DOCSLIB.ORG

BCAP31, a Cancer/Testis Antigen-Like Protein, Can Act As a Probe for Non

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
BCAP31, a Cancer/Testis Antigen-Like Protein, Can Act As a Probe for Non www.nature.com/scientificreports OPEN BCAP31, a cancer/testis antigen- like protein, can act as a probe for non-small-cell lung cancer metastasis Jing Wang1,4, Dongbo Jiang1,4, Zichao Li1,4, Shuya Yang1,4, Jiayi Zhou1, Guanwen Zhang1, Zixin Zhang1, Yuanjie Sun1, Zhipei Zhang2, Xiaofei Li2, Liang Tao1, Jingqi Shi1, Yuchen Lu1, Lianhe Zheng3, Chaojun Song1* & Kun Yang1* Non-small-cell lung cancer (NSCLC) represents most of lung cancers, is often diagnosed at an advanced metastatic stage. Therefore, exploring the mechanisms underlying metastasis is key to understanding the development of NSCLC. The expression of B cell receptor-associated protein 31 (BCAP31), calreticulin, glucose-regulated protein 78, and glucose-regulated protein 94 were analyzed using immunohistochemical staining of 360 NSCLC patients. It resulted that the high-level expression of the four proteins, but particularly BCAP31, predicted inferior overall survival. What’s more, BCAP31 was closely associated with histological grade and p53 status, which was verifed by seven cohorts of NSCLC transcript microarray datasets. Then, three NSCLC cell lines were transfected to observe behavior changes BCAP31 caused, we found the fuctuation of BCAP31 signifcantly infuenced the migration, invasion of NSCLC cells. To identify the pathway utilized by BCAP31, Gene Set Enrichment Analysis was frstly performed, showing Akt/m-TOR/p70S6K pathway was the signifcant one, which was verifed by immunofuorescence, kinase phosphorylation and cellular behavioral observations. Finally, the data of label-free mass spectroscopy implied that BCAP31 plays a role in a fundamental biological process. This study provides the frst demonstration of BCAP31 as a novel prognostic factor related to metastasis and suggests a new therapeutic strategy for NSCLC. Lung cancer is one of the most prevalent neoplasms and the leading cause of cancer-related death worldwide, being responsible for nearly one in fve cases1. Non-small-cell lung cancer (NSCLC) contributes to 85% of lung cancer cases. Owing to the absence of clinical symptoms and efective screening programs, most lung cancers are diagnosed at an advanced stage with metastasis. Targeted immunotherapy, including anti-angiogenic and checkpoint monoclonal antibodies or tyrosine kinase inhibitors, demonstrates better efcacy than traditional surgical treatment and radio-chemotherapy, although drug resistance and tumor heterogeneity remain signifcant problems, and metastasis remains the major cause of mortality2. It is therefore important to identify efficient symbolic markers of metastasis and therapeutic targets for NSCLC. Given the aberrant expression of specifc genes in a variety of cancer types, restricted in testis or selected in normal tissue, cancer-testis antigens (CTAs) have emerged as efcient specifc tumor targets which spare nor- mal tissue from incurring damage during treatment3. Originally described in patients with malignant melanoma4, CTAs have been identifed as biomarkers for a diverse range of cancers, including NSCLC5. Teir expression is ofen coordinated6, and associated with poor clinical outcome7 and advanced stage8, particularly metastasis9. Some CTAs have already been used as biomarkers for the diagnosis and prognosis of NSCLC, or as targets in clin- ical trials for vaccine immunotherapy10. According to our previous studies11, B cell receptor-associated protein 31 (BAP31/BCAP31) is a CTA-like protein which is highly expressed in many forms of cancer, including lung cancer. 1Department of Immunology, the Fourth Military Medical University, No.169 Changle W. Rd., Xi’an, 710032, China. 2Department of Thoracic Surgery, Tangdu Hospital, the Fourth Military Medical University, No.169, Changle W. Rd., Xi’an, 710032, China. 