Vol. XL, Number 28 Q April 12, 2019 City faces pressure over new 5G antennas Page 5
Pulse 18 Transitions 19 Spectrum 20 Eating Out 31 Movies 33 Puzzles 51 QA&E Alan Cumming prepares to be vulnerable in Palo Alto Page 29 QHome At Hidden Villa, techies find their inner farmer Page 35 QSports Local baseball races are heating up Page 49 Colonoscopies Save Lives
Colon cancer is the second leading cause of cancer-related death in the U.S. Thanks to an increase in colorectal cancer screenings, improved diagnostics, and advanced treatments, there are more than one million survivors of colorectal cancer. If you’re 50 or older, or have a family history, a colonoscopy can reduce your risk of developing colon cancer.
Stanford Medicine doctors are committed to providing innovative care using the latest treatment advances and research for the best health outcomes.
To learn more or to schedule a colonoscopy, visit stanfordhealthcare.org/colonhealth or call 650.736.5555.
Page 2 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com SHIFT IN THE MARKET?
Where are interest rates headed?
How does the tax bill affect me?
What is the best strategy to take advantage of the current market?
More than ever, local knowledge and experience are paramount to succeed in today’s market. Call Derk to leverage the Local Advantage.
Local Knowledge, Local Resources, Global Reach.
DERK BRILL Wall Street Journal “Top Residential Realtors” in America M: 650.814.0478 [email protected] www.DerkBrill.com License# 01256035 www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 3 Page 4 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com UpfrontLocal news, information and analysis With pressure rising, city eyes overhaul of cell-antenna rules Palo Alto seeks to reconcile federal are installing with ever-greater fre- facilities) to support a network,” many of which are designed for quency on streetlights and utility according to a new report from streetlights and utility poles, that regulations, citizens’ concerns poles throughout the city. The city the Department of Planning and cities must make rulings on with- by Gennady Sheyner has approved dozens of such ap- Community Environment. in 60 or 90 days, depending on plications in the past year and has As city planners review the the technology being installed. In acing a flood of applica- chorus of concerned residents least 100 more wireless “clusters” applications, they are facing Palo Alto, this federally mandated tions from telecommunica- calling for them to resist. in the pipeline, according to staff. pressure to speed things along “shot clock” speeds up the city’s F tions companies wanting Both of these factors are sure to That trend is expected to contin- from the Federal Communica- prior time limit of either 90 days to install new wireless antennas come into play on April 15, when ue, with telecoms rolling out new tions Commission (FCC), which or 150 days. throughout Palo Alto, city staff the City Council considers creat- 5G technologies, which typically in September approved an order The federal order also requires and elected leaders find them- ing a new process for approving rely on equipment that have less creating a new time limit for the local jurisdictions to make deci- selves caught between new feder- “wireless communication facili- power and shorter range. As such, review process. sions on these applications based al rules that require them to speed ties” — radio equipment that tele- they will require a “greater density The FCC order defines a cate- up the permitting process and a coms such as Verizon and AT&T of WCFs (wireless communication gory of “small wireless facilities,” (continued on page 7)
CRIMINAL JUSTICE Guilty pleas, more charges in bribery case Parents face prison time, hundreds of thousands of dollars in fines in college- admissions scam by Sue Dremann ven as four Midpeninsula residents agreed to plead E guilty in the recent na- tional college-admissions brib- ery scandal, federal authorities on Tuesday added fraud and money laundering charges against four other indicted area parents. Menlo Park residents Marjorie Klapper, 50, and Peter Jan Sar- torio, 53; Hillsborough residents
Jenny Rodriguez Jenny Bruce Isackson, 61, and Davina Isackson, 55; all intend to plead guilty to one count of mail fraud and honest services mail fraud, U.S. Attorney for Massachusetts Felix Weber and Tyler Liu, members of Peninsula Robotics, work on a Bridgeport vertical milling machine in member Ethan Chun’s Andrew Lelling said. In addition, garage in south Palo Alto on April 10. Bruce Isackson plans to plead guilty to one count each of money group that has grown from laundering conspiracy and con- YOUTH about 10 high schoolers that spiracy to defraud the IRS. first year to more than 25 stu- The agreements, which must dents from Paly, Gunn High be presented before a judge no Born in a garage, grassroots robotics School and other local public later than April 30, could lead and private high schools, some to incarceration and hundreds of team heads to world championships form as far as away as San Jose. thousands of dollars in fines for There is another community- the parents, who allegedly bribed Students from private, public schools join forces based team in Palo Alto called college-entrance-exam adminis- to follow their passion, learn teamwork Garage Robotics, started by trators to allow their children to a group of about 10 Paly stu- cheat on the SAT and ACT tests by Elena Kadvany dents also working out of a and/or paid university athletic ike many great Silicon competitive robotics team since “He just felt like everybody team member’s garage. This coaches and administrators to Valley origin stories, Pen- his freshman year. In 2015, with who wants to do this should get year was Garage Robotics’ first designate their kids as star athletic L insula Robotics’ starts in a overwhelming demand from to do it,” his mother, Pam Mor- competing in For Inspiration recruits. garage. students who wanted to be part genfeld, said in an interview. and Recognition of Science The group that plans to en- Four years ago, Spencer Mor- of the team but without the re- “We emptied our garage and and Technology (FIRST) Ro- ter guilty pleas is made up of 13 genfeld was a junior at Palo Alto sources to meet it, the school cut welcomed the kids here.” botics competitions, according parents and one athletics coach, High School, where he had been more than 40 students from the So began Peninsula Robotics, about a quarter of the total 50 part of the school’s popular, program. a scrappy, student-run robotics (continued on page 10) (continued on page 12)
www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 5 PET EMERGENCY TRANSPORTATION UNIT Upfront )VVR`V\YZ[[YHUZWVY[ YV\UK[YPWFREE[OYV\NO4HYJO 450 Cambridge Ave., Palo Alto, CA 94306 QUOTE OF THE WEEK (650) 326-8210 PUBLISHER 4VU-YP WT7LHR/V\YZ HT[VWTWT William S. Johnson (223-6505)
EDITORIAL 833.PET.2VET 833.738.2838 Editor Jocelyn Dong (223-6514) Associate Editor Linda Taaffe (223-6511) Sports Editor Rick Eymer (223-6516) Sustainability is in Palo Alto’s blood, Arts & Entertainment Editor Karla Kane (223-6517) Assistant Sports Editor Glenn Reeves (223-6521) and this where we can make our mark. Learn the Guitar this Spring Express & Digital Editor Jamey Padojino (223-6524) — Carol McComb’s “Starting to Play” workshophop includesincludes Staff Writers Sue Dremann (223-6518), Elena Bob Wenzlau, Palo Alto resident, on the city’s new the FREE use of a Loaner Guitar for the durationration Kadvany (223-6519), Gennady Sheyner (223-6513) recycling guidelines. See story on page 23. of the classes. * Regular cost is just $180 foror eighteight Staff Photographer/Videographer weeks of group lessons, and all music is included.ncluded.d. Veronica Weber (223-6520) Editorial Assistant/Intern Coordinator * “Starting to Play” meets for one hour each Mondayday nightnignight Cierra Bailey (223-6526) for eight weeks beginning April 1st. Editorial Intern Christian Trujano For more information about this and Carol’s other classes Photo Intern Jennifer Rodriguez at Gryphon, visit www.carolmccomb.com Contributors Chrissi Angeles, Mike Berry, Around Town and click on “group classes.” Carol Blitzer, Peter Canavese, Yoshi Kato, KEEP CALM AND LOVE GOATS division, which remains without Chris Kenrick, Jack McKinnon, Alissa Merksamer, ... Eighty goats that escaped from a leader, and in its parking Sheryl Nonnenberg, Kaila Prins, Ruth Schechter, a Los Altos Hills home on the Monica Schreiber, Jay Thorwaldson operation, which has a single night of April 4 could’ve turned staff member managing the city’s ADVERTISING into a “baaaaad” situation, but messy hodgepodge of custom- Stringed Instruments Vice President Sales & Marketing Since 1969 Tom Zahiralis (223-6570) Palo Alto Animal Control Officer built, neighborhood-specific William Warrior and a sheepdog Residential Preferential Parking 6504932131 Digital Sales Manager Caitlin Wolf (223-6508) Multimedia Advertising Sales helped four Santa Clara County programs. The council’s Finance 3HTILY[(]LU\L7HSV(S[V Tiffany Birch (223-6573), Elaine Clark (223-6572), sheriff’s deputies bring the herd Committee will try to reconcile www.gryphonstrings.com Connie Jo Cotton (223-6571), Jillian Schrager back to its rightful place. A new the competing priorities of saving Real Estate Advertising Sales homeowner on O’Keefe Lane money and reducing traffic on Neal Fine (223-6583), Rosemary Lewkowitz (223-6585) had rented the goats from Green Tuesday, when it considers Legal Advertising Alicia Santillan (223-6578) Goat Landscapers to clean up funding for the Palo Alto their lawn, but the herd found an Transportation Management Avenidas Announces New CARE FORUM ADVERTISING SERVICES opening past a portable electric (TMA), the nonprofit Advertising Services Manager Association Kevin Legarda (223-6597) fence and decided to go on a charged with giving downtown FREE MONTHLY Sales & Production Coordinators nighttime adventure. “They love employees incentives to not drive. Diane Martin (223-6584), Nico Navarrete (223-6582) to wander and when they find an The nonprofit has requested CAREGIVING WORKSHOPS DESIGN opening they go for it,” Warrior that the city either maintain the Design & Production Manager said. A resident out for a jog in the $480,000 contribution from 2019 Kristin Brown (223-6562) area of La Rena Lane and Dianne or increase it by 50 percent, to Senior Designers Linda Atilano, Paul Llewellyn Drive that night noticed the goats $720,000. The funding would COME MEET OUR EXPERT Designers Amy Levine, Doug Young and alerted authorities, who allow the agency to remove From Chaos to Confidence: BUSINESS were able to bring the herd back between 200 and 337 cars daily, Payroll & Benefits Cassadie Gonzalez (223-6544) just before midnight. Sheriff’s according to a letter from the Navigating Home, ER, Business Associates Ji Loh (223-6542), Suzanne deputy Michael Low said none TMA. On the bright side, the city Hospital, Rehab Ogawa (223-6541), Eddie Reyes (223-6575) of the goats or deputies were is now getting some assistance ADMINISTRATION injured, and their great escape for its traffic-fighting efforts from Dr. Rita Ghatak Courier Ruben Espinoza had a happy ending. “If I were a outside sources. Facebook and EMBARCADERO MEDIA goat, I would be a little scared,” Palantir have contributed a Rita Ghatak, PhD. Saturday, May 4 President William S. Johnson (223-6505) Low said, “But for the most part combined $100,000 to expand aging101.org Vice President Michael I. Naar (223-6540) ... they were goats being goats the TMA’s programs to California 11 am-2 pm Vice President & CFO Peter Beller (223-6545) and they all kind of followed Avenue earlier this year. Palo Vice President Sales & Marketing each other and got back home.” Alto is participating in a pilot Free lunch included. Tom Zahiralis (223-6570) A cattle dog and border collie program funded by a $1 million Director, Information Technology & Webmaster from the landscaping company federal grant that seeks to shift Frank A. Bravo (223-6551) RESERVE YOUR SPACE assisted in herding the goats city employees from cars to other Director of Marketing and Audience back home. Warrior added it CALL (659) 289-5400 AVENIDAS.ORG Development Emily Freeman (223-6560) modes of transportation. Major Accounts Sales Manager was the second time he has ever MORE UPCOMING WORKSHOPS Connie Jo Cotton (223-6571) encountered a large herd in his STAYING THE COURSE ... Circulation Assistant Alicia Santillan 40 years with the agency. He When the Santa Clara Valley gets up close with the goats in SAT Caregiving Conversations About Quality Computer System Associates Matthew Hargrove, Transportation Authority released of LIfe and Treatment Options Chris Planessi a 14-minute video that can be JUNE its proposed New Transit Service 11 am-2 pm. Free lunch included | Dr. Ellen Brown The Palo Alto Weekly (ISSN 0199-1159) is published every viewed at bit.ly/2XaMWdl. Plan in January, many riders 1 Friday by Embarcadero Media, 450 Cambridge Ave., Palo Alto, CA 94306, (650) 326-8210. Periodicals postage paid at expressed concern over potential The Emotional Work Inherent Within Caregiving Palo Alto, CA and additional mailing offices. Adjudicated a COST DRIVERS ... As Palo Alto SAT newspaper of general circulation for Santa Clara County. cuts to Line 22, which runs 11 am-2 pm. Free lunch included The Palo Alto Weekly is delivered free to homes in Palo prepares to kick off its budget between the Palo Alto Transit AUG Alto, Menlo Park, Atherton, Portola Valley, East Palo Alto, Paula Wolfson, LCSW season later this month, the City Center and Eastridge Transit 3 Manager of Avenidas Care Partners to faculty and staff households on the Stanford campus and to portions of Los Altos Hills. If you are not currently Council’s top 2019 priorities Center in San Jose via El Camino receiving the paper, you may request free delivery by SAT The Cost of Caregiving: Budgeting for Respite Resources calling 326-8210. POSTMASTER: Send address changes to appear to be on a collision Real. The agency considered 11 am-2 pm. Free lunch included Palo Alto Weekly, P.O. Box 1610, Palo Alto, CA 94302. ©2018 course. The council had directed OCT by Embarcadero Media. All rights reserved. Reproduction cutting hourly runs from 1-4 a.m. Kristina Lugo, Director, Avenidas Rose Kleiner Center without permission is strictly prohibited. The Palo Alto staff to trim $4 million from the After community outreach and 12 Minda Cuther, MBA, Director, Love and Order Weekly is available on the Internet via Palo Alto Online at: www.PaloAltoOnline.com city’s budget as part of an effort ridership analysis over the past to control rising pension costs SAT Caregiver Health and Wellness Strategies Our email addresses are: [email protected], few months, the VTA decided to [email protected], [email protected], and address the city’s “financial NOV 11 am-2 pm. Free lunch included [email protected] continue overnight service as many sustainability” priority for 2019. 2 Dr. Ellen Brown & Dr. Rita Ghatak Missed delivery or start/stop your paper? use the bus for mobility needs Call (650) 223-6557, or email [email protected]. At the same time, the council is rather than shelter. The line has You may also subscribe online at SAT Caregiver Empowerment and Advocacy: www.PaloAltoOnline.com. Subscriptions are $60/yr. trying to make progress on its been nicknamed “Hotel 22,” where Your Voice, Your Visions DEC “transportation” and “climate homeless people have boarded 11 am-2 pm. Free lunch included change” priorities by launching 7 Paula Wolfson, LCSW to sleep on the bus rather than on new initiatives that reduce the the streets. The agency planned to number of cars on local streets — increase service in the morning and Become a efforts that require new programs evenings from 20 to 15 minutes Paid Subscriber for as low and additional investments. on Line 522, spanning the same as $5 per month It doesn’t help that City Hall distance as Line 22, which staff Sign up online at continues to see significant is now proposing to maintain the vacancies in its transportation 270 Escuela Ave. Mountain View www.PaloAltoOnline.com/ same level of service. Q user/subscribe
