DOCSLIB.ORG

Differential Gene Regulation in Fibroblasts in Co-Culture with Keratinocytes and Head and Neck SCC Cells

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Differential Gene Regulation in Fibroblasts in Co-Culture with Keratinocytes and Head and Neck SCC Cells ANTICANCER RESEARCH 35: 3253-3266 (2015) Differential Gene Regulation in Fibroblasts in Co-culture with Keratinocytes and Head and Neck SCC Cells MALIN HAKELIUS1, DANIEL SAIEPOUR1, HANNA GÖRANSSON2, KRISTOFER RUBIN3, BENGT GERDIN1 and DANIEL NOWINSKI1 Departments of 1Surgical Sciences, Plastic Surgery and 3Medical Biochemistry and Microbiology, Uppsala University, Uppsala, Sweden; 2Array Facility, Department of Medical Sciences, Uppsala University, Uppsala, Sweden Abstract. Background: While carcinoma-associated growth. In cancers, this microenvironment, or tumor stroma, fibroblasts (CAFs) support tumorigenesis, normal tissue constitutes the backbone of the tumor and is essential for the fibroblasts suppress tumor progression. Mechanisms behind cohesiveness of the tumor tissue the tumor’s ability to thrive conversion of fibroblasts into a CAF phenotype are largely (1). This stroma has considerable similarities with that of unrevealed. Materials and Methods: Transwell co-cultures non-malignant repair processes that are characterized by with fibroblasts in collagen gels and squamous-cell activation of fibroblasts and neoformation of stromal tissue, carcinoma (SCC) cells or normal oral keratinocytes (NOKs) which has led to the concept of a tumor as a "wound that in inserts. Differences in fibroblast global gene expression never heals" (2). were analyzed using Affymetrix arrays and subsequent A fibroblast phenotype characterized by expression of functional annotation and cluster analysis, as well as gene alpha-smooth muscle actin (SMA), platelet-derived growth set enrichment analysis were performed. Results: There were factor receptor-beta (PDGFR-β) and the pericyte marker 52 up-regulated and 30 down-regulated transcript IDs neuron glial antigen 2 (NG2) is regarded as a key cell in the (>2-fold, p<0.05) in fibroblasts co-cultured with SCC tumor stroma (3). Accordingly, this phenotype has been compared to NOKs. Functional analysis demonstrated an denoted “cancer-associated fibroblast”, CAF. It has been enrichment of collagen-related genes. There were similarities proposed that the CAF phenotype is the result of a reciprocal with gene sets reflecting a non-specific, innate–type response signaling between tumor cells and stromal fibroblasts (3). with activation of both interferon pathways and connective However, the nature of such signaling is only partially tissue turnover. Conclusion: There were distinct differences studied as there exist differences in signaling between benign in fibroblast gene expression between the co-culture types. proliferating keratinocytes and stromal cells in a healing Many were in genes related to an innate-type of response wound and the corresponding process in malignant tissue. and to connective tissue turnover. Two phenomena are worth mentioning. First, keratinocytes from the wound edge transiently exhibit many similarities to Tumors arise as consequences of genetic alterations in their transformed counterparts in squamous-cell carcinomas normal cells, which -in turn- result in a loss of cellular (SCCs) (4). Second, the stroma of a healing wound also growth control. In addition, tumor progression requires an contains cells with characteristics similar to those of the aberrant microenvironment that supports further tumor CAFs. Thus, similarities, as well as differences, in the interaction between the malignant keratinocyte phenotype and stromal cells, compared to the interaction between Abbreviations: CAF: Carcinoma associated fibroblasts; NOKs: benign keratinocytes and stromal cells, may be expected. normal oral keratinocytes; SCC: squamous cell