3Department of Orthopedics, Tangdu Hospital; the Fourth Military Medical University, No.169, Changle W. Rd., Xi’an, 710032, China. 4These authors contributed equally: Jing Wang, Dongbo Jiang, Zichao Li and Shuya Yang. *email: [email protected]; [email protected] SCIENTIFIC REPORTS | (2020) 10:4025 | https://doi.org/10.1038/s41598-020-60905-7 1 www.nature.com/scientificreports/ www.nature.com/scientificreports Figure 1. B cell receptor-associated protein 31 (BCAP31) expression in NSCLC and para-carcinoma tissue. (A) RT-PCR analysis of two pairs of NSCLC cancerous tissue samples (C1, C2) and their respective para- carcinoma tissues (P1, P2). (B) Western blot analysis of two pairs of NSCLC cancerous tissue samples (C1, C2) and their respective para-carcinoma tissues (P1, P2). β-actin was chosen as the reference protein for western blotting because of three reports from the Gene Set Enrichment Analysis hinting that tubulin could be afected by BCAP31 (Supplementary Table S2 sheets 1–3). (C) Immunohistochemical analysis for BCAP31, CRT, GRP78, and GRP94 performed on tissues from 360 NSCLC patients. (D) Overall survival curves showing the relevance of the expression of four key protein markers and NSCLC patient overall survival. (E) Te presence of the four markers alone, or in combination, resulted in distinct diferences in the overall survival of NSCLC patients. C: cancer tissue; P: para-carcinoma tissue. All experiments were repeated at least three times. BCAP31, located on chromosome Xq28, encodes a 28 kDa polytopic integral protein of the endoplasmic retic- ulum (ER)12. As an evolutionarily conserved molecule, the BCAP31 protein contains three predicted transmem- brane segments within its amino terminus12, and has been implicated in the sorting of a diverse range of ER membrane proteins, as well as participating in the transportation of various molecules from the ER to the Golgi apparatus13. As a substrate of caspase, BCAP31 participates in the crosstalk between ER and mitochondria to regulate apoptosis14. Afer being defned as a novel CTA-like protein, BCAP31 has been correlated with hepato- cellular carcinoma and breast cancer15,16. However, the relationship between BCAP31 and the development of NSCLC remains unclear. It has been reported that ER proteins can infuence cell growth, migration, and invasion through epithelial-mesenchymal transition (EMT), ER stress, and autophagy17–19. We therefore hypothesized that BCAP31, as an ER chaperone, may play a role in NSCLC metastasis. Tus far, studies have failed to identify a precise mechanism by which BCAP31 can regulate NSCLC cells. To validate our hypothesis, the present study began with an evidence-based medical evaluation and exploration of the molecular mechanisms of BCAP31. To the best of our knowledge, this is the frst study to systematically inves- tigate the signifcance and biological function of BCAP31, and provides new understanding of NSCLC develop- ment and metastasis. Results BCAP31 protein expression correlates with NSCLC. First, we investigated the gene and protein expression of BCAP31. Compared to adjacent tissues, NSCLC tissues had higher levels of both BCAP31 gene and protein expression, as assessed using qRT-PCR and western blot analysis (Fig. 1A,B). To investigate the clinical signifcance of BCAP31 in NSCLC, we examined the expression of three well-known tumor markers, calreticulin (CRT), glucose-regulated protein 78 (GRP78) and glucose-regulated protein 94 (GRP94), as parallel control. Te expression of the four proteins was analyzed immunohistochemically using a tissue microarray of samples from 360 NSCLC patients and16 normal controls. Of the elevated levels of the four proteins (Fig. 1C), BCAP31 was sig- nifcantly associated with histological grade (p = 0.017) (Table 1). At the time of analysis, 137 of the 360 patients were still alive, with a median follow-up of 78 months. Kaplan–Meier survival curves were plotted and Fisher’s exact probability test was performed, which indicated that high expression was associated with patient