Page 6 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com Upfront
health and environmental impacts the telecom’s proposal to install subjectivity and the illusory im- had attended the March meeting Wireless of the new technology. Some five pole-mounted wireless equip- pression that personal concerns and heard Chow’s presentation, (continued from page 5) people have called for more re- ment “nodes” in the downtown would override objective stan- told the planning commission strictions for wireless equipment, area. Crown Castle, the company dards, frustrating both the public during its March 27 review that on aesthetic regulations that are including setback requirements that is installing the equipment on and decision-makers.” the proposed ordinance appears to “reasonable, objective, non-dis- in cases where antennas are in- Verizon’s behalf, protested Lait’s “The public’s subjective person- be “rushed” and in need of “more criminatory, and published in ad- stalled near homes and schools. rejection of its proposed design al concerns simply cannot be ad- thoughtful consideration” and vance.” It gave cities until April Others, like resident Francesca — fake mailboxes on downtown dressed by decision-makers imple- “public input.” 15 to adopt such regulations, Kautz, urged the council to place sidewalks — and his requirement menting what must be an objective “I think it’s fair to say at the end which a public official must be a moratorium on nodes in residen- that the equipment be placed in process,” Albritton wrote. “While (of the meeting) that a large ma- able to apply “without exercise of tial neighborhoods. pole-mounted shrouds. a community meeting could be jority of those present — includ- personal judgment,” according to “I am not saying we can’t have Residents also criticized his optional, the notice and meeting ing council members (Tom) Du- the planning report. 5G, but please put the cell nodes approval and maintained that the required for Tier 2 and 3 facilities Bois, (Greg) Tanaka, and (Lydia) At the same time, city leaders along freeways and on top of com- radio equipment should be placed are irrelevant to objective review.” Kou — felt that the topic deserves are facing an intensifying push- mercial, industrial and city owned underground, in keeping with the more discussion and public input, back from residents, who in recent buildings, not in our residential Architectural Review Board’s Residents want a say especially before passing an ordi- months have submitted hundreds neighborhoods,” Kautz wrote to recommendation. But for Chow and many of her nance that curtails future public of letters protesting the new pole the council on March 22. After a long debate, council vot- neighbors, community input is par- input, as this one does,” said Col- fixtures that are slated to go up ed 4-3, with Tom DuBois, Lydia amount. At recent public hearings, lins, speaking as an individual near their homes. Last month, Four designs, three tiers Kou and Greg Tanaka dissenting, residents have urged the council and not as a representative of the about a hundred residents attend- On Monday, the City Council to reaffirm Lait’s decision, leav- to include ARB in all reviews of school board. ed a meeting of the Barron Park will consider a new wireless- ing Verizon unsatisfied and the wireless facilities and criticized Palo Alto is far from the only Neighborhood Association to hear facilities ordinance and a set of resident appellants furious. the proposed ordinance for giv- city dealing with the federal or- a presentation from resident Tina “objective standards,” which in- While the proposed ordinance ing the planning director the sole der. A coalition of cities that in- Chow about the latest wireless clude four designs for wireless aims to facilitate a “more effi- discretion to approve applications cludes San Jose, Los Angeles, proposals. They also heard from equipment that city planning staff cient review and help to alleviate without public meetings. Portland and New York has sued City Manager Ed Shikada and believe are “among the smallest, the significant burden on staff Todd Collins, a Barron Park res- to have the order overturned and Planning Director Jonathan Lait, least conspicuous, camouflaged, resources and ARB agendas cre- ident and member of the Palo Alto Palo Alto has publicly come out who in January approved an appli- and/or stealth design options ated by the influx of WCF ap- Unified School Board, argued in favor of H.R 530, a resolution cation from Vinculums, on behalf available,” the department’s report plications,” the report states, it is that the city’s proposed ordinance of Verizon, to install seven nodes, states. These include underground facing pushback from both sides appears “rushed.” Collins, who (continued on page 8) some of them in Barron Park. vaults for radio equipment; cy- of the debate. Chow, a professor in the Depart- lindrical “shrouds” that hide Verizon and AT&T are both ment of Civil and Environmental pole-mounted antennas; a boxy arguing that the proposed rules Engineering at the University of “sunshield” cover for equipment are too restrictive. The compa- California at Berkeley, told the mounted on the side of poles; and nies are specifically opposing a Weekly that residents expressed the use of existing street signs to provision that would create three Voted Best On The Peninsula concern about the city’s approval conceal wireless equipment. different tiers for wireless equip- of the latest batch of wireless The new standards would bring ment, based on the type of equip- nodes. One resident, Jerry Fan, some consistency and clarity to ment sought. The least intrusive confronted Lait at the meeting and what has often been a protracted, equipment (“Tier 1”) would re- asked him why he had rejected convoluted and highly contentious quire approval by the planning the Architectural Review Board’s process, according to staff. Appli- director, whose decision would recommendation that the project cations typically undergo numer- be final and not subject to appeal. be denied. Lait’s decision “put ous Architectural Review Board Equipment that requires modifi- my three kids’ and wife’s health hearings, which span months and cation of poles and support struc- at risk,” Fan told the council on routinely involve design changes. tures would be considered “Tier March 18, referring to his fear that Even after the board and the plan- 2.” The planning director would the radio frequencies are harmful. ning director approve the applica- have the option of referring these Dozens of other residents sent tion, residents and applicants can applications for ARB review, and letters to the Planning and Trans- appeal it to the City Council. residents would be able to appeal portation Commission and the That’s what happened in Janu- his decision to the council. City Council in recent weeks, ary, when both Verizon and its A similar process would apply complaining about the aesthetic, critics appealed Lait’s approval of to “Tier 3” permits, which would be required for equipment that is What not to do not collocated on existing poles. In this case, however, the applicant would need to acquire a condition- al-use permit. And for both Tier 2 and Tier 3 proposals, the applicant would be required to host commu- nity meetings and notify all resi- dents and property owners within 600 feet of the project sites at least 14 days before the meeting. Jeremy Stroup, a representa- tive from Vinculums, which is installing wireless equipment on behalf of Verizon, told the plan- ning commission that Verizon believes all applications for small cells should be approved under the Tier 1 process. “Verizon strongly believes that conditional-use appeals to the Courtesy city of Palo Alto Palo of city Courtesy City Council for small cells that already meet objective design standards would overburden the City Council, where they have limited authority under the federal law and will prove impossible to complete within the required 60 Palo Alto’s Architectural Review Board does not favor to 90 day shot clock,” Stroup said. installations of wireless-antenna equipment that look like either AT&T made a similar argument TEAK of these two designs, which telecommunications companies in its March 26 letter to the city. 3592 Haven Ave, Redwood City have proposed: at left, the side-mounted box on wooden utility Attorney Paul Albritton, who rep- pole with antenna on top and, at right, the “faux mailbox” for resents AT&T, wrote that solicit- OPEN DAILY 10:30 - 5 Ph 650-366-0411 cell equipment with antenna topping the light pole. ing public comments “introduces TomsOutdoorFurniture.Com
www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 7 Upfront
Wireless A different design (continued from page 7)
by U.S. Rep. Anna Eshoo, D-Palo Alto, that would do exactly that. In February, the city submitted a letter to Eshoo expressing support for her legislation. “We agree that deployment of the infrastructure supporting new cellular technology must be completed in a thoughtful and deliberate manner,” the Feb. 7 let- Sheraton Easter ter signed by Mayor Eric Filseth states. “We also believe that it should be done through the usual public process associated with lo- Champagne Brunch cal government, a process that has Alto Palo of city Courtesy worked well and needed no modi- fications from the FCC. Sunday, April 21, 2019 10:00 AM–2:00 PM “As you noted, the FCC’s deci- ADULTS SENIORS sion to implement a time limit on $60 $39 our ability to review the applica- $26 CHILDREN UNDER 12. CHILDREN UNDER 5 ARE FREE. tions — thus limiting our public Palo Alto’s Architectural Review process — cap fees, and restrict Board has asked to further our ability to best determine the SHERATON PALO ALTO HOTEL 625 EL CAMINO REAL, PALO ALTO, CA 94301 study integrated streetlight-pole needs for our own city represents designs for wireless equipment. FOR RESERVATIONS PLEASE CALL 650-328-2800 COMPLIMENTARY PARKING the FCC’s failure to listen to local Under these designs, a pole governments across the country.” that’s wider than the city’s The proposed ordinance ac- existing streetlights would counts for the possibility that the contain radio and other ancillary FCC order would be struck from equipment as well as cabling and the books. It specifies that if the the antenna. Removable panels council repeals the “objective of the pole would provide access standards” necessitated by the to equipment inside. ReFuel Your Fun! FCC order, the city would effec- tively revert to the existing process of its land, a power that “includes requiring architectural-review the authority to establish aesthetic findings as part of the approval of conditions for land use.” Propane Cylinder Exchange — April – June Tier 2 and Tier 3 applications. Chow and others argue that Palo Chow and others believe the Alto should use this power and, at city can do a lot more to protect the very least, impose setback re- neighbors. The architecture board, quirements for cell equipment in she said, should continue to review residential areas. She also wants wireless applications and Lait to tighten up the “exceptions” pro- should respect its recommenda- vision in the proposed ordinance, tions, as planning directors have which allow applicants to get traditionally done. waivers from objective standards The city can also include in its under certain circumstances. • objective standards a list of “pre- Chow argued that the city ferred locations” for new wireless should require applicants seeking
• equipment and consider requir- exceptions to commission an anal- ing a minimum distance between ysis from an independent third-
• wireless nodes. party reviewer, demonstrating why While the Telecommunica- other alternatives (including those tions Act of 1996 precludes states recommended by the city and by • or cities from regulating radio- members of the public) aren’t fea- frequency emissions (other than sible. Telecom companies should Reuse is better than recycling! Exchange your disposable, to verify that wireless equipment also be required to use “the least comply with FCC standards), sev- non-compliant configuration that one-pound propane cylinder with a FREE reusable one. eral cities, including Mill Valley would work,” Chow told the coun- and Fairfax, have prohibited in- cil this week. stallations of wireless equipment Chow also noted that other cit- in residential zones, in some cases ies that have recently crafted new using residents’ health concerns as regulations for wireless equip- a justification. ment. Petaluma, she said, requires But Palo Alto planners note that underground vaults for its equip- Mill Valley and Fairfax have yet ment. Fairfax recently passed an to receive any applications for urgency ordinance with new regu- “small cells,” while Palo Alto lations for wireless equipment, in- has numerous such applications cluding setback requirements. In pending. Adopting a residential Ripon, an uproar from residents ban, the staff report notes, “would prompted Sprint to relocate a cell result in a large number of excep- tower that was installed near an tion requests and would warrant elementary school. It’s important, Bring in one or more empty, Get one FREE additional legal analysis.” she said, for Palo Alto to consider Cities that restrict the placement the issue carefully and craft a so- one-pound, single use cylinders reusable cylinder of wireless equipment received a lution that works for its residents. boost on April 4, when the Cali- “We are fortunate that we have fornia Supreme Court ruled that many nearby cities who are also For more information, visit: cities are allowed to adopt regu- working on this issue,” Chow told lations to accommodate aesthetic the council on April 8. “Now, we www.cityofpaloalto.org/RFYF concerns. In upholding a San have to figure out how to do this [email protected] Francisco ordinance on wireless here, for Palo Alto.” Q (650) 496-5910 facilities, Justice Carol Corrigan Staff Writer Gennady Sheyner wrote that the city has “inherent can be emailed at gsheyner@ police powers” to determine uses paweekly.com.