carcinoma. The origin of the CAFs has not been established with certainty. Current information suggests that CAFs may be Correspondence to: Daniel Nowinski, MD, Ph.D., Department of derived from a variety of sources. Three main hypotheses Plastic and Maxillofacial Surgery, Uppsala University Hospital, 751 have been proposed. First, it has been suggested that CAFs 85 Uppsala, Sweden. Tel: +46 738664625, e-mail: daniel. [email protected] are recruited locally from resident cells in the vicinity of a growing and spreading tumor, including normal tissue Key Words: Head and neck cancer, keratinocytes, differential gene fibroblasts and tissue mesenchymal stem cells (MSCs). regulation, array. Second, bone marrow-derived cells with an ability to 0250-7005/2015 $2.00+.40 3253 ANTICANCER RESEARCH 35: 3253-3266 (2015) differentiate into fibroblast phenotypes have been shown to Co-culture. Fibroblasts were cultured in collagen gels. Briefly, a migrate to areas of proliferating tumor cells. Finally, other cold solution of 1.6 ml collagen type I (Vitrogen, Cohesion, Palo cell types, e.g. pericytes, myoepithelial cells and endothelial Alto, CA, USA), 0.15 ml (10×) Hank’s balanced salt solution (10xHBSS) and 0.15 ml fetal bovine serum (FBS) with or without cells, are thought to transdifferentiate towards a tumor fibroblasts (2×105/well) was pH-adjusted to pH 7.4 with 5 M NaOH fibroblast-like population (3). and added to 6-well plates. After polymerization at 37˚C, 2 ml Using co-culture systems we have previously shown that DMEM with 10% bovine calf serum (HyClone) was added to each normal keratinocytes from both skin and the oral cavity well. Normal oral keratinocytes or malignant keratinocytes (UT- decrease profibrotic characteristics of fibroblasts through SCC-87), in passage 16 or 17, were seeded in Falcon polyurethane humoral mechanisms, which -at least in part- involve release cell culture inserts (4.0 μm pore diameter). The inserts were pre- of interleukin-1α (IL-1α) from the epithelial cells (5-7). incubated with a mixture of 10 μg/ml bovine plasma fibronectin (Gibco BRL/Life Technology, Paisley, UK), 30 μg/ml bovine Furthermore, this down-regulation was more pronounced in collagen (Vitrogen) and 10 μg/ml bovine serum albumin (Sigma) co-cultures with normal oral keratinocytes (NOKs) than with for 2 h at 37˚C. NOKs and malignant oral keratinocytes were seeded oral SSC cells (5). This observation forms the basis for the in inserts, both in DMEM: HAM’s F12 (4:1) supplemented with present study, which investigates the differential effect of 5 μg/ml Zn-free insulin (Sigma Chemical Co.), 2 nM 3,3’,5-triido- NOKs and SCC on overall fibroblast gene expression D-thyronine (Sigma), 0.4 μg/ml hydrocortisone (Sigma), 0.1 nM through humoral communication, utilizing a conventional cholera toxin (Sigma), 10 ng/ml EGF (Austral Biologicals, San array approach. The aim of the study was to reveal to what Ramon, CA, USA), 24 μg/ml adenine, 10% fetal bovine serum (HyClone) and 50 μg/ml gentamicin. After 24 h, the medium was extent there exist differences in overall gene expression at a changed in wells and in inserts to 2 ml DMEM/Ham’s F12 (4:1) cluster level that reflects qualitative differences in fibroblast supplemented with 0.5% FCS in each. Inserts and wells with cell response after a humoral interaction with benign versus collagen gels were combined and propagated as co-cultures for an malignant epithelial cells. An additional aim is to determine additional 48 h. As controls, 0.15×106 fibroblasts were seeded in whether such differences exhibit similarities with publicly inserts instead of keratinocytes. Experiments were performed with presented gene expression profiles or molecular signatures. different seeding concentrations of NOKs and malignant keratinocytes and the number of cells was assessed with a cell- Materials and Methods counter (Z2 Cell and Particle