OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC211347
S100G (NM_004057) Human Tagged ORF Clone Product data:
Product Type: Expression Plasmids Product Name: S100G (NM_004057) Human Tagged ORF Clone Tag: Myc-DDK Symbol: S100G Synonyms: CABP; CABP1; CABP9K; CALB3 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC211347 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC
ATGAGTACTAAAAAGTCTCCTGAGGAACTGAAGAGGATTTTTGAAAAATATGCAGCCAAAGAAGGTGATC CAGACCAGTTGTCAAAGGATGAACTGAAGCTATTGATTCAGGCTGAATTCCCCAGTTTACTCAAAGGTCC AAACACCCTAGATGATCTCTTTCAAGAACTGGACAAGAATGGAGATGGAGAAGTTAGTTTTGAAGAATTC CAAGTATTAGTAAAAAAGATATCCCAG
ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC211347 protein sequence Red=Cloning site Green=Tags(s)
MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKNGDGEVSFEEF QVLVKKISQ
myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk6589_b03.zip Restriction Sites: SgfI-MluI
This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 S100G (NM_004057) Human Tagged ORF Clone – RC211347
Cloning Scheme:
Plasmid Map:
ACCN: NM_004057 ORF Size: 237 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 S100G (NM_004057) Human Tagged ORF Clone – RC211347
OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_004057.3 RefSeq Size: 453 bp RefSeq ORF: 240 bp Locus ID: 795 UniProt ID: P29377 MW: 9 kDa
Gene Summary: This gene encodes calbindin D9K, a vitamin D-dependent calcium-binding protein. This cytosolic protein belongs to a family of calcium-binding proteins that includes calmodulin, parvalbumin, troponin C, and S100 protein. In the intestine, the protein is vitamin D- dependent and its expression correlates with calcium transport activity. The protein may increase Ca2+ absorption by buffering Ca2+ in the cytoplasm and increase ATP-dependent Ca2+ transport in duodenal basolateral membrane vesicles. [provided by RefSeq, Jul 2008]
Product images:
Western blot validation of overexpression lysate (Cat# [LY418249]) using anti-DDK antibody (Cat# [TA50011-100]). Left: Cell lysates from un- transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC211347 using transfection reagent MegaTran 2.0 (Cat# [TT210002]).
This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3