Page 8 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com Lan Liu Bowling presents 4256 Manuela Court, Palo Alto
BY APPOINTMENT ONLY
Palatial Luxury, Elegant Contemporary
RARELYRA IS A HOME OF THIS MAGNITUDE AVAILABLE – oone that combines palatial luxury with a sleek modern style. Completed in 2008, ththis exceptional estate presents a spatially grand palette of elegant white – from flfloorso of Carrara marble to walls just waiting for the display of fine art. Bowed wallswa of floor-to-ceiling glass overlook the resort-inspired grounds, ceilings are craftedcra with architectural embellishments, and colorful glass adds artistic detail. WWith more than 9,100 square feet of living space plus 3 car garage of 1034 sf, expectex everything needed for luxurious Silicon Valley living – a fitness center, rerecreation/mediac room, full bar, and of course, two offices for the executive llifestyle.if There are 6 bedrooms, each with private bath, plus a separate bedroom aandn bath apartment ideal for staff or extended family. Outside, a sparkling pool aawaitsw on the vast grounds of approximately two-thirds of an acre. Unequaled in its ddesigne and quality, and with access to the excellent Palo Alto schools, this tour de foforce is a remarkable place to call home in Silicon Valley. LISTED AT $10,988,000 Lan Liu Bowling John Chung Broker-AssociateB Keller Williams (650) 520-3407 (650) 269-7538 [email protected] [email protected] CalBRE # 01248958 CalBRE # 01720510
Kw #1 Agent Worldwide – 2015 Kw #1 Team Worldwide – 2016, 2017
For more photos and information please visit:
www.4256ManuelaCt.comwww.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 9 Upfront
rummage for scrap metal and robotics, but he said he was sur- Robotics other materials. Their busiest prised by how much the team has (continued from page 5) period, build season, coincides taught him about working with with the winter months, so they others. to team captain Quintin Dwight. use a tent to cover the driveway “I thought robotics would be Despite the space and funding when it rains, set up heat lamps about building things and just limitations Peninsula Robotics and race against waning daylight building things. But it’s actually faces — its main workspace is in the evenings. They have to wait turned out to be a whole lot more. still a team member’s garage and for clear weather to test the robot Teamwork skills ... that’s been one driveway — the team won a wild- in the driveway — or at a nearby of the most valuable things I’ve card spot at the FIRST Robotics school if they need more space. learned,” he said. World Championships in Hous- Parents with programming or Because the students come ton, Texas next week. They’ll engineering experience lend a from different schools, they have be competing with their robot, hand if needed, but the students more diverse experiences and dubbed Baby Dino, against tens of primarily lead the work. skills. Chun learned about com- thousands of students from K-12 “When your resources are lim- puter-aided drafting (CAD) from Courtesy Mark Erickson robotics programs from around ited, you need to be creative to be a Gunn student who had been ex- the world. successful and competitive,” Mor- posed to the software in an engi- Paly’s and Gunn’s well-estab- genfeld said. neering course. lished robotics programs are sup- That first year, they built a robot “By virtue of being a commu- ported by parent boosters and the for less than $1,000, Lee said, but nity team, it means that students schools’ administrations. Creating were still able to reach the top 10 don’t feel that they have to choose The Peninsula Robotics team members work on their robot, “Baby an independent group has been against 50 teams in a local com- between a school sports team or Dino,” at the San Francisco Regional FIRST Robotics competition both gratifying and challenging petition. Other teams’ robots can arts program and are able to do on March 16. for the students involved. cost up to $5,000, she said. multiple things,” added junior After Kate Lee was cut from This year, the team has been Vyomika Gupta, who joined Pen- what obstacles you face, you can $1,500 GoFundMe campaign to Paly’s robotics team her fresh- working mostly out of Lee’s fam- insula Robotics after two years always overcome them as long as pay for other expenses. man year, she joined Peninsula ily’s south Palo Alto garage but is on Paly’s team. “This means that you are driven,” she said. “With Looming on the horizon is the Robotics. Now a senior, she said also machining parts in Paly ju- the team has a wonderful set of like-minded people, a ‘sketch bot’ question of where the team will the “vibe was completely differ- nior Ethan Chun’s garage nearby. collective interests and skills can easily become the same value operate next year. After Lee grad- ent.” The smaller, more intimate He’s sourced a collection of vin- and means you can always learn as an $5,000 robot.” uates, her family’s garage will no group of students included kids tage tools from Craigslist, includ- something new.” The students are gearing up to longer be available, and they’ll of different ages and skill levels, ing a lathe machine from 1944 The experience of Peninsula travel to Texas next week, their have to find a new space. but all had a deep passion for and a vertical milling machine Robotics has been influential for first non-local competition, where Students who are interested in robotics. from the 1960s. Lee, who is now the team captain. their robot will face an obstacle joining Peninsula Robotics can They quickly realized they Chun joined Peninsula Robot- She won a FIRST scholarship to course of sorts, depositing “car- learn more at team6036.github.io/ would be doing much more than ics as a freshman because he study engineering at her dream go” and climbing tiered platforms or email [email protected]. In- building a robot. They had to wanted to be on a smaller team school, Boston University. with efficiency and precision. formation about Garage Robotics manage their finances, find cor- with more flexibility. His love “Robotics has taught me disci- The team borrowed a ship- is posted at team7445.org/home. Q porate sponsors and learn how for building things — Legos and pline, responsibility, passion, etc. ping crate from Woodside High Staff Writer Elena Kadvany to work together as a team. They sand structures at the beach when But the most important lesson that School’s robotics team to ship can be emailed at ekadvany@ went to local recycling plants to he was younger — drew him to I have learned is that no matter Baby Dino in and launched a paweekly.com.
Proposing a responsible General Use Permit. Elevating the community. Stanford is committed to Santa Clara County and the surrounding area we call home. We’ve made it part of our mission to contribute to the health and quality of life of our community. Over the past 18 years, we’ve met every one of more than 100 annual reporting requirements, and now we’re proposing a land use permit that’s just as rigorous. We're accelerating solutions to society’s challenges, at home and around the world.