Counter; Beckman Coulter AB, City, CA, USA) after 48 h. The reason for the different seeding-numbers for normal and malignant cells was to compensate for an observed Cells. A head and neck SCC (UT-SCC-87) cell line established at higher proliferation of malignant cells. After titration with different the University of Turku, Finland, was used in this study. The cell seeding densities, concentrations of 0.30×106 for NOKs and line was established from a previously untreated primary tumor of 0.16×106 for malignant cells were chosen for the experiments. In the mobile tongue in a 29-year-old female patient presenting with a this way, the average cell number at the termination of the co- T3N1M0 grade 1 SCC. The methods used in establishing and cultures was 0.45×106 for NOKs and 0.43×106 for malignant cells, characterizing the cell line have been described previously (8, 9). and a cell-density of about 80% was reached in all samples at the NOKs were obtained from the gingiva of a 28-year-old, previously end of the co-culture experiments. healthy, non-smoking male. Human primary dermal fibroblasts were obtained from patients undergoing reconstructive breast surgery at RNA extraction. Collagen gels were dissolved and RNA was the Department of Plastic Surgery, Uppsala University Hospital. extracted using a modification of the one-step-phenol-chloroform Fibroblasts from one healthy female were used for the experiments. method (11). Gels were dissolved in TRIzol reagent (Life Approval from the local ethics committee (Uppsala University) was Technology) under extensive vortex mixing. The amount and the obtained (Dnr 2005:332). This approval entails written informed quality of RNA were determined using the Agilent Bioanalyzer consent and written patient information. 2100 (Agilent Technology, Kista, Sweden). Cellular isolation and culture. Mucosal samples were treated with Microarray expression analysis. Three different experiments with dispase and the epithelium was mechanically separated from the duplicates were done with fibroblasts,
Load more

Recommended publications
  • BIOINFORMATICS DOI: 10.1093/Bioinformatics/Btg1030
    Vol. 19 Suppl. 1 2003, pages i222–i224 BIOINFORMATICS DOI: 10.1093/bioinformatics/btg1030 GeneLoc: exon-based integration of human genome maps Naomi Rosen, Vered Chalifa-Caspi, Orit Shmueli, Avital Adato, Michal Lapidot, Julie Stampnitzky, Marilyn Safran ∗ and Doron Lancet Weizmann Institute of Science, Rehovot, Israel Received on January 6, 2003; accepted on February 20, 2003 ABSTRACT to provide a comprehensive gene list, NCBI’s LocusLink Motivation: Despite the numerous available whole- contains thousands of model genes, categorized by level genome mapping resources, no comprehensive, inte- and type of support. Even known genes appearing in every grated map of the human genome yet exists. database may have different names in each database. The Results: GeneLoc, software adjunct to GeneCards and biologist must move among databases to figure out which UDB, integrates gene lists by comparing genomic coordi- genes are the same, and which could be a novel gene nates at the exon level and assigns unique and meaningful sought. UCSC’s Genome Browser website maps genes identifiers to each gene. from several sources on the same scale, but the maps are Availability: http://bioinfo.weizmann.ac.il/genecards and not integrated, making it difficult to relate genes from http://genecards.weizmann.ac.il/udb different sources. As stated (Jongeneel, 2000),‘there is an Supplementary information: http://bioinfo.weizmann.ac. urgent need for a human gene index that can be used to il/cards-bin/AboutGCids.cgi, http://genecards.weizmann. identify transcripts unambiguously.’ The author contends ac.il/GeneLocAlg.html that this index should have, among others, the following Contact: [email protected] qualities: comprehensiveness, uniqueness, and stability.