overall survival (Fig. 1D, Table 2). Retrospective χ2 tests demonstrated that clinicopathological stage and histological grade were risk factors for cancer-related death. Multivariate Cox analysis further demonstrated an enhanced survival prediction of their synergetic efect (Fig. 1E), which implied that BCAP31 could represent a new prog- nostic factor. Analysis of seven transcript expression microarray datasets extracted from the Gene Expression Omnibus (GEO) (https://www.ncbi.nlm.nih.gov/geo/) validated the positive correlation of BCAP31 expression SCIENTIFIC REPORTS | (2020) 10:4025 | https://doi.org/10.1038/s41598-020-60905-7 2 www.nature.com/scientificreports/ www.nature.com/scientificreports BCAP31 Expression CRT Expression GRP78 Expression GRP94 Expression All High Low High Low High Low High Low Characteristic Patients (n = 223) (n = 137) P (n = 164) (n = 196) P (n = 157) (n = 203) P (n = 231) (n = 129) P Age, years 0.161 0.328 0.35 0.595 Median 58.5 59.6 56.7 59.3 57.9 59.2 58.0 58.8 58.4 Range 28–77 25–77 28–75 34–77 25–75 34–76 25–77 25–76 37–77 Histological type 0.992 0.348 0.811 0.975 Squamous cell 239 148 91 109 130 104 135 157 82 carcinoma Adenocarcinoma 85 53 32 35 50 40 45 56 29 Large cell carcinoma 36 22 14 20 16 17 19 23 13 Clinico-pathologic stage 0.373 0.114 0.007 0.773 I (Ia + Ib) 139 80 59 54 85 44 95 90 49 II (IIa + IIb) 131 86 45 67 64 66 65 89 42 III (IIIa + IIIb) 90 57 33 43 47 39 51 62 28 Tumor size, cm 0.725 0.052 0.185 0.071 <3 35 20 15 10 25 19 16 21 14 3–7 276 174 102 127 149 112 164 182 94 >7 49 29 20 27 22 17 32 24 25 Histological grade 0.017 0.23 0.484 0.543 High (grade 1) 77 47 30 29 48 33 44 52 25 Moderate (grade 2) 164 91 73 73 91 71 93 99 65 Poor (grade 3) 83 64 20 42 41 44 39 57 26 Unidentifed 36 22 14 20 16 17 19 23 13 Nodal status 0.588 0.848 0.25 0.212 N0 198 121 77 94 104 79 119 120 78 N1 97 64 33 43 54 45 52 64 33 N2 65 38 27 29 36 33 32 47 18 Table 1.
Load more

Recommended publications
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • A Multi-Omics Interpretable Machine Learning Model Reveals Modes of Action of Small Molecules Natasha L
    www.nature.com/scientificreports OPEN A Multi-Omics Interpretable Machine Learning Model Reveals Modes of Action of Small Molecules Natasha L. Patel-Murray1, Miriam Adam2, Nhan Huynh2, Brook T. Wassie2, Pamela Milani2 & Ernest Fraenkel 2,3* High-throughput screening and gene signature analyses frequently identify lead therapeutic compounds with unknown modes of action (MoAs), and the resulting uncertainties can lead to the failure of clinical trials. We developed an approach for uncovering MoAs through an interpretable machine learning model of transcriptomics, epigenomics, metabolomics, and proteomics. Examining compounds with benefcial efects in models of Huntington’s Disease, we found common MoAs for compounds with unrelated structures, connectivity scores, and binding targets. The approach also predicted highly divergent MoAs for two FDA-approved antihistamines. We experimentally validated these efects, demonstrating that one antihistamine activates autophagy, while the other targets bioenergetics. The use of multiple omics was essential, as some MoAs were virtually undetectable in specifc assays. Our approach does not require reference compounds or large databases of experimental data in related systems and thus can be applied to the study of agents with uncharacterized MoAs and to rare or understudied diseases. Unknown modes of action of drug candidates can lead to unpredicted consequences on efectiveness and safety. Computational methods, such as the analysis of gene signatures, and high-throughput experimental methods have accelerated the discovery of lead compounds that afect a specifc target or phenotype1–3. However, these advances have not dramatically changed the rate of drug approvals. Between 2000 and 2015, 86% of drug can- didates failed to earn FDA approval, with toxicity or a lack of efcacy being common reasons for their clinical trial termination4,5.