LEARN MORE AT GUP.STANFORD.EDU
Page 10 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com “Recently Sold” by Matt Skrabo
SOLD
61 Faxon Rd, Atherton
7 bed, 12 bath | 13,014 SQ.FT. Livable | 1.07 Acre Lot Offered at: $26,500,000
SOLD
500 St. Claire Dr, Palo Alto
4 Bed, 4 Bath | 2,612 SQ.FT. Livable | 7,000 SQ.FT. Lot Offered at: $3,998,000
MATT SKRABO MS MATT 3RD GENERATION REALTOR® SKRABO RESIDENTIAL REAL ESTATE (650) 804-6673 [email protected]
DRE# 01910597 www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 11 Upfront
university. Neither of these two Scandal HIGHER EDUCATION had completed the application (continued from page 5) process and neither was admitted, Stanford expels student in according to Stanford. people whom have been charged Stanford has confirmed all for allegedly conspiring with Wil- students on the sailing team who liam “Rick” Singer, 58, of New- connection with admissions scheme received an athletic recommen- port Beach, California, who ran University cites false information in student’s application dation, dating back to 2011, had a questionable college-admissions legitimate sailing experience be- coaching business. Under Singer’s by Gennady Sheyner fore applying. direction, a test taker would either tanford University has a March 21 statement in which has not been affiliated with the No students in this year’s appli- fill out college-entrance exams in expelled a student who it the university disclosed that it Stanford sailing program or any cant pool are associated with a do- place of students or correct the S determined had falsified had identified a student who was other athletic team. nation from The Key Worldwide students’ answers after they had his or her college application and associated with a contribution to The university did, however, Foundation, Stanford has said. taken the exam. University ath- who was connected to the nation- Stanford from The Key World- deem that the student is “associ- In response to the scandal, Stan- letic coaches and administrators wide college-admission fraud wide Foundation, the fraudulent ated with a contribution to Stan- ford has announced a series of created or accepted fake athletic scheme, the university announced organization that funneled money ford from the foundation in the policy changes and is conducting a profiles of the students in order to Tuesday. from parents to athletic coaches government investigation.” That “comprehensive external review” facilitate admission into top uni- In the April 2 statement, the and administrators. contribution was made several of its process for admissions rec- versities and colleges. university announced that “some The university’s former head months after the student was ad- ommendations from the athletics Singer funneled the bribes of the material in the student’s sailing coach, John Vandemoer, mitted, according to the university. department as well as how gifts through a fake nonprofit organi- application is false and, in accor- has already been implicated in the According to the Department of to athletic programs are accepted. zation he founded, the Key World- dance with our policies, (we) have scheme and was fired last month Justice investigation, the Stanford To have more oversight over re- wide Foundation, according to rescinded admission.” shortly after the federal indict- sailing program received three cruits recommended by coaches, federal prosecutors. “Any credits earned also have ment was announced. Vandemoer gifts totaling $770,000. Vande- Stanford Athletics now requires The penalties for the parents been vacated,” Stanford officials pleaded guilty to a federal charge moer acknowledged that he had that a member of the executive could be severe. Mail fraud and said. “The student is no longer on of racketeering conspiracy. accepted these contributions to leadership of the athletics depart- honest services mail fraud car- Stanford’s campus.” According to Stanford, the stu- the sailing program in exchange ment responsible review and con- ries a maximum sentence of 20 In its announcement of the ex- dent had not received a recom- for recommending two prospec- firm the athletic credentials of all years in prison, three years of pulsion, the university alluded to mendation from any coach and tive students for admission to the recruits. Q supervised release and a fine of $250,000 or twice the gross gain or loss, whichever is greater. Con- spiracy to commit money laun- dering has a maximum sentence of 20 years in prison, three years of supervised release, and a fine of $500,000 or twice the value of the property involved in the money laundering. Conspiracy to defraud the United States or IRS carries a maximum sentence of five years in prison, three years of supervised release and a fine A Free Gilfix Seminar of $250,000. The government will ask for in- carceration at the low end of the U.S. sentencing guidelines and 15TH ANNUAL other statutory factors, prosecu- tors noted in each agreement. The decision is up to the judge. SPECIAL NEEDS In addition, all of the defen- dants would receive 12 months TRUSTS SEMINAR of supervised release; a special assessment of $100; restitution to be determined by the court; and A Must If You Have a Child With a Disability forfeiture of any assets seized dur- ing investigation and prosecution. Under their respective agree- MICHAEL GILFIX, ESQ. MARK R. GILFIX, ESQ. ments, Klapper would pay a fine or penalty of $20,000; Sartorio Stanford Law J.D. Wednesday, May 1, 2019 Stanford B.S. would pay a $9,500 fine; Davi- Academy of Special 2 PM or 6 PM Loyola Law J.D. na Isackson would pay a fine or Needs Planners Featured on KTVU penalty of $100,000; and Bruce Co-Founder of NAELA and KRON TV Elks Lodge Palo Alto 4249 El Camino Real, Palo Alto, CA 94306 Isackson would pay $150,000. The Isacksons also have agreed to cooperate with the government and the IRS and to correct any YOU WILL LEARN tax returns and pay delinquent taxes and fees. They have signed separate cooperation agreements How Special Needs Trusts Work Why you MUST create one if you with the government for any in- vestigations, grand jury inquiries have a child with a disability or court proceedings. The ABLE Act: An Empowering New Tool Klapper had paid Singer Ensuring Your Child Has a Place $15,000 to participate in the cheat- Qualifying For Medi-Cal and SSI to Live ing scheme for her son, according to court documents. Sartorio paid $15,000 to aid his daughter, ac- cording to court documents filed Nonprofit Partner Organizations Attending last Wednesday. TO REGISTER Community Resources for Independent Living The Isacksons agreed to pay 650-493-8070 Guide Dogs for the Blind Singer a total of $600,000 to have Call or Pacific Autism Center for Education both of their daughters listed as National Alliance on Mentel Illness (NAMI) www.Gilfix.com Life Services Alternative, Inc recruited college athletes and to online at Pragnya obtain false test scores for the
(continued on page 15)
Page 12 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com Upfront
ENVIRONMENT To fight climate change, Palo Alto wants more electric cars, trees Earth Day report highlights city’s two-year work plan for green initiatives by Gennady Sheyner alo Alto plans to plant The two-year work plan, which appliances, such as electric heat- thousands of trees, accel- the council’s Policy and Services pump water heaters, and a lack P erate the installation of Committee endorsed earlier this of expertise among contractors File photo/Brenna Malmberg more electric-vehicle chargers in month, focuses on four key areas about alternatives to gas appli- local garages and — at long last identified by the council last year ances, according to staff. Utilities — retire this summer the energy- as pressing priorities: energy, mo- staff is recommending offering sucking, sludge-burning incin- bility, electric vehicles and wa- rebates for heat pump water heat- erators in the Baylands as part of ter management. It also includes ers, providing technical assistance City Hall’s renewed push toward three additional areas: sea-level and encouraging “all-electric” environmental sustainability. rise, natural environment and construction projects. In 2018, the These efforts and many others the reduction of waste bound for city provided rebates for 26 heat- From left, Maika Horjus, Jenny Wei, Marian and David Cortesi and will be highlighted on Monday landfills. ers, according to staff, up from 10 Uriel Hernandez, all with the Palo Alto nonprofit Canopy, gather when the City Council reviews To reduce energy consump- in 2017. around a young tree. the annual Earth Day report and tion, the city plans to update its A bigger and more pressing city is also providing incentives growing popularity of smaller considers a staff plan for pursuing building code by introducing new challenge is addressing trans- of up to $18,000 for multifamily electricity-powered modes of sustainability initiatives in 2019 energy-efficiency measures, with portation, which produces about homes and $30,000 for schools transportation, including scoot- and 2020. The council also will the goal of saving between 2% 94% of local greenhouse-gas and nonprofits to install EV ers, bikes and skateboards, the consider following in the foot- and 5% of electricity through vol- emissions. infrastructure. city should offer incentives to steps of Cambridge, Massachu- untary and mandatory programs. Palo Alto is already providing The Earth Day report notes riders who choose these options setts, which this week passed a The Earth Day report notes that funding for the Palo Alto Trans- that Palo Alto’s adoption rate for over cars. law requiring protected bike lanes energy-efficient buildings “re- portation Management Associa- electric vehicles is the highest in “We make infrastructure for to be added to roads that are un- quire less electricity, natural gas tion (TMA), the nonprofit that the the country, with a recent report cars, which are very expensive, dergoing reconstruction and that and water, while saving custom- city established in 2015 with the by the International Council on which have a huge carbon foot- have been identified in the city’s ers money.” (This goal follows goal of reducing solo commuting. Clean Transportation finding that print, but we don’t make the same bicycle master plan. one the city adopted in 2017 to According to TMA surveys, the 29% of Palo Alto’s new vehicles for these electric portable vehicles, The council agreed in February achieve electric-energy savings percentage of downtown commut- in 2017 were electric (in Califor- which have a much more dramat- to designate “climate change” as of 5.7% and gas savings of 5.1% ers who drive alone has dropped nia, the rate was 5%). ic impact on the environment,” one of its top four priorities for between 2018 and 2027.) from 57% to 49%. Councilman Greg Tanaka, who Tanaka said at the April 3 meet- the year. Monday’s meeting will Given Palo Alto’s “carbon neu- But in addition to the TMA, regularly bikes and rides an elec- ing. “The same money we spend give council members a chance to tral” electricity portfolio, city the city is also trying to acceler- tric skateboard to meetings, ar- here, if we spend just a small por- weigh in on the city staff’s sus- staff is also trying to encourage ate residents’ transition to electric gued at the Policy and Services tion of it for small, electric por- tainability plan, which is geared residents to convert from gas ap- vehicles by installing more EV Committee meeting last week table vehicles, I think the impact toward reducing the city’s green- pliances to electric ones — an chargers and by requiring new that the city should think beyond would be much, much greater.” house gas emissions by 80% by effort that has been hampered commercial buildings to include cars when it considers incentives 2030, with 1990 as the baseline. by high upfront costs for electric EV-ready infrastructure. The for electric vehicles. Given the (continued on page 14)
www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 13 Upfront Earth Day News Digest (continued from page 13) In unanimously endorsing the City to celebrate Earth Day with festival work plan, the committee added The city of Palo Alto is gearing up for this Saturday’s Earth Day Tanaka’s suggestion that the city’s Available at multiple Palo Alto locations, Festival and sixth annual Great Race for Saving Water. The event mobility efforts include all types including Cubberley Community Center, includes live music, food trucks, raffle prizes, community booths of electric vehicles. The commit- Lucie Stern Community Center, the and running events, among other activities. tee also agreed with Tanaka that Baylands Nature Center, Arastradero Held at the Palo Alto Baylands, the event has served to raise the city should consider following Park, and Rinconada Park. awareness about environmental resources and sustainability to the Cambridge’s example and adopt community since 2013, according to Catherine Elvert, utilities com- a policy requiring protected bike munication manager for the city of Palo Alto. lanes be incorporated into major NOW REGISTERING Palo Alto Mayor Eric Filseth will kick off the event by underscor- road projects. PRESCHOOL TO ing all of the sustainability achievements the city has had over its Another new initiative that the MIDDLE SCHOOL lifespan, Elvert said. city plans to roll out is the plant- There will also be a ribbon-cutting ceremony at the beginning of ing of thousands of trees. The city the festival for the completion of a major flood control project along has gone out to bid for a company San Francisquito Creek. that can create a digital tool to The Santa Clara Valley Water District also has announced trails analyze the percentage of canopy that will be reopened in time for Saturday’s event, including ones coverage in any area of town, that stretch from East Bayshore Road to Geng Road, Geng Road to down to an individual parcel. Friendship Bridge and Friendship Bridge to the bay and north of Such a tool would help the city Friendship Bridge. reach the goals of its recently up- The festival and race are scheduled for Saturday, April 13, from dated Urban Forest Master Plan, 9 a.m. to 1 p.m. at the Palo Alto Baylands Athletic Center located according to staff. To learn more, visit at 1900 Geng Road. For more information about the event, go to The city already has a plan to cityofpaloalto.org. Q plant as many as 10,000 trees in cityofpaloalto.org/jmz —Christian Trujano south Palo Alto on private proper- ty, the report states, and Palo Alto Caltrain commuter exposes riders to measles Urban Forester Walter Passmore For the fourth time in less than two weeks, public health officials said the city has been in discus- are warning the public of possible exposure to measles — this time sions with various corporations involving a Santa Clara County resident who traveled to San Fran- about funding the program. 