    [Show full text]
  • Genetic Variations in the PSMA6 and PSMC6 Proteasome Genes Are Associated with Multiple Sclerosis and Response to Interferon‑Β Therapy in Latvians
    EXPERIMENTAL AND THERAPEUTIC MEDICINE 21: 478, 2021 Genetic variations in the PSMA6 and PSMC6 proteasome genes are associated with multiple sclerosis and response to interferon‑β therapy in Latvians NATALIA PARAMONOVA1, JOLANTA KALNINA1, KRISTINE DOKANE1, KRISTINE DISLERE1, ILVA TRAPINA1, TATJANA SJAKSTE1 and NIKOLAJS SJAKSTE1,2 1Genomics and Bioinformatics, Institute of Biology of The University of Latvia; 2Department of Medical Biochemistry of The University of Latvia, LV‑1004 Riga, Latvia Received July 8, 2020; Accepted December 8, 2020 DOI: 10.3892/etm.2021.9909 Abstract. Several polymorphisms in genes related to the Introduction ubiquitin‑proteasome system exhibit an association with pathogenesis and prognosis of various human autoimmune Multiple sclerosis (MS) is a lifelong demyelinating disease of diseases. Our previous study reported the association the central nervous system. The clinical onset of MS tends to between multiple sclerosis (MS) and the PSMA3‑rs2348071 be between the second and fourth decade of life. Similarly to polymorphism in the Latvian population. The current study other autoimmune diseases, women are affected 3‑4 times more aimed to evaluate the PSMA6 and PSMC6 genetic variations, frequently than men (1). About 10% of MS patients experience their interaction between each other and with the rs2348071, a primary progressive MS form characterized by the progres‑ on the susceptibility to MS risk and response to therapy in sion of neurological disability from the onset. In about 90% the Latvian population. PSMA6‑rs2277460, ‑rs1048990 and of MS patients, the disease undergoes the relapse‑remitting PSMC6‑rs2295826, ‑rs2295827 were genotyped in the MS MS course (RRMS); in most of these patients, the condition case/control study and analysed in terms of genotype‑protein acquires secondary progressive course (SPMS) (2).
    [Show full text]
  • Identification and Classification of Differentially Expressed Genes
    Informatics in Medicine Unlocked 20 (2020) 100384 Contents lists available at ScienceDirect Informatics in Medicine Unlocked journal homepage: http://www.elsevier.com/locate/imu Identification and classification of differentially expressed genes reveal potential molecular signature associated with SARS-CoV-2 infection in lung adenocarcinomal cells Opeyemi S. Soremekun, Kehinde F. Omolabi, Mahmoud E.S. Soliman * Molecular Bio-computation and Drug Design Laboratory, School of Health Sciences, University of KwaZulu-Natal, Westville Campus, Durban, 4001, South Africa ARTICLE INFO ABSTRACT Keywords: Genomic techniques such as next-generation sequencing and microarrays have facilitated the identification and Differentially expressed genes classification of molecular signatures inherent in cells upon viral infection, for possible therapeutic targets. SARS-CoV-2 Therefore, in this study, we performed a differential gene expression analysis, pathway enrichment analysis, and COVID-19 gene ontology on RNAseq data obtained from SARS-CoV-2 infected A549 cells. Differential expression analysis Enrichment analysis revealed that 753 genes were up-regulated while 746 down-regulated. SNORA81, OAS2, SYCP2, LOC100506985, RNAseq and SNORD35B are the top 5 upregulated genes upon SARS-Cov-2 infection. Expectedly, these genes have been implicated in the immune response to viral assaults. In the Ontology of protein classification, a high percentage of the genes are classified as Gene-specific transcriptional regulator, metabolite interconversion enzyme, and Protein modifying enzymes. Twenty pathways with P-value lower than 0.05 were enriched in the up-regulated genes while 18 pathways are enriched in the down-regulated DEGs. The toll-like receptor signalling pathway is one of the major pathways enriched. This pathway plays an important role in the innate immune system by identifying the pathogen-associated molecular signature emanating from various microorganisms.