    [Show full text]
  • Downloaded from [266]
    Patterns of DNA methylation on the human X chromosome and use in analyzing X-chromosome inactivation by Allison Marie Cotton B.Sc., The University of Guelph, 2005 A THESIS SUBMITTED IN PARTIAL FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE OF DOCTOR OF PHILOSOPHY in The Faculty of Graduate Studies (Medical Genetics) THE UNIVERSITY OF BRITISH COLUMBIA (Vancouver) January 2012 © Allison Marie Cotton, 2012 Abstract The process of X-chromosome inactivation achieves dosage compensation between mammalian males and females. In females one X chromosome is transcriptionally silenced through a variety of epigenetic modifications including DNA methylation. Most X-linked genes are subject to X-chromosome inactivation and only expressed from the active X chromosome. On the inactive X chromosome, the CpG island promoters of genes subject to X-chromosome inactivation are methylated in their promoter regions, while genes which escape from X- chromosome inactivation have unmethylated CpG island promoters on both the active and inactive X chromosomes. The first objective of this thesis was to determine if the DNA methylation of CpG island promoters could be used to accurately predict X chromosome inactivation status. The second objective was to use DNA methylation to predict X-chromosome inactivation status in a variety of tissues. A comparison of blood, muscle, kidney and neural tissues revealed tissue-specific X-chromosome inactivation, in which 12% of genes escaped from X-chromosome inactivation in some, but not all, tissues. X-linked DNA methylation analysis of placental tissues predicted four times higher escape from X-chromosome inactivation than in any other tissue. Despite the hypomethylation of repetitive elements on both the X chromosome and the autosomes, no changes were detected in the frequency or intensity of placental Cot-1 holes.
    [Show full text]
  • Supplementary Materials
    Supplementary materials Supplementary Table S1: MGNC compound library Ingredien Molecule Caco- Mol ID MW AlogP OB (%) BBB DL FASA- HL t Name Name 2 shengdi MOL012254 campesterol 400.8 7.63 37.58 1.34 0.98 0.7 0.21 20.2 shengdi MOL000519 coniferin 314.4 3.16 31.11 0.42 -0.2 0.3 0.27 74.6 beta- shengdi MOL000359 414.8 8.08 36.91 1.32 0.99 0.8 0.23 20.2 sitosterol pachymic shengdi MOL000289 528.9 6.54 33.63 0.1 -0.6 0.8 0 9.27 acid Poricoic acid shengdi MOL000291 484.7 5.64 30.52 -0.08 -0.9 0.8 0 8.67 B Chrysanthem shengdi MOL004492 585 8.24 38.72 0.51 -1 0.6 0.3 17.5 axanthin 20- shengdi MOL011455 Hexadecano 418.6 1.91 32.7 -0.24 -0.4 0.7 0.29 104 ylingenol huanglian MOL001454 berberine 336.4 3.45 36.86 1.24 0.57 0.8 0.19 6.57 huanglian MOL013352 Obacunone 454.6 2.68 43.29 0.01 -0.4 0.8 0.31 -13 huanglian MOL002894 berberrubine 322.4 3.2 35.74 1.07 0.17 0.7 0.24 6.46 huanglian MOL002897 epiberberine 336.4 3.45 43.09 1.17 0.4 0.8 0.19 6.1 huanglian MOL002903 (R)-Canadine 339.4 3.4 55.37 1.04 0.57 0.8 0.2 6.41 huanglian MOL002904 Berlambine 351.4 2.49 36.68 0.97 0.17 0.8 0.28 7.33 Corchorosid huanglian MOL002907 404.6 1.34 105 -0.91 -1.3 0.8 0.29 6.68 e A_qt Magnogrand huanglian MOL000622 266.4 1.18 63.71 0.02 -0.2 0.2 0.3 3.17 iolide huanglian MOL000762 Palmidin A 510.5 4.52 35.36 -0.38 -1.5 0.7 0.39 33.2 huanglian MOL000785 palmatine 352.4 3.65 64.6 1.33 0.37 0.7 0.13 2.25 huanglian MOL000098 quercetin 302.3 1.5 46.43 0.05 -0.8 0.3 0.38 14.4 huanglian MOL001458 coptisine 320.3 3.25 30.67 1.21 0.32 0.9 0.26 9.33 huanglian MOL002668 Worenine
    [Show full text]
  • Apoptosis-Related Gene Expression in Tumor Tissue Samples Obtained from Patients Diagnosed with Glioblastoma Multiforme
    INTERNATIONAL JOURNAL OF MOLECULAR MEDICINE 36: 1677-1684, 2015 Apoptosis-related gene expression in tumor tissue samples obtained from patients diagnosed with glioblastoma multiforme EVA BLAHOVCOVA1, ROMANA RICHTEROVA2, BRANISLAV KOLAROVSZKI2, DUSAN DOBROTA1, PETER RACAY1 and JOZEF HATOK1 1Department of Medical Biochemistry, Jessenius Faculty of Medicine in Martin, Comenius University in Bratislava; 2Clinic of Neurosurgery, Jessenius Faculty of Medicine in Martin, Comenius University in Bratislava and University Hospital in Martin, SK-03601 Martin, Slovakia Received May 27, 2015; Accepted September 28, 2015 DOI: 10.3892/ijmm.2015.2369 Abstract. Tumors of the brain are very diverse in their biological Introduction behavior and are therefore considered a major issue in modern medicine. The heterogeneity