7HSV(S[V Page 14 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com Upfront “There’s no place like home.” Scandal (continued from page 12) Public Agenda younger of the two daughters. A preview of Palo Alto government meetings next week The couple also paid less on their CITY COUNCIL ... The council plans to hold its annual Earth Day federal income taxes by deducting study session to discuss its sustainability efforts, consider approving a the bribe payments as purported vesting tentative map at 190 Channing Ave. to allow for four residential charitable contributions, accord- condominium units and two office units; and consider an ordinance ing to court documents. amending the municipal code on wireless communication facilities. Plea and sentencing hearings The meeting will begin at 5 p.m. on Monday, April 15, at City Hall, 250 have not yet been set. Hamilton Ave. The grand jury indictment re- leased Tuesday accuses Elizabeth COUNCIL FINANCE COMMITTEE ... The committee plans to adopt Matched CareGivers Henriquez, 56, and Manuel Hen- resolutions approving the financial plans for the water and wastewater- collection services; consider amending water, wastewater collection and riquez, 56, of Atherton; William storm-water management fees; and consider a funding request from Matched CareGivers is nurse owned and operated McGlashan Jr., 55, a former Palo the Palo Alto Transportation Management Association. The meeting will and has provided the best in home care and case Alto resident who now lives in begin at 5:30 p.m. on Tuesday, April 16, in the Community Meeting Room management on the peninsula for over 25 years. Mill Valley; and Marci Palatella, at City Hall, 250 Hamilton Ave. 63, of Hillsborough of conspiring Our trained caregivers provide personal care, to launder bribes and other pay- BOARD OF EDUCATION ... The school board is tentatively set to hold bathing, dressing, companionship, exercise mobility ments by funneling them through a special meeting from 6 to 8 p.m. on Tuesday, April 16, at the district assistance, and much more. Singer’s purported charity as well office, 25 Churchill Ave. The agenda wasn’t available by press time. as his for-profit corporation, The Key. The parents also allegedly CITY/SCHOOL LIAISON COMMITTEE ... The committee plans to meet When someone you care about needs assistance... transferred the money into the at 8:30 a.m. on Thursday, April 18, in the Community Meeting Room at you can count on us to be there. Call (650) 839-2273 U.S. from outside of the country City Hall, 250 Hamilton Ave. The agenda wasn’t available by press time. Menlo Park • San Mateo • San Jose Lic# 41470002 to promote the fraud scheme. ARCHITECTURAL REVIEW BOARD ... The board plans to consider Palo Alto residents Dr. Gregory façade improvements for Building E at Stanford Shopping Center; and MatchedCareGivers.com Colburn, 61, and Amy Colburn, consider a proposal to demolish existing structures and construct a 59, were already indicted by a mixed-use building with 19 apartments and up to 7,450 square feet of federal grand jury on the same office space at 565 Hamilton Ave. The meeting will begin at 8:30 a.m. on charges on March 26. Thursday, April 18, in the Council Chambers at City Hall, 250 Hamilton Ave. The Henriquezes allegedly paid Singer $25,000 in 2015 to PUBLIC ART COMMISSION ... The commission plans to allocate have Mark Riddell, another co- $9,500 for ground regrading of Arpeggio V by artist Bruce Beasley; 7HSV(S[V www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 15 Upfront scores to Ernst, according to the for their roles in facilitating the fal- the grand jury indictment. had a fake football player pro- Scandal complaint. sified exam for the Henriquezes’ Singer and Riddell used the file created for the boy and used (continued from page 15) Singer paid Ernst $950,000 younger daughter and another stu- center frequently in their scheme Photoshop to place the son’s head through The Key Worldwide dent. Manuel Henriquez agreed to after getting students transferred onto the body of a kicker, accord- Riddell allegedly provided the Foundation for the coach to des- help Singer secure the admission of there through a fraud in which the ing to the indictment. daughter with answers to the ignate the Henriquezes’ older an applicant to Northeastern Uni- parents claimed their children had Palatella — a longtime donor to exam. Singer then paid Riddell daughter and several other stu- versity in Boston, Massachusetts, learning disabilities. They said the Sacred Heart Schools in Atherton $10,000 in three separate install- dents as tennis recruits. in lieu of paying for the cheating. children needed more time to take where an athletic field was named ments through his nonprofit. The couple also allegedly hired The couple also allegedly paid the exams because of purported after her family — wired $75,000 The Henriquezes also allegedly Singer in 2016 to have Riddell Singer $25,000 in cash for facili- disabilities rather than being tested to Singer’s foundation for Riddell paid Singer $400,000 to help get proctor and provide answers for tating cheating for their younger along with other students at their to proctor her son’s SAT exam their daughter into Georgetown the ACT exam to their younger daughter in the SAT exam in 2017. regular schools. Singer funneled and to correct his answers in 2017. University as a tennis recruit. daughter at a testing facility in McGlashan allegedly paid Sing- payments to Riddell and other con- Palatella ultimately paid $500,000 Singer allegedly directed Eliza- Houston, Texas. They allegedly er $50,000 through the foundation spirators through his foundation. to have her son represented as a beth Henriquez and her daughter lied to her school guidance coun- to arrange for Riddell to proctor McGlashan also allegedly paid purported football recruit to USC. to send a letter to tennis coach selor, claiming they needed to his son’s ACT exam at a West a total of $250,000 to Singer to She paid $100,000 to Donna Gordon Ernst misrepresenting her move the test site because they Hollywood test center and to se- facilitate his son’s admission as a Heinel, USC’s senior associate tennis experience. The daughter would be in Houston at that time. cretly correct the answers without football recruit to the University athletic director, who allegedly also emailed her fraudulent SAT Singer paid his cohorts $70,000 the boy’s knowledge, according to of Southern California. Singer presented the boy’s application to the university’s subcommittee for athletic admissions and obtained approval to admit him as a recruit. Palatella agreed during a 2018 phone call with Singer to mislead the IRS if anyone inquired about her payments to the foundation, CityViewA round-up of Palo Alto government action this week according to the indictment. Attorneys for the defendants City Council (April 8) could not immediately be reached 335 Webster St.: The council voted to sell the city’s share of former City for comment. An arraignment Manager James Keene’s home at 335 Webster St., and directed its Finance date for the parents has not yet Committee to consider ways to use the proceeds to promote employee housing. Yes: Cormack, DuBois, Kou, Tanaka No: Filseth, Fine Absent: Kniss been scheduled. Two well-known actresses have Utilities Advisory Commission (April 9) also been implicated in the ad- Underground utilities The commission supported a resolution that would give missions scandal. Lori Loughlin, utility districts the option, by a supermajority vote by customers, to maintain an 54, of Los Angeles, and her hus- underground utility district. Yes: NoneYes: Danaher, Johnston, Forssell, Segal No: Schwartz Absent: Ballantine, Trumbull band, clothing designer Mossimo Water The commission recommended adopting Fiscal Year 2020 Water Utility Giannulli, 55, were among the 16 Financial Plan and a resolution increasing water rates by 1 percent. Yes: NoneYes: indicted on Tuesday on the same Danaher, Johnston, Forssell, Schwartz, Segal Absent: Ballantine, Trumbull charges for allegedly paying Singer Electricity The commission recommended adopting the Fiscal Year 2020 Electric Financing Plan and a resolution increasing electric rates by 8 percent. $500,000 for facilitating admission Yes: NoneYes: Danaher, Johnston, Forssell, Schwartz, Segal Absent: for their two daughters into USC as Ballantine, Trumbull purported crew team recruits. Felicity Huffman, 56, of Los Board of Education (April 10) Angeles, has agreed to plead Stanford GUP The board met in closed session to discuss with legal counsel anticipated litigation regarding the environmental impact report for Stanford guilty under the same conditions University’s proposed general use permit (GUP). Action: None as the other defendants, in addi- tion to paying a $20,000 fine. She Planning and Transportation Commission originally paid $15,000 on behalf (April 10) of her oldest daughter. Q 1210 Newell Road: The commission upheld the planning director’s tentative Staff Writer Sue Dremann decision to deny a variance request that would have allowed an exception to can be emailed at sdremann@ height regulations for an unpermitted fence. Yes: Unanimous paweekly.com. Dental Cleaningss 20 OFF MIDTOWN is OPENPEN LATLATEE % until 10PM weekdayskdays and weekends. FREE EXAM Full Medical, for New Clientss Surgical, and Emergency Care. (650) 397-7387 3045 Middlefield Rd, Palo Alto 94306 midtownvetpa.comidt t Page 16 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com Open House 988 Menlo Avenue Saturday & Sunday 1 – 4pm Menlo Park 2 Bed 2.5 Bath 1,570 Sq Ft $2,195,000 • Gorgeous townhouse in fabulous downtown Menlo Park complex • Rarely available, very private and quiet unit in a desirable corner location • ObOodtppWOM_WyWbUoddazWsVoOl_BKOÛyBt_sOM ceiling, built-in bookcase / entertainment center and access to large, private patio • Separate dining room with doors to southwest facing deck and garden • Beautifully updated, well-appointed kitchen with granite countertops, counter seating and nook area 873 Partridge Avenue Menlo Park Open House 3 Bed 2 Bath 1,350 Sq Ft $2,395,000 Saturday & Sunday 1 – 4pm • /tbb|ÛdlOb_WyWbUæMWbWbUoddazWsVoOl_BKO • Well-appointed kitchen with granite countertops, tile backsplash, stainless steel appliances, and paneled refrigerator • Kitchen/family room with breakfast nook and French doors leading to private, enclosed courtyard • doUOdtpVBoMzddMddop • 1-car garage • So convenient to downtown Menlo Park, downtown Palo Alto, Caltrain, and Stanford. Award-winning Menlo Park schools Monica Corman Mandy Montoya 650.465.5971 650.823.8212 [email protected] [email protected] DRE 01111473 DRE 01911643 Rankings provided courtesy of Real Trends, The Thousand list of individual agents by total sales volume in 2018. Compass is a real estate broker licensed by the State of California and abides by Equal Housing Opportunity laws. WKObpO!taJOoà__aBsOoWB_loOpObsOMVOoOWbWpWbsObMOMTdoWbTdoaBsWdbB_ltoldpOpdb_|BbMWpKdalW_OMTodapdtoKOpMOOaOMoO_WBJ_OJtsVBpbdsJOObyOoWOMà VBbUOpWbloWKOÛKdbMWsWdbÛpB_OdozWsVMoBzB_aB|JO made without notice. No statement is made as to accuracy of any description. All measurements and square footage are approximate. www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 17 Alcohol or drug related Driving under influence...... 2 Drunk in public ...... 1 Peter Fenerin Possession of drugs...... 2 Possession of paraphernalia ...... 1 Under influence of drugs ...... 1 April 22, 1951 – March 16, 2019 Miscellaneous Animal call ...... 1 Pulse Found property...... 3 Peter Fenerin, age 67, passed en years, and were married for A weekly compendium Info. case ...... 3 away on March 16, 2019 from 29 wonderful years. With the Lost property ...... 1 of vital statistics Other/misc...... 2 metastasized prostate cancer Loma Prieta earthquake nip- Outside assistance...... 1 with his loving wife Rene Cor- ping at Peter’s heels, he realized Suspicious circumstances ...... 1 Trespassing ...... 1 tinaz by his side. Peter was how impermanent life was and POLICE CALLS Vandalism...... 1 born and raised in Palo Alto proposed marriage. They mar- Palo Alto Warrant arrest...... 3 and lived most of his life in the ried at home and received a April 3-April 9 Warrant/other agency...... 3 Violence related Bay Area. wonderful small ceremony with Battery ...... 1 VIOLENT CRIMES Peter attended parochial family and friends. Domestic violence ...... 2 Palo Alto Theft related Amherst Street, 4/4, 8:04 p.m.; school at St. Albert the Great in Following the earthquake Commercial burglaries ...... 4 domestic violence. Palo Alto through grade 7 and Peter as a general contractor, Grand theft...... 1 Encina Avenue, 4/5, 4:29 a.m.; domestic Identity theft ...... 1 violence. experienced public education got into restoring antique unre- Petty theft...... 5 640 Emerson St., 4/9, 10:30 a.m.; for the first time in the eighth grade at Jordan inforced masonry buildings (URMS) in the Vehicle related battery. Jr. High in Palo Alto. Public school gave way South Bay saving a 1870’s family building Auto burglary ...... 1 Menlo Park Attempted auto burglary...... 1 1300 block Willow Road, 4/3, 12:36 to a Jesuit education for high school where that received landmark status as the Glein- Driving w/ suspended license...... 4 a.m.; assault. Fenerin Building. Peter began work on his Hit and run ...... 5 1300 Mills St., 4/3, 2:17 a.m.; assault. he attended and graduated from Bellarmine Misc. traffic...... 1 300 Sharon Park., 4/7, 2:24 a.m.; College Preparatory in San Jose, class of ’69. family properties as the first restoration work Theft from auto...... 12 robbery. Vehicle accident/minor injury ...... 3 From an early age he expressed his nature of URMS to help preserve heritage buildings Vehicle accident/prop damage...... 5 for exploration in a variety of interests. He and presented the first seminar with Preser- Vehicle tow ...... 5 SUBMITTING began beekeeping at age eleven which he vation Action Council and the City of San Alcohol or drug related Drinking in public ...... 