    [Show full text]
  • A Genetic Variant Protective Against Severe COVID-19 Is Inherited from Neandertals
    bioRxiv preprint doi: https://doi.org/10.1101/2020.10.05.327197; this version posted October 9, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. A genetic variant protective against severe COVID-19 is inherited from Neandertals Authors Hugo Zeberg1,2* and Svante Pääbo1,3* Affiliations 1 Max Planck Institute for Evolutionary Anthropology, Deutscher Platz 6, D-04103 Leipzig, Germany. 2 Department of Neuroscience, Karolinska Institutet, SE-17177 Stockholm, Sweden. 3 Okinawa Institute of Science and Technology, Onna-son, Okinawa 904-0495, Japan. *Corresponding authors: [email protected], [email protected] Abstract It was recently shown that the major genetic risk factor associated with becoming severely ill with COVID-19 when infected by SARS-CoV-2 is inherited from Neandertals. Thanks to new genetic association studies additional risk factors are now being discovered. Using data from a recent genome- wide associations from the Genetics of Mortality in Critical Care (GenOMICC) consortium, we show that a haplotype at a region associated with requiring intensive care is inherited from Neandertals. It encodes proteins that activate enzymes that are important during infections with RNA viruses. As compared to the previously described Neandertal risk haplotype, this Neandertal haplotype is protective against severe COVID-19, is of more moderate effect, and is found at substantial frequencies in all regions of the world outside Africa. 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.10.05.327197; this version posted October 9, 2020.
    [Show full text]
  • Datasheet A02938-1 Anti-LGALS3BP Antibody
    Product datasheet Anti-LGALS3BP Antibody Catalog Number: A02938-1 BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected] Basic Information Product Name Anti-LGALS3BP Antibody Gene Name LGALS3BP Source Rabbit IgG Species Reactivity human,mouse Tested Application WB,IHC-P Contents 500ug/ml antibody with PBS ，0.02% NaN3 , 1mg BSA and 50% glycerol. Immunogen A synthetic peptide corresponding to a sequence of human LGALS3BP (HEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPR). Purification Immunogen affinity purified. Observed MW 65KD Dilution Ratios Western blot: 1:500-2000 Immunohistochemistry in paraffin section: 1:50-400 (Boiling the paraffin sections in 10mM citrate buffer,pH6.0,or PH8.0 EDTA repair liquid for 20 mins is required for the staining of formalin/paraffin sections.) Optimal working dilutions must be determined by end user. Storage 12 months from date of receipt，-20℃ as supplied.6 months 2 to 8℃ after reconstitution. Avoid repeated freezing and thawing Background Information Galectin-3-binding protein is a protein that in humans is encoded by the LGALS3BP gene. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 90K cDNA has been localized to chromosome 17q25.
    [Show full text]
  • Genome Analysis and Knowledge
    Dahary et al. BMC Medical Genomics (2019) 12:200 https://doi.org/10.1186/s12920-019-0647-8 SOFTWARE Open Access Genome analysis and knowledge-driven variant interpretation with TGex Dvir Dahary1*, Yaron Golan1, Yaron Mazor1, Ofer Zelig1, Ruth Barshir2, Michal Twik2, Tsippi Iny Stein2, Guy Rosner3,4, Revital Kariv3,4, Fei Chen5, Qiang Zhang5, Yiping Shen5,6,7, Marilyn Safran2, Doron Lancet2* and Simon Fishilevich2* Abstract Background: The clinical genetics revolution ushers in great opportunities, accompanied by significant challenges. The fundamental mission in clinical genetics is to analyze genomes, and to identify the most relevant genetic variations underlying a patient’s phenotypes and symptoms. The adoption of Whole Genome Sequencing requires novel capacities for interpretation of non-coding variants. Results: We present TGex, the Translational Genomics expert, a novel genome variation analysis and interpretation platform, with remarkable exome analysis capacities and a pioneering approach of non-coding variants interpretation. TGex’s main strength is combining state-of-the-art variant filtering with knowledge-driven analysis made possible by VarElect, our highly effective gene-phenotype interpretation tool. VarElect leverages the widely used GeneCards knowledgebase, which integrates information from > 150 automatically-mined data sources. Access to such a comprehensive data compendium also facilitates TGex’s broad variant annotation, supporting evidence exploration, and decision making. TGex has an interactive, user-friendly, and easy adaptive interface, ACMG compliance, and an automated reporting system. Beyond comprehensive whole exome sequence capabilities, TGex encompasses innovative non-coding variants interpretation, towards the goal of maximal exploitation of whole genome sequence analyses in the clinical genetics practice. This is enabled by GeneCards’ recently developed GeneHancer, a novel integrative and fully annotated database of human enhancers and promoters.