of gliomas, their clinical presenta- Changes in programmed cell death and the loss of regulation in tion and their responses to treatment makes this type of tumor a cell growth and anti-growth signals may result in uncontrolled challenging area of research. Glioblastoma multiforme (GBM) proliferation, the disorganized growth of tissue cells and tumor is the most common, and biologically the most aggressive, formation. The malignant transformation of cells is accompa- primary brain tumor in adults. The standard treatment for nied and characterized by the disruption of genetic material patients with newly diagnosed GBM consists of surgical resec- and the aberrant expression of multiple genes. Tumors of the tion, radiotherapy and chemotherapy. However, resistance central nervous system (CNS) are characterized by heteroge- to chemotherapy is a major obstacle to successful treatment. neity within the cell population and are the cause of severe The aim of this study was to examine the changes occurring serious medical conditions (1,2).
    [Show full text]
  • BAP31 (BCAP31) (NM 001139457) Human Mass Spec Standard Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for PH327334 BAP31 (BCAP31) (NM_001139457) Human Mass Spec Standard Product data: Product Type: Mass Spec Standards Description: BCAP31 MS Standard C13 and N15-labeled recombinant protein (NP_001132929) Species: Human Expression Host: HEK293 Expression cDNA Clone RC227334 or AA Sequence: Predicted MW: 34.6 kDa Protein Sequence: >RC227334 representing NM_001139457 Red=Cloning site Green=Tags(s) MGAEASSSWCPGTALPEERLSVKRASEISGFLGQGSSGEAALDVLTHVLEGAGNKLTSSCGKPSSNRMSL QWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKY DDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESA SEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMR KQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE myc-FLAG tag Tag: C-Myc/DDK Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining Concentration: 50 ug/ml as determined by BCA Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. RefSeq: NP_001132929 RefSeq ORF: 939 Synonyms: 6C6-AG; BAP31; CDM; DDCH; DXS1357E Locus ID: 10134 UniProt ID: P51572 Cytogenetics: Xq28 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 BAP31 (BCAP31) (NM_001139457) Human Mass Spec Standard – PH327334 Summary: This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in caspase 8-mediated apoptosis.
    [Show full text]
  • Renoprotective Effect of Combined Inhibition of Angiotensin-Converting Enzyme and Histone Deacetylase
    BASIC RESEARCH www.jasn.org Renoprotective Effect of Combined Inhibition of Angiotensin-Converting Enzyme and Histone Deacetylase † ‡ Yifei Zhong,* Edward Y. Chen, § Ruijie Liu,*¶ Peter Y. Chuang,* Sandeep K. Mallipattu,* ‡ ‡ † | ‡ Christopher M. Tan, § Neil R. Clark, § Yueyi Deng, Paul E. Klotman, Avi Ma’ayan, § and ‡ John Cijiang He* ¶ *Department of Medicine, Mount Sinai School of Medicine, New York, New York; †Department of Nephrology, Longhua Hospital, Shanghai University of Traditional Chinese Medicine, Shanghai, China; ‡Department of Pharmacology and Systems Therapeutics and §Systems Biology Center New York, Mount Sinai School of Medicine, New York, New York; |Baylor College of Medicine, Houston, Texas; and ¶Renal Section, James J. Peters Veterans Affairs Medical Center, New York, New York ABSTRACT The Connectivity Map database contains microarray signatures of gene expression derived from approximately 6000 experiments that examined the effects of approximately 1300 single drugs on several human cancer cell lines. We used these data to prioritize pairs of drugs expected to reverse the changes in gene expression observed in the kidneys of a mouse model of HIV-associated nephropathy (Tg26 mice). We predicted that the combination of an angiotensin-converting enzyme (ACE) inhibitor and a histone deacetylase inhibitor would maximally reverse the disease-associated expression of genes in the kidneys of these mice. Testing the combination of these inhibitors in Tg26 mice revealed an additive renoprotective effect, as suggested by reduction of proteinuria, improvement of renal function, and attenuation of kidney injury. Furthermore, we observed the predicted treatment-associated changes in the expression of selected genes and pathway components. In summary, these data suggest that the combination of an ACE inhibitor and a histone deacetylase inhibitor could have therapeutic potential for various kidney diseases.