3 TRANSITIONS continued for several years and would sell his Jose and other stakeholders. As part of the Driving under influence...... 1 Drunk in public ...... 2 ANNOUNCEMENTS honey to his Palo Alto Times paper route cus- City of San Jose’s outreach program he con- Possession of drugs...... 4 Possession of paraphernalia ...... 5 tomers. At about the same age he began sail- tinued work until he was surprised at being The Palo Alto Weekly’s offered a position as a building inspector Under influence of drugs ...... 2 ing solo in San Francisco Bay out of the Palo Miscellaneous Transitions page is devoted Alto Yacht Harbor (no longer active). As a and spent the past 21 years with the City of Found property...... 2 to births, weddings, young teenager he began learning boatbuild- San Jose Building jurisdiction. Peter became Juvenile problem ...... 1 anniversaries and deaths of Lost property ...... 3 local residents. ing at Aeolus Boatworks in Davenport under president of the building inspectors union, Missing person...... 1 Other/misc...... 1 Obituaries for local the tutelage of Bill Grunwald. Over several ABMEI, which he held for 7 years after long- Psychiatric hold ...... 4 residents are a free editorial years he built wooden boats for himself for serving Tom Brim decided to retire. Peter Suspicious circumstances ...... 1 service. The best way to Vandalism...... 1 submit an obituary is through both sailing and rowing. Peter struggled was very proud of his work with the union Warrant/other agency...... 7 along the way with his love for working with and his fellow building inspectors and ad- our Lasting Memories website, at PaloAltoOnline. his hands at Aeolus Boatworks and his desire vancing the cause of labor. Menlo Park April 3-April 9 com/obituaries. for education. He attended UCSB but being Peter was Violence related Paid obituaries are infected with the bug of building boats won known to be a Assault ...... 2 also available and can out over a formal education. superb cook, Robbery ...... 1 be arranged through our Theft related advertising department by With Peter’s burgeoning love for travel he conversation- Fraud ...... 2 Grand theft...... 1 emailing [email protected]. was able to enjoy the passage assistance pro- alist, gardener Petty theft...... 1 Send wedding, anniversary gram to Australia at age 19 where he lived and and story teller Vehicle related or birth announcements to worked in Sydney for over a year and when who could turn a Driving w/ suspended license...... 5 [email protected] or P.O. Hit and run ...... 2 Box 1610, Palo Alto 94302, the clichés about Australia turned out to be phrase. He loved Vehicle tow ...... 3 or fax to 650-223-7526. true. He still considered it a second home wildlife, travel, today and he and Rene made three visits to the natural and Australia over the years. He was fortunate built environ- enough to find employment in the hospitality ment, maritime industry with Travelodge Proprietary, LTD. history, reading, studying Spanish, good Prior to that, in desperation, he took a job food and wine, and most of all time with his with New South Wales Government Railway wife and dear friends. Peter and Rene made which fueled a life-long interest in steam rail- their home in Redwood City for the past 21 roads. But being homesick for California he years following 15 years in Palo Alto. returned home where he spent the next sev- Peter was preceded in death by his par- ® eral years in construction. During this time ents, William and Virginia Fenerin, and by he took time off to be a dancer which were his sister Patsy Luniewski. He is survived some the most physically satisfying years of by his wife, Rene Cortinaz, brother Michael his life. People said “for a carpenter, he wasn’t Fenerin (Janet), brother-in-law Carlos Cor- a bad dancer.” He also practiced yoga and tinaz, and sister-in-law Patricia Fuller and a occasionally taught classes In Palo Alto when multitude of friends – all of whom will miss it was a great time to do the arts. He gave up him terribly. dance and focused on construction to form A celebration of Peter’s life is planned and his own construction company. his ashes will be scattered at sea as he desired. It was at that time that he met Rene, the If you want to sign his guest book you may love of his life, or as he would say in his be- visit http://peter-fenerin.lastingmemories. loved Spanish, “el amor de mi alma”. He com. The DeLeon Difference® said he would never forget looking into her If you wish to donate in Peter’s memory to deep brown, forgiving eyes, and knowing one of his favorite non-profits, please con- 650.543.8500 she was the one. She would later tease him sider: Sierra Club, Monterey Bay Aquarium, www.deleonrealty.com saying those forgiving eyes were a necessity. Ducks Unlimited, Peninsula Open Space They dated for a year, lived together for sev- Trust (POST), and Habitat for Humanity. 650.543.8500 | www.deleonrealty.com | DeLeon Realty CalBRE #01903224 PAID OBITUARY Page 18 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com INVESTMENT OFFERING Kushla LIFE SCIENCES Births,Transitions marriages and deaths &ƵůůLJƉĞƌŵŝƩĞĚĂŶĚůŝĐĞŶƐĞĚĐĂŶŶĂďŝƐĐŽŵƉĂŶLJ Beverly Bogart Richard Bogart and Judy Bogart- in 2018 and in Florence, Italy, in ĐƵƌƌĞŶƚůLJďƵŝůĚŝŶŐŽƵƚŽƵƌϲϬϬϬƐƋƵĂƌĞͲĨŽŽƚĨĂĐŝůŝƚLJ Beverly Bogart, 94, died on Hyde, both of Palo Alto; and two 2019 as part of Stanford’s Bing ŝŶ^ĂŶƚĂZŽƐĂ͘tĞŚĂǀĞĂǁŽƌůĚĐůĂƐƐĐŚĞŵŝƐƚĂŶĚĂ March 15 at her home in Palo Alto. grandchildren. She was preceded Overseas Studies Program, be- She was born in Buenos Aires, in death by her husband in 2005. coming fluent in both Spanish ƐƚĂīǁŝƚŚŵĂŶLJLJĞĂƌƐŽĨĞdžƉĞƌŝĞŶĐĞŝŶƚŚĞŝŶĚƵƐƚƌLJ͘ Argentina, in 1925 to Solomon A memorial service will be held and Italian. and Pauline on April 22 at 2 p.m. at the Osh- He worked as a computer-sci- Sokolow, who man Family Jewish Community ence tutor through Breakout Men- /ĨLJŽƵ͛ƌĞĂŶŝŶǀĞƐƚŽƌůŽŽŬŝŶŐĨŽƌĂŶŽƉƉŽƌƚƵŶŝƚLJ͕ had emigrated Center, 3921 Fabian Way, Palo tors in Palo Alto and held comput- ĐŽŵĞǀŝƐŝƚƵƐ͕ůĞĂƌŶĂďŽƵƚƵƐ͕ĂŶĚƐĞĞŝĨǁĞ͛ƌĞĂ from Rus- Alto. Memorial donations may er-science internships at Infosys sia along with be made to the Community Tues- in Bangalore, India, Zeal Learn- ŐŽŽĚĮƚĨŽƌLJŽƵƌĮŶĂŶĐŝĂůŐŽĂůƐ͘ their young days concert program at the JCC ing in San Francisco and Break- son, Samuel. (paloaltojcc.org/Donate). out Mentors. He also worked as a Prospectus and Financials available upon request. Following the graphic-design intern at Opinno death of her Mischa Nee in Madrid. $50,000 minimum required. father, she im- Mischa Nee (Mikhail Erick- He loved to travel. He wanted to migrated to the United States at son Nee), 20, of Palo Alto died see the world, and in his short life- Contact: John Houston the age of 11 with her mother and on March 22 in a hiking accident time, he visited nearly 30 coun- brother. They settled in Los Ange- in Deia, Spain, on the island of tries beyond the United States: [email protected] les, where she attended Los Ange- Majorca. Aruba, Austria, the Bahamas, Phone: 707-479-4913 les High School and University of He was born in Palo Alto on Belize, British Virgin Islands, California, Los Angeles. Aug. 1, 1998. Canada, the Cayman Islands, the dŚŝƐŝƐŶŽƚĂŶŽīĞƌƚŽƐĞůůŽƌĂƐŽůŝĐŝƚĂƟŽŶŽĨĂŶLJŽīĞƌƚŽďƵLJĂŶLJƐĞĐƵƌŝƟĞƐ͘KīĞƌƐĂƌĞŵĂĚĞ In 1947, she married Louis Bog- Since early Dominican Republic, France, ŽŶůLJďLJƉƌŽƐƉĞĐƚƐŽƌŽƚŚĞƌŽīĞƌŝŶŐŵĂƚĞƌŝĂůƐ͘dŽŽďƚĂŝŶĨƵƌƚŚĞƌŝŶĨŽƌŵĂƟŽŶ͕LJŽƵŵƵƐƚ art, a war veteran who was study- childhood, he Germany, Grenada, Haiti, Hondu- ĐŽŵƉůĞƚĞŽƵƌŝŶǀĞƐƚŽƌƋƵĞƐƟŽŶŶĂŝƌĞĂŶĚŵĞĞƚƐƵŝƚĂďŝůŝƚLJƐƚĂŶĚĂƌĚƐ͘ ing physics at the California In- embraced the ras, Hungary, India, Italy, Jamai- stitute of Technology. The couple circus arts, ca, Japan, Luxembourg, Mexico, moved to the Bay Area in 1952, quickly excel- Morocco, the Netherlands, Portu- both eventually going to work for ling in jug- gal, Saint Kitts and Nevis, Singa- Stanford University. She was a gling, unicycle, pore, Sri Lanka, Spain, Thailand librarian in the university’s aerials and and the United Kingdom. He went Law Library until her retirement slackline. He beyond casual tourism; he was in 1987. was a proud alumnus of Camp proud that he had lived (by his She and her husband traveled Winnarainbow, a circus and per- definition, a stay of more than two Join our team! extensively following their re- forming arts camp in Laytonville, months) in five countries besides tirement and were both actively California. He was also an avid the U.S.: the Dominican Republic, We’re looking for talented, engaged in progressive political skimboarder, a skill nurtured dur- France, India, Italy and Spain. causes throughout their lives. In ing summers with extended fam- His family remembers him as highly-motivated and dynamic people 1948, she worked on the presi- ily at the Jersey Shore. kind, loving and happy, with a dential campaign of Henry Wal- At Palo Alto High School, from unique gift of connection and a lace of the Progressive Party and which he graduated in 2016, he talent for finding and nurturing Embarcadero Media is an independent multimedia news personally collected a large cam- spent much of his time in the friendships with a wide variety organization with over 35 years of providing award-winning paign contribution from film star Media Arts Center, serving as of people. He never let himself be Edward G. Robinson. In 1969, editor-in-chief of The Campanile, limited by labels or definitions. local news, community information and entertainment to the she served on Stanford’s low-cost the Paly newspaper, and assisting He is survived by his parents, Midpeninsula. housing (Moulton) committee, re- with other publications. In 2014, Tekla (Perry) Nee and Eric Nee porting on the need for low- and he co-founded Camp MAC, a of Palo Alto; and his siblings, We are always looking for talented and creative people moderate-cost housing in the Stan- journalism program for rising Nadya Nee and Alex Nee of Los ford area. She was also involved in eighth and ninth graders that con- Angeles. Funeral services and a interested in joining our efforts to produce outstanding the civil rights and anti-war move- tinues to operate today. He was a celebration of life were held this journalism and results for our advertisers through print and ments of the 1960s and 1970s and member of the Paly debate team, week. A memorial fund has been online. a lifelong, vocal supporter of the the junior varsity lacrosse team created in his honor to support rights and dignity of all. and the varsity cross country the mission of Camp Winnara- We currently have the following positions open In retirement, she was a mem- team. inbow, a place that helped shape ber of the senior center of the Palo He also participated in the ser- him. More information on the for talented and outgoing individuals: Alto Jewish Community Center, vice organization Amigos de las fund and his life can be found at where she served on a number of Americas and spent two months mischanee.com/memorial-fund. • Advertising Sales/Production Admin Assist the sales and committees and participated in working in the Dominican Repub- design teams in the production of online and print advertising. arts programs and current-affairs lic when he was 15. He received groups. She met and befriended the President’s Volunteer Service BIRTHS Tech savvy, excellent communication and keen attention to many recent arrivals from the East Award/Gold, was a Gold Key detail a must. Coast and Russia and volunteered winner for critical essay in the William Schulz and for many years at the South Palo Scholastic Writing Awards and Ylemsuy Rubio of East Palo • Graphic Designer Creation/production of print and online Alto Food Closet. was a National Merit finalist. Alto, a son, April 5. ads, including editorial layout, in a fast-paced environment. At the Moldaw Residences se- He entered Stanford Univer- nior-living community, where she sity in September 2016, quickly Publishing experience and video editing a plus. was one of the first residents and discovering computer science • Digital Sales Account Representative Prospect and sell lived from 2009 on, she continued as a new passion and winning to serve on numerous committees the Programming Methodology local businesses in our markets who have needs to brand and played an active role in wel- Graphics Contest that year. At Lasting and promote their businesses or events using our full-suite coming new residents. the same time, he rediscovered She was an avid lover of music the fine arts, studying art history Memories of digital solutions. and theater, and she particularly and sketching and painting as an enjoyed opera and classic films. artist himself, an interest he had An online directory of For more information visit: She was a part of the Moldaw put aside after elementary school. obituaries and remembrances. http://embarcaderomediagroup.com/employment Singers and a longtime member At Stanford he joined the jump Search obituaries, submit a of the Wagner Society of Northern rope team. He also participated memorial, share a photo. California. She held season tick- in Stanford Dance Marathon, not ets to the San Francisco Opera, the only as a 24-hour marathoner Lamplighters and West Bay Op- but also serving as dorm captain, Go to: era, for which she never missed a event coordinator and graphic PaloAltoOnline.com/ performance. designer. obituaries 450 Cambridge Avenue | Palo Alto, CA 94306 | 650.326.8210 She is survived by her children, He studied in Madrid, Spain, PaloAltoOnline.com | TheAlmanacOnline.com | MountainViewOnline.com www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 19 Editorial Not-so-free parking Valet parking program needs audit, not a million-dollar extension alo Alto has to be the only city that provides valet parking Editorials, letters and opinions at no charge in a city parking garage —at a cost of some Spectrum P $15 per car parked —while at the same time saying that reducing car use is one of its top transportation priorities. But that’s what we’ve been doing for the last four years for the Debunking concerns of flooding, will taller and larger required in these multi-story apart- benefit of squeezing in about 50 additional parked cars each day. buildings result? What if all build- ments, tenants will park on the And last week the City Council extended and expanded the pro- about Avenidas building Editor, ing is