    [Show full text]
  • Pancreatic Cancer Invasion of the Lymphatic Vasculature and Contributions of the Tumor Microenvironment: Roles for E- Selectin and CXCR4
    University of Nebraska Medical Center DigitalCommons@UNMC Theses & Dissertations Graduate Studies Fall 12-16-2016 Pancreatic Cancer Invasion of the Lymphatic Vasculature and Contributions of the Tumor Microenvironment: Roles for E- selectin and CXCR4 Maria M. Steele University of Nebraska Medical Center Follow this and additional works at: https://digitalcommons.unmc.edu/etd Recommended Citation Steele, Maria M., "Pancreatic Cancer Invasion of the Lymphatic Vasculature and Contributions of the Tumor Microenvironment: Roles for E-selectin and CXCR4" (2016). Theses & Dissertations. 166. https://digitalcommons.unmc.edu/etd/166 This Dissertation is brought to you for free and open access by the Graduate Studies at DigitalCommons@UNMC. It has been accepted for inclusion in Theses & Dissertations by an authorized administrator of DigitalCommons@UNMC. For more information, please contact [email protected]. i PANCREATIC CANCER INVASION OF THE LYMPHATIC VASCULATURE AND CONTRIBUTIONS OF THE TUMOR MICROENVIRONMENT: ROLES FOR E-SELECTIN AND CXCR4 By Maria M. Steele A DISSERTATION Presented to the Faculty of the University of Nebraska Graduate College in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy Cancer Research Graduate Program Under the Supervision of Professor Michael A. Hollingsworth University of Nebraska Medical Center Omaha, NE November, 2016 Supervisory Committee Michael A. Hollingsworth, Ph.D. Kaustubh Datta, Ph.D. Angie Rizzino, Ph.D. Joyce C. Solheim, Ph.D. ii PANCREATIC CANCER INVASION OF THE LYMPHATIC VASCULATURE AND CONTRIBUTIONS OF THE TUMOR MICROENVIRONMENT: ROLES FOR E-SELECTIN AND CXCR4 Maria M. Steele University of Nebraska, 2016 Advisor: Michael A. Hollingsworth ABSTRACT As the fourth leading cause of cancer-related deaths, pancreatic cancer is one of the most lethal forms of cancers in the United States.
    [Show full text]
  • Full Review Molecular Disease Presentation in Diabetic Nephropathy
    Nephrol Dial Transplant (2015) 30: iv17–iv25 doi: 10.1093/ndt/gfv267 Full Review Molecular disease presentation in diabetic nephropathy Downloaded from https://academic.oup.com/ndt/article/30/suppl_4/iv17/2324968 by guest on 25 September 2021 Andreas Heinzel1, Irmgard Mühlberger1, Gil Stelzer2, Doron Lancet2, Rainer Oberbauer3, Maria Martin4 and Paul Perco1 1emergentec biodevelopment GmbH, Vienna, Austria, 2Weizmann Institute of Science, Rehovot, Israel, 3Medical University of Vienna, Vienna, Austria and 4EMBL-EBI, Wellcome Trust Genome Campus, Hinxton, UK Correspondence and offprint requests to: Paul Perco; E-mail: [email protected] ABSTRACT INTRODUCTION Diabetic nephropathy, as the most prevalent chronic disease of Kidney disease is a common problem in patients with diabetes. the kidney, has also become the primary cause of end-stage Depending on the degree of GFR impairment and/or albumin- renal disease with the incidence of kidney disease in type 2 dia- uria, roughly 30% of subjects are affected. As with most betics continuously rising. As with most chronic diseases, the diabetes-associated comorbidities, the pathophysiology is pathophysiology is multifactorial with a number of deregulated multifactorial and the molecular pathways involved in the ini- molecular processes contributing to disease manifestation and tiation and progression constitute a wide and complex as well as progression. Current therapy mainly involves interfering in the redundant network of regulators. Considerable success has renin–angiotensin–aldosterone