    [Show full text]
  • Alterations of the Pro-Survival Bcl-2 Protein Interactome in Breast Cancer
    bioRxiv preprint doi: https://doi.org/10.1101/695379; this version posted July 12, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 Alterations of the pro-survival Bcl-2 protein interactome in 2 breast cancer at the transcriptional, mutational and 3 structural level 4 5 Simon Mathis Kønig1, Vendela Rissler1, Thilde Terkelsen1, Matteo Lambrughi1, Elena 6 Papaleo1,2 * 7 1Computational Biology Laboratory, Danish Cancer Society Research Center, 8 Strandboulevarden 49, 2100, Copenhagen 9 10 2Translational Disease Systems Biology, Faculty of Health and Medical Sciences, Novo 11 Nordisk Foundation Center for Protein Research University of Copenhagen, Copenhagen, 12 Denmark 13 14 Abstract 15 16 Apoptosis is an essential defensive mechanism against tumorigenesis. Proteins of the B-cell 17 lymphoma-2 (Bcl-2) family regulates programmed cell death by the mitochondrial apoptosis 18 pathway. In response to intracellular stresses, the apoptotic balance is governed by interactions 19 of three distinct subgroups of proteins; the activator/sensitizer BH3 (Bcl-2 homology 3)-only 20 proteins, the pro-survival, and the pro-apoptotic executioner proteins. Changes in expression 21 levels, stability, and functional impairment of pro-survival proteins can lead to an imbalance 22 in tissue homeostasis. Their overexpression or hyperactivation can result in oncogenic effects. 23 Pro-survival Bcl-2 family members carry out their function by binding the BH3 short linear 24 motif of pro-apoptotic proteins in a modular way, creating a complex network of protein- 25 protein interactions.
    [Show full text]
  • BCAP 31 Expression and Promoter Demethylation in Psoriasis
    ORIGINAL ARTICLE Asian Pacific Journal of Allergy and Immunology BCAP 31 expression and promoter demethylation in psoriasis Kriangsak Ruchusatsawat,1 Laddawan Thiemsing,1 Apiwat Mutirangura,2 Jongkonnee Wongpiyabovorn3 Abstract Background: Psoriasis is the disease of abnormal keratinocyte differentiation and apoptosis. Alterations in DNA methylation leading to keratinocyte hyperproliferation is one of the proposed pathogenic mechanisms of psoriasis. B-cell receptor associated protein (BCAP31) has been reported to be involved in the proliferation and apoptosis of keratinocytes. Up-regulation and changing in BCAP31 promoter methylation has been reported to be associated with some cancers. To date, there has been no study of psoriasis. Objective: We investigated BCAP31 protein expression and the status of BCAP31 promoter methylation in psoriasis. Method: Ten patients with psoriasis and 10 healthy subjects were enrolled. The immunohistochemistry was performed on paraffin-embedded tissue section to detect BCAP31 protein expression and compared between psoriasis and normal skin. The laser capture micro-dissected keratinocyte were analyzed using bisulfite PCR method and cloning and sequencing. Results: Increased BCAP31 protein expression was observed in psoriatic epidermis compared with normal epidermis. Interestingly the methylation level of the BCAP31 promoter was significantly lower in patients with psoriasis compared with healthy subjects (p < 0.001, % psoriasis vs. normal skin methylation = 14.94 vs. 60.61). Conclusions: The present study
    [Show full text]
  • Infection Respiratory Epithelium During Adenoviral Stat3 Is Required
    Stat3 Is Required for Cytoprotection of the Respiratory Epithelium during Adenoviral Infection This information is current as Yohei Matsuzaki, Yan Xu, Machiko Ikegami, Valérie of September 24, 2021. Besnard, Kwon-Sik Park, William M. Hull, Susan E. Wert and Jeffrey A. Whitsett J Immunol 2006; 177:527-537; ; doi: 10.4049/jimmunol.177.1.527 http://www.jimmunol.org/content/177/1/527 Downloaded from References This article cites 65 articles, 30 of which you can access for free at: http://www.jimmunol.org/content/177/1/527.full#ref-list-1 http://www.jimmunol.org/ Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication by guest on September 24, 2021 *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2006 by The American Association of Immunologists All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. The Journal of Immunology Stat3 Is Required for Cytoprotection of the Respiratory Epithelium during Adenoviral Infection1 Yohei Matsuzaki, Yan Xu, Machiko Ikegami, Vale´rie Besnard, Kwon-Sik Park, William M. Hull, Susan E. Wert, and Jeffrey A.