prohibited in some areas — streets. But the other consequence gram for three additional years. In the April 5 issue of the Week- would densification in other areas of this gift to developers is that it It’s no secret to anyone with a parking permit issued by the city ly, a reader expressed concern occur? Are currently discussed will seriously damage California’s of Palo Alto that the entire parking system is a convoluted and about the new Avenidas senior cen- designs — including Cubberley attempt to get people to reduce confusing mess. ter building. As a 30-year environ- Community Center’s underground greenhouse-gas generation by con- Here at the center of innovation and technology, we have a sys- mental health and safety manager, I garage or the desired trench/tunnel verting to electric vehicles. tem that is astonishingly difficult to use. Most permit holders of can respond to the health concerns for rail grade separation — going The legislature has worked very residential and employee parking permits must either go to City that she expressed. to be able to withstand groundwa- hard to drive California to reduce Hall every six months, show their ID, pay and pick up their permit Modern glues used by flooring ter-level rise? our greenhouse-gas emissions. Our or they must contend with a buggy online re-registration system. installers are no longer toxic as A free presentation on climate electricity is increasingly clean, and Each area in the city with permit-parking restrictions has different they were in the old days. Modern change and sea-level rise featur- there are significant advances in rules and eligibility requirements. The online system is clunky, glues may have an odor, but typi- ing Dr. K. Hill is set for April 24 this area. The largest source of pol- buggy and confusing. City “help” phone lines go unanswered and cally that odor is not harmful to our at the Mitchell Park Community lution in the state is transportation. voicemail boxes are full. health. I expect that Avenidas will Center, El Palo Alto Room, 3700 Peninsula Clean Energy, of We challenge City Council members to experience this system research this concern and explain Middlefield Road, Palo Alto, from which I am the vice-chairman, for themselves and discover how far behind we are in achieving what they learn. 6:30-8:30 p.m. More information is has launched a program to deploy state-of-the-art practices for efficiently managing permitted park- The warning sign out front of the available at savepaloaltosground- 3,600 charging stations in San ing and garage utilization. new building is required by Cali- water.org. Mateo County to encourage and It is no wonder that with the complicated parking system, along fornia law if there is any chance Rita Vrhel enable more people to purchase with the controversies surrounding traffic-calming measures that a chemical on the state’s list Channing Avenue, Palo Alto electric vehicles; however, an enor- throughout the city, that the transportation staff is suffering from of potential cancer agents might be mous impediment to electric ve- multiple vacancies and is currently without a department head. present. On that list are 900 sub- hicle purchase is that 50% of San Without the staff resources to operate five residential parking SB 50 would harm stances, including coffee, medica- Mateo County residents live in programs (downtown, Southgate, Evergreen Park, California Av- tions, sunglasses (because of plastic environment multi-family buildings and there enue and College Terrace, with another in Old Palo Alto soon to frames) and the vinyl in most lino- Editor, isn’t an inexpensive way to enable come) each with different rules, and employee permit parking in leum. That warning sign is stan- SB 50 is focused on a serious electric vehicle charging in multi- city garages and surface lots, the city has been contracting with SP dard in all new buildings. problem that all of California fac- unit buildings. Plus, a national company, to administer the program. Carpets installed in public build- es: the need for affordable hous- If SB 50 mandates multi-family This is the same company that has been getting paid more than ings are normally chosen for ease ing. However, SB 50’s solution is development without parking, $300,000 a year by the city to operate its “free” valet parking of cleaning and for good wear char- an urban solution that is a windfall then it guarantees that those resi- service between 11 a.m. and 2 p.m. for the last four years in “Lot acteristics. There is no evidence to developers who would apply its dents are much less likely to pur- R,” the garage located between Alma and High streets just south that carpeting itself is bad for asth- mandate in the suburban environ- chase electric vehicles. SB 50’s of University Avenue. ma; it is not. Carpeting in homes ment. SB 50 enables developers to no-required-parking mandate is in The valet program, which utilizes three attendants who report that are seldom cleaned could very build four-story, multi-family apart- opposition to California’s efforts they double-park an average of about 50 cars per day during the well be. ments within a half mile of a train to encourage people to purchase three-hour period, was approved by the City Council in 2015 as a In conclusion, I have found that station, and it would override local electric vehicles. pilot. According to the city, it is costing between $14 and $22 per Avenidas is a well-managed pro- zoning to allow these buildings to Rick DeGolia car parked each day. But the drivers pay nothing. Valet parking is a vider of services to seniors. I be- have zero parking. If parking is not Clay Drive, Atherton free service for those who have parking permits. When the garage lieve that all of us can expect that fills up, the attendants put out signs directing drivers to park in the they will do a good job of keeping drive aisle and leave their keys. WHAT DO YOU THINK? the new Palo Alto senior-enrich- Last week, on April Fools’ Day and with no discussion, the ment center running smoothly. City Council approved on its consent calendar another three- The Palo Alto Weekly encourages comments on our coverage Avenidas is a trusted nonprofit year, $900,000 contract with SP Plus to continue the program or on issues of local interest. with an excellent track record. I and potentially expand it to the Cowper/Webster garage and the look forward to using the new Palo Bryant/Lytton garage (which had the valet service until it was What has been your Alto facility in good health going discontinued). forward. There was no analysis or data provided to the council showing experience with cell antennas Clem Molony the daily utilization of the valet parking or assessing the impacts of Menalto Avenue, Menlo Park in your neighborhood? other city measures implemented since 2015: the elimination of the color-zoned street parking downtown, the effects of the downtown Submit letters to the editor of up to 300 words to [email protected]. residential permit-parking program or the reduced car use claimed Sea-level rise and Submit guest opinions of 1,000 words to [email protected]. Include your by the new downtown Transportation Management Association as name, address and daytime phone number so we can reach you. a result of incentives to get downtown workers to use public trans- Palo Alto We reserve the right to edit contributions for length, objectionable content, Editor, libel and factual errors known to us. Anonymous letters will generally not be portation or carpool. There was also no analysis of how providing Many of us are becoming in- accepted. Submitting a letter to the editor or guest opinion constitutes a granting valet parking service for permit holders addresses the problem of of permission to the Palo Alto Weekly and Embarcadero Media to also publish it creasingly concerned about climate the lunchtime surge in parking demand by unpermitted cars need- online, including in our online archives and as a post on Town Square. change’s possible impacts. ing to park for under two hours. For more information, contact Editorial Assistant Cierra Bailey at cbailey@ Our organization, Save Palo paweekly.com or 650-223-6526 or Editor Jocelyn Dong at [email protected]. The city rationalizes the exorbitant per vehicle cost of providing Alto’s Groundwater, is especially the free valet service by the fact it has been able to bump up by 150 concerned with one infrequently the total number of permits it issues, thereby collecting fees that discussed impact: As the sea level partially offset the expense. rises, so does the groundwater level. The city’s philosophy of limiting the number of permits it issues Studies in other communities (see for parking garages and surface lots is misguided. Permits should bit.ly/2G4yPPv and bit.ly/2I9hOr8) be sold to whoever wishes to buy them and shouldn’t be viewed have indicated groundwater rise as entitling the holder to a parking space. This would eliminate could double the area flooded by a huge administrative headache of maintaining waiting lists and sea-level rise alone, with impacts the need for permit holders to repeatedly go to City Hall to prove felt up to 2.5 to 3 miles inland. Le- their identity, pay for and pick up permits. vees and sea walls are not effective With every new city action, our Rubik’s cube system of parking against groundwater rise. becomes less rational, more complicated and more disconnected As our cities plan for and adapt from the community’s needs. It badly needs review, simplification to sea-level rise, future zoning and and automation, which should be Job One for the new transporta- development will likely be affect- tion manager. Q ed. If underground construction is impossible in some areas because Page 20 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com Check out Town Square! Hundreds of local topics are being discussed by local residents on Town Square, a reader forum sponsored by the Weekly at PaloAltoOnline.com/square. Post your own comments, ask questions or just stay up on what people are talking about around town! Guest Opinion Recycling: A ‘good deed’ that punishes southeast Asia by Bob Wenzlau ecycling is one composting facilities — and the vehicles materials to overseas markets. CalRecycle, plastic for beverages). The rest of the plas- of the simple for collection — dwarfs the programs of the state agency overseeing diversion, does tics, about 1,000 tons per year, should not R “good deeds” the 1970s. While the recycling of the 1970s not enforce regulations that would ensure be placed in the blue bin until Palo Alto that we perform daily required more attention and work, the cur- that materials sent to southeast Asia are finds an acceptable domestic recycler. at home or work. The rent recycling system has made our “good actually recycled, or recycled to accept- As for waste paper, Palo Alto residents blue bins for recycling deed” seem easy. able environmental and social standards. generate 1,000 tons per year of corrugated and green for compost But the near 90% diversion is achieved at A shipper merely states “for the purpose cardboard that is recycled domestical- are “good,” and we cel- the expense of recovery costs. Meanwhile, of recycling” on shipped materials — no ly; the remaining 6,000 tons per year of ebrate as our discarded the relatively local footprint of recycling questions asked — and our city accom- waste paper streams should not go in the materials shift to the has shifted to global. plishes its objective of waste diversion. blue bin until domestic recycling markets green and blue bins instead of the black A key to this transformation has been The irony is that the black bin may actu- are established. The consequence of these bin. Asia. During the 1990s, China was pro- ally be “good”: It contents’ fate is known, principles is a lower diversion rate, which Is this shift too good to be true? Have we cessing massive flows of mixed papers while the blue bin’s is unknown. A plastic would drop from 90% to about 75%. This really performed “good deeds”? and plastics from American communities, or paper placed in the black bin will go to is a drop that would be honorable in that Palo Alto was a founder of “curbside” and diversion objectives were being met. a regional landfill with the environmental it protects the vulnerable communities of recycling to increase citywide participa- But processing those materials generated impact kept in America, while the exported southeast Asia. tion and material recovery. The curbside enormous pollution, so China recently plastic or paper placed in the blue bin might We also need change at the state level. recycling of the 1970s relied on discrete stopped accepting them as part of its envi- create severe adverse impacts to unsophisti- California should accept and enforce “ver- separations of glass, paper and metals into ronmental-improvement initiatives. South- cated communities in southeast Asia. ified” recycling and not count shipments simple burlap bags. Palo Alto also started east Asian countries stepped in to take the These circumstances offer simple princi- to an unknown end in southeast Asia as local collection of yard trimmings, which materials created by China’s pullback, but ples to our city. A first principle is that Palo “diversion.” California must also drive new were sent to a local municipal composting they lacked China’s industrial processing Alto’s wastes should not impact any com- recovery technology, as well as limit the center. In those days our recovery rate was scale, and materials soon were piling up in munity in southeast Asia more adversely complex packaging that has complicated lower, but the quality of the recovery was ports and communities. than locally acceptable environmental or recovery efforts. This request has been high. Paper, glass and metals were recycled Greenpeace’s documentation of America’s social standard. A second principle is that placed for consideration with our assem- domestically with many recovery facilities plastics shipped to southeast Asia gives a when we do not know the social or envi- blyman, Marc Berman. within California. The compost would be glimpse of who receives them. In a rural vil- ronmental impact of our waste, we must Our individual actions and choices also returned to our gardens, keeping these or- lage, women and children are sorting piles presume that the impact is harmful rather have considerable impact: They create ganic materials local. of