    [Show full text]
  • Primepcr™Assay Validation Report
    PrimePCR™Assay Validation Report Gene Information Gene Name interferon, alpha-inducible protein 27 Gene Symbol IFI27 Organism Human Gene Summary Description Not Available Gene Aliases FAM14D, ISG12, ISG12A, P27 RefSeq Accession No. NC_000014.8, NT_026437.12 UniGene ID Hs.532634 Ensembl Gene ID ENSG00000165949 Entrez Gene ID 3429 Assay Information Unique Assay ID qHsaCEP0024638 Assay Type Probe - Validation information is for the primer pair using SYBR® Green detection Detected Coding Transcript(s) ENST00000557098, ENST00000298902, ENST00000557634, ENST00000555744, ENST00000444961, ENST00000448882 Amplicon Context Sequence GAGCAACTGGACTCTCCGGATTGACCAAGTTCATCCTGGGCTCCATTGGGTCTG CCATTGCGGCTGTCATTGCGAGGTTCTACTAGCTCCCTGCCCCTCGCCCTGCAG AGAAGAGAACCATGCCAGGGGAGAAGGCACCCAGCCA Amplicon Length (bp) 115 Chromosome Location 14:94582779-94582923 Assay Design Exonic Purification Desalted Validation Results Efficiency (%) 100 R2 0.9997 cDNA Cq 23.09 cDNA Tm (Celsius) 86 gDNA Cq 23.06 Specificity (%) 100 Information to assist with data interpretation is provided at the end of this report. Page 1/4 PrimePCR™Assay Validation Report IFI27, Human Amplification Plot Amplification of cDNA generated from 25 ng of universal reference RNA Melt Peak Melt curve analysis of above amplification Standard Curve Standard curve generated using 20 million copies of template diluted 10-fold to 20 copies Page 2/4 PrimePCR™Assay Validation Report Products used to generate validation data Real-Time PCR Instrument CFX384 Real-Time PCR Detection System Reverse Transcription Reagent iScript™ Advanced cDNA Synthesis Kit for RT-qPCR Real-Time PCR Supermix SsoAdvanced™ SYBR® Green Supermix Experimental Sample qPCR Human Reference Total RNA Data Interpretation Unique Assay ID This is a unique identifier that can be used to identify the assay in the literature and online. Detected Coding Transcript(s) This is a list of the Ensembl transcript ID(s) that this assay will detect.
    [Show full text]
  • Secretion and LPS-Induced Endotoxin Shock Α Lipopolysaccharide
    IFIT2 Is an Effector Protein of Type I IFN− Mediated Amplification of Lipopolysaccharide (LPS)-Induced TNF- α Secretion and LPS-Induced Endotoxin Shock This information is current as of September 27, 2021. Alexandra Siegfried, Susanne Berchtold, Birgit Manncke, Eva Deuschle, Julia Reber, Thomas Ott, Michaela Weber, Ulrich Kalinke, Markus J. Hofer, Bastian Hatesuer, Klaus Schughart, Valérie Gailus-Durner, Helmut Fuchs, Martin Hrabe de Angelis, Friedemann Weber, Mathias W. Hornef, Ingo B. Autenrieth and Erwin Bohn Downloaded from J Immunol published online 6 September 2013 http://www.jimmunol.org/content/early/2013/09/06/jimmun ol.1203305 http://www.jimmunol.org/ Supplementary http://www.jimmunol.org/content/suppl/2013/09/06/jimmunol.120330 Material 5.DC1 Why The JI? Submit online. by guest on September 27, 2021 • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2013 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. Published September 6, 2013, doi:10.4049/jimmunol.1203305 The Journal of Immunology IFIT2 Is an Effector Protein of Type I IFN–Mediated Amplification of Lipopolysaccharide (LPS)-Induced TNF-a Secretion and LPS-Induced Endotoxin Shock Alexandra Siegfried,*,1 Susanne Berchtold,*,1 Birgit Manncke,* Eva Deuschle,* Julia Reber,* Thomas Ott,† Michaela Weber,‡ Ulrich Kalinke,x Markus J.