    [Show full text]
  • Two Types of Human Malignant Melanoma Cell Lines Revealed By
    Published OnlineFirst April 21, 2009; DOI: 10.1158/1535-7163.MCT-08-1030 Published Online First on April 21, 2009 as 10.1158/1535-7163.MCT-08-1030 OF1 Two types of human malignant melanoma cell lines revealed by expression patterns of mitochondrial and survival-apoptosis genes: implications for malignant melanoma therapy David M. Su,1 Qiuyang Zhang,1 Xuexi Wang,1,2 type A (n = 12) and type B (n = 9). Three hundred fifty- Ping He,3 Yuelin Jack Zhu,5 Jianxiong Zhao,2 five of 1,037 (34.2%) genes displayed significant (P ≤ Owen M. Rennert,4 and Yan A. Su1 0.030; false discovery rate ≤ 3.68%) differences (±≥2.0- fold) in average expression, with 197 genes higher and 1Department of Biochemistry and Molecular Biology and the 158 genes lower in type A than in type B. Of 84 genes Catherine Birch McCormick Genomics Center, The George with known survival-apoptosis functions, 38 (45.2%) dis- Washington University School of Medicine and Health Sciences, Washington, District of Columbia; 2The Institution of Chinese- played the significant (P < 0.001; false discovery rate < Western Integrative Medicine, Lanzhou University School of 0.15%) difference. Antiapoptotic (BCL2, BCL2A1, Medical Science, Lanzhou, Gansu, China; 3Laboratory of Cellular PPARD,andRAF1), antioxidant (MT3, PRDX5, PRDX3, Hemostasis, Division of Hematology, Center for Biological GPX4, GLRX2, and GSR), and proapoptotic (BAD, BNIP1, Evaluation and Research, Food and Drug Administration; APAF1, BNIP3L, CASP7, CYCS, CASP1,andVDAC1) 4Laboratory of Clinical Genomics, Eunice Kennedy Shriver
    [Show full text]
  • RESEARCH ARTICLE Expression Profile of Genes
    DOI:http://dx.doi.org/10.7314/APJCP.2014.15.11.4499 Expression Profile of Genes Modulated byAloe emodin in Human U87 Glioblastoma Cells RESEARCH ARTICLE Expression Profile of Genes Modulated by Aloe emodin in Human U87 Glioblastoma Cells Khalilah Haris, Samhani Ismail, Zamzuri Idris, Jafri Malin Abdullah, Abdul Aziz Mohamed Yusoff* Abstract Glioblastoma, the most aggressive and malignant form of glioma, appears to be resistant to various chemotherapeutic agents. Hence, approaches have been intensively investigated to targeti specific molecular pathways involved in glioblastoma development and progression. Aloe emodin is believed to modulate the expression of several genes in cancer cells. We aimed to understand the molecular mechanisms underlying the therapeutic effect of Aloe emodin on gene expression profiles in the human U87 glioblastoma cell line utilizing microarray technology. The gene expression analysis revealed that a total of 8,226 gene alterations out of 28,869 genes were detected after treatment with 58.6 µg/ml for 24 hours. Out of this total, 34 genes demonstrated statistically significant change (p<0.05) ranging from 1.07 to 1.87 fold. The results revealed that 22 genes were up-regulated and 12 genes were down-regulated in response to Aloe emodin treatment. These genes were then grouped into several clusters based on their biological functions, revealing induction of expression of genes involved in apoptosis (programmed cell death) and tissue remodelling in U87 cells (p<0.01). Several genes with significant changes of the expression level e.g. SHARPIN, BCAP31, FIS1, RAC1 and TGM2 from the apoptotic cluster were confirmed by quantitative real-time PCR (qRT-PCR).
    [Show full text]