animal Science Department of Biomedical Sciences and Veterinary Public Health and Department of Anatomy, Physiology and Biochemistry Uppsala Doctoral Thesis Swedish University of Agricultural Sciences Uppsala 2008 Acta Universitatis agriculturae Sueciae 2008:100 Cover: Female Euprosthenops australis (photo: A. Rising). ISSN 1652-6880 ISBN 978-91-861-9533-5 © 2008 Stefan Grip, Uppsala Tryck: SLU Service/Repro, Uppsala 2008 Artificial Spider Silk - Recombinant Production and Determinants for Fiber Formation Abstract Spider dragline silk is Nature’s high-performance fiber that outperforms the best man-made materials by displaying extraordinary mechanical properties. In addition, spider silk is biocompatible and biodegradable, which makes it suitable as a model for biomaterial production. Dragline silk consists of large structural proteins (spidroins) comprising an extensive region of poly-alanine/glycine-rich tandem repeats, located in between two non-repetitive and folded terminal domains. The spidroins are stored at high concentration in liquid form and are converted to a solid fiber through a poorly understood spinning process. In order to artificially replicate the dragline properties, the protein constituents must be characterized and the silk production pathway elucidated. The large, repetitive sequences of the genes and corresponding proteins have made spidroin analogs difficult to produce in recombinant expression systems. Genetic instability, prematurely terminated synthesis and poor solubility of produced proteins are often observed. This thesis presents a novel method for the efficient recombinant production of a soluble miniaturized spidroin under non-denaturing conditions. The mini-spidroin can be processed under physiological conditions to form fibers with favorable mechanical and cell-compatibility properties, without the use of denaturing spinning procedures or coagulation treatments.
    [Show full text]