    [Show full text]
  • The 50Th Anniversary of the Discovery of Trisomy 21: the Past, Present, and Future of Research and Treatment of Down Syndrome
    REVIEW The 50th anniversary of the discovery of trisomy 21: The past, present, and future of research and treatment of Down syndrome Andre´Me´garbane´, MD, PhD1,2, Aime´ Ravel, MD1, Clotilde Mircher, MD1, Franck Sturtz, MD, PhD1,3, Yann Grattau, MD1, Marie-Odile Rethore´, MD1, Jean-Maurice Delabar, PhD4, and William C. Mobley, MD, PhD5 Abstract: Trisomy 21 or Down syndrome is a chromosomal disorder HISTORICAL REVIEW resulting from the presence of all or part of an extra Chromosome 21. Clinical description It is a common birth defect, the most frequent and most recognizable By examining artifacts from the Tumaco-La Tolita culture, form of mental retardation, appearing in about 1 of every 700 newborns. which existed on the border between current Colombia and Although the syndrome had been described thousands of years before, Ecuador approximately 2500 years ago, Bernal and Briceno2 it was named after John Langdon Down who reported its clinical suspected that certain figurines depicted individuals with Tri- description in 1866. The suspected association of Down syndrome with somy 21, making these potteries the earliest evidence for the a chromosomal abnormality was confirmed by Lejeune et al. in 1959. existence of the syndrome. Martinez-Frias3 identified the syn- Fifty years after the discovery of the origin of Down syndrome, the term drome in a terra-cotta head from the Tolteca culture of Mexico “mongolism” is still inappropriately used; persons with Down syn- in 500 patients with AD in which the facial features of Trisomy drome are still institutionalized. Health problems associated with that 21 are clearly displayed.
    [Show full text]
  • Small Nucleolar Rnas Determine Resistance to Doxorubicin in Human Osteosarcoma
    International Journal of Molecular Sciences Article Small Nucleolar RNAs Determine Resistance to Doxorubicin in Human Osteosarcoma Martina Godel 1, Deborah Morena 1, Preeta Ananthanarayanan 1, Ilaria Buondonno 1, Giulio Ferrero 2,3 , Claudia M. Hattinger 4, Federica Di Nicolantonio 1,5 , Massimo Serra 4 , 1 2 1, , 1, , Riccardo Taulli , Francesca Cordero , Chiara Riganti * y and Joanna Kopecka * y 1 Department of Oncology, University of Torino, 1026 Torino, Italy; [email protected] (M.G.); [email protected] (D.M.); [email protected] (P.A.); [email protected] (I.B.); [email protected] (F.D.N.); [email protected] (R.T.) 2 Department of Computer Science, University of Torino, 10149 Torino, Italy; [email protected] (G.F.); [email protected] (F.C.) 3 Department of Clinical and Biological Sciences, University of Torino, 10043 Orbassano, Italy 4 Laboratory of Experimental Oncology, Pharmacogenomics and Pharmacogenetics Research Unit, IRCCS Istituto Ortopedico Rizzoli, 40136 Bologna, Italy; [email protected] (C.M.H.); [email protected] (M.S.) 5 Candiolo Cancer Institute, FPO–IRCCS, 10060 Candiolo, Italy * Correspondence: [email protected] (C.R.); [email protected] (J.K.); Tel.: +39-0116705857 (C.R.); +39-0116705849 (J.K.) These authors equally contributed to this work. y Received: 31 May 2020; Accepted: 21 June 2020; Published: 24 June 2020 Abstract: Doxorubicin (Dox) is one of the most important first-line drugs used in osteosarcoma therapy. Multiple and not fully clarified mechanisms, however, determine resistance to Dox. With the aim of identifying new markers associated with Dox-resistance, we found a global up-regulation of small nucleolar RNAs (snoRNAs) in human Dox-resistant osteosarcoma cells.
    [Show full text]