plastics, making the village vulnerable to than benign. much of the waste our city manages. The Then the state shifted the goal from “re- fire and toxics. Other research reveals paper Applying the foregoing principles gener- mantra “Reduce, Reuse, Recycle” begins covery” to a broader goal of “waste diver- recycling and its treatment processes kill ates actions that our city should take. Giv- with two actions you can take as an indi- sion” from landfills. The waste-services and color the rivers, and a vital community en we know nothing of the impact of our vidual: reduce material consumption and industry streamlined “recycling” by creat- and natural resource is lost. Southeast Asian discards shipped to southeast Asia, the city reuse or repair items instead of disposing ing material-recovery facilities that could countries lack basic environmental enforce- must presume them harmful, and thereby or recycling. Q do the sorting for you. Along the way, ment that would prevent these dark scenarios. not acceptable inside our blue “recycling” Bob Wenzlau is a founder of Palo Alto’s companies that produce consumer prod- Here is our challenge: How do we achieve bins. Some plastics should go in the blue curbside recycling programs, a board ucts merged papers with plastics and foils, “diversion” while preserving the effective bin — for Palo Alto residents, that’s about member of Repair Cafe, president of and plastic variations multiplied — actions “recovery” of the 1970s? We are basically 400 tons per year — for those plastics used Palo Alto Neighbors Abroad, and CEO of that complicated recovery. in the dark. Palo Alto’s waste-management domestically: the PET plastics (clear wa- Terradex, Inc. He can be emailed at bob@ The scale of these regional recovery and company does not reveal the destination of ter bottles) and the HDPE plastics (cloudy wenzlau.net. Streetwise What do you think should be done about the housing crisis in Palo Alto? Asked around Palo Alto. Question, interviews and photographs by Christian Trujano. Adam Weaver Jackson Larango Michael Hollands Erica Ramon Jan Holliday Retail Floor Lead Tech Marketer Software Worker Nanny Retired Edison Way, Redwood City Arbor Avenue, Los Altos Middlefield Road, Palo Alto Delmas Street, Mountain View Kent Place, Palo Alto “Having more service roles, manual “I think it’s about getting together and “I don’t know if Palo Alto is big “Getting paid cost of living would “Limit the number of business labor, construction and stuff like that coming up with a long-term strategy enough for the expansion of any help a lot to be able to afford expansions that are authorized and at a higher average income could help that includes people outside of tech more new companies. I don’t think housing out here.” allowed and permitted.” support a wider demographic being and making an effort to maintain Palo Alto has the square footage to able to afford living in the area.” housing for teachers, low-income house all the people that they are folks, artists — that type of thing.” hiring.” www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 21 Page 22 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com icardo Hernandez was finishing up his collection rounds over 8,500 tons (approximately 30%) were diverted. as a solid-waste driver for GreenWaste of Palo Alto re- This extra sorting step is just one of the many tactics Palo Alto is R cently when he spotted a black trash bin overflowing employing in its ambitious Zero Waste Plan to divert 90% of its waste with garbage bags. by 2021. It’s a goal that’s well ahead of the state’s target of 75%. “Most of the stuff in these bags is recyclables and food waste,” The plan includes incentives that encourage residents and busi- said Hernandez, shaking his head and tossing the excess trash bags nesses to reduce their weekly garbage loads; proposals to ban certain into the truck. types of single-use plastics and foodware items; and an ordinance that One only needs to take a tour of the Sunnyvale Materials Recovery would regulate construction and demolition debris, which currently and Transfer (SMaRT) Station, where Palo Alto’s trash is delivered makes up 44% of Palo Alto’s total landfill disposal. for sorting before being sent to the landfill, to understand Hernandez’s “I think we realized a long time ago, that landfill space is a limited concern. There are plastic water bottles, cardboard boxes, yogurt con- resource,” said Daniel North, district manager of Morgan Hill’s Kirby tainers, soda cans, orange peels, apple cores and other recyclables and Canyon Recycling and Disposal Facility. “It’s in everyone’s interest compostables mixed in the mound of garbage on the floor. to make sure that as little material goes to the landfill as possible.” Top: Ricardo Hernandez, a solid-waste On average, 70% of what Palo Altans toss into their black gar- But as Palo Alto works to achieve zero waste, there are new envi- driver for GreenWaste of Palo Alto, bage bins is recyclable and compostable, according to the city’s latest ronmental obstacles arising from changes in global recycling stan- tosses excess trash into his truck. Waste Characterization Study. dards that the city must consider since it currently sends about 75% Above: Nearly 33% of what is thrown At the SMaRT Station, these salvageable materials are separated of its recyclables overseas. into the trash and ends up at the from the garbage. It’s an extra step in the city’s recycling process that “We’re struggling here with looking ahead at the ultimate solution Sunnyvale SMaRT station is actually has helped divert tons of waste from landfills. Out of the 27,000 tons and yet trying to do something in the immediate future,” said Phil recyclable materials, such as plastic of waste processed at the SMaRT station from Palo Alto last year, Bobel, Palo Alto’s assistant director of public works. bottles and aluminum cans. very day, after 750 tons Underground are a series of methane wells con- of garbage from Palo nected to a large pipe and blowers that vacuum up the Alto, Mountain View and gas, which is then channeled upward and burned off Sunnyvale is processed by a flare, resulting in carbon dioxide and water and and sorted at the SMaRT inspected annually for air contaminants. station, the remaining re- Though the technology can be seen as a feat in man- fuse is compacted and loaded onto a fleet of 30 - 40 aging waste and maintaining clean emissions, Daniel trucks, which head to the Kirby Canyon Recycling and North of Kirby Canyon sees the process as a wasted Disposal Facility in Morgan Hill, which is operated by opportunity. He said the company’s Altamont landfill, the company Waste Management. in comparison, has an onsite power plant that converts Hidden behind rolling hills of serpentine grasses methane gas into renewable energy and is an example overlooking U.S. Highway 101, bulldozers at the of what could be done at Kirby Canyon. landfill site push the debris onto a flattened mound As cities further reduce waste with increased recy- dubbed “the pancake,” pounding and grinding ev- cling and composting habits, North said landfills will erything from discarded mattresses, filing cabinets, have to convert from mere dumping grounds into sus- laminate floor boards, VHS tapes, estate-planning tainable energy sources. paperwork, and lots and lots of plastic bags. For “The world is changing,” he said. “We’d like to see odor control, the mound is then covered with alter- less material go in the landfill and more of it be di- Bulldozers at the Kirby Canyon Recycling and Disposal Facility native daily cover — often a blend of soil, sludge, re- verted, and that’s why these facilities are adapting over compact trash at the landfill and cover it with alternative daily cover. covered plastics and ground-up construction debris. time to be able to handle that.” www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 23 ust outside the Port while the country adopts more environmen- every year, six new optical sorters are being of Oakland, up to tal protections to end its role as the world’s installed to better handle the enormous vol- 100 trucks carrying dumping ground. ume of mixed-paper products and make them cargo containers “It’s thrown the entire global recycling mar- marketable for the changing international pull up next to the ket into chaos, and we’re talking the whole buyer demand. Ever Reach Logis- developed world,” said Mark Bowers, Sunny- In 2018, GreenWaste stopped sending re- Top left: Workers at the GreenWaste tics processing center, where a team of eight vale Solid Waste Programs division manager, cycled paper products to China altogether. Material Recovery Facility sort mixed inspectors clad in yellow vests and hard hats who oversees the Sunnyvale SMaRT station. Because there are few paper pulping mills paper underneath a series of optical from the China Certification and Inspection In 2017, the United States exported 12.8 operating in the United States, GreenWaste sorters. Above: Bales of aluminum cans at Group await to inspect shipments headed billion pounds of fiber and plastic products now sends paper to Korea, Vietnam, India, the Sunnyvale SMaRT station are crushed overseas to China. to China. In 2018, that number dropped to Thailand, Indonesia, Malaysia and Taiwan. and ready to be sold to domestic buyers. Inside each of these containers are about 8.1 billion. It is expected to keep dropping Even with the China restrictions, waste pa- 30 bales of corrugated cardboard — think as China outlines more restrictions. This has per is still the Port of Oakland’s largest ex- arrive in the United States carrying imports Amazon and moving boxes retrieved from left domestic recycling operations scram- port, making up 18% of all exports last year. and would otherwise be empty on the return recycling facilities. Directed by the Chinese bling to adapt and find new markets for the That equates to 110,400, 20-foot containers trip home. government, the inspectors use a strict card- materials. shipped every year. “As a recycling industry, we’ve just taken board-screening process. They snap photos, Contamination is the problem everyone One reason why so much recycling is advantage of the fact that the shipping con- remove the bales and scrutinize each one up is trying to solve. It’s a dirty word in the shipped overseas is because many containers tainers need to go back,” Hanson said. “That close, sometimes even using X-rays to make recycling industry. In Palo Alto, bales of doesn’t mean that we know sure each bale contains less than 0.5% con- cardboard and mixed paper, which make exactly what happens once it tamination from outside materials, defined as up roughly 70% of the city’s exported recy- leaves our shores.” anything from mixed paper to plastic bags to clables, can become tainted instantly by poor This is a reality many too much moisture. Bales that don’t meet the sorting in the city’s single-stream program, recycling sorting facilities 99.5% clean metric are rejected and sent back which mixes all materials together. Liquids are coming to terms with to recycle buyers. in soda bottles, half-filled jars of peanut but- now that the markets have “Now that they’ve dropped to a half per- ter, oily residue from takeout containers can shifted to mainly South- cent, it’s darn near impossible to meet, but ruin potential fiber shipments. east Asian countries with we’re doing everything that we can to meet In an effort to combat “dirty sorting,” Palo questionable environmental it.,” said Emily Hanson, director of business Alto recently launched its Recycle-Ready practices. development and communications for Green- campaign, imploring residents and businesses “We’re essentially relin- Waste Recovery, Palo Alto’s recycling sorter. to remove food waste and liquids before toss- quishing control of those The strict new standards, which began in ing cans and bottles into bins. materials to those (coun- March 2018, are part of China’s National At the GreenWaste Material Recovery tries) that don’t have the en- Sword policy that has halted international im- Facility in San Jose, which sorts 18,000 vironmental policies that we ports of cardboard, mixed paper and plastics -19,000 tons of Palo Alto’s recyclable goods do and don’t have the same tracking that we do in some cases,” North said. No one understands this better than Palo Alto resi- dent Bob Wenzlau, who helped launch Palo Alto’s curbside recycling program in the 1970s. Most recently, he spoke with city leaders and representatives from GreenWaste who then crafted the city’s new Environmental and Social Impacts of Processing Recycla- ble Materials guidelines. “It’s really urgent that we start waking up to this new reality,” Wenzlau said. “I can almost say that there is no single destination in Southeast Asia that would satisfy either Above: Sorters at the GreenWaste MRF separate nonrecyclable plastics. The bottles are later sold to domestic buyers and processed into plastic flakes for recycling. Bottom left: Mixed plastics are baled at the GreenWaste facility and sold to international buyers in Malaysia, Vietnam, Philippines, India and Taiwan because they don’t have any domestic markets. Page 24 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com Loading cranes stack containers onto a cargo ship at the Port of Oakland. Waste paper makes up the port’s largest export; more than 110,400 containers were shipped overseas in 2018. About the cover Top: Mark Bowers, Sunnyvale Solid Waste Programs division manager who oversees the Sunnyvale SMaRT station, walks past two trommels, which break apart plastic bags and liners to sort solid waste. Middle: Sorters at the GreenWaste Materials Recovery Facility pull bulky items from the flow of recyclables. Bottom: A bulldozer grabs piles of demolition debris at Zanker Recycling. Photos by Veronica Weber. Cover design by Doug Young. our basic environmental or basic social sent 1.3 billion tons of plastic last year,r, proposed ordinances to ban certain kinds of reusable objects in their place. standards, period.” according to the article “Plastic Pollu-- single-use plastics before the City Council “The ultimate solution is waste reduction, es- The guidelines direct the hauling com- tion,” published in Our World In Data. on May 20. If approved, the first phase of the pecially for those single-use items,” said Eric pany to establish a tracking system that Unlike plastic bottles and milk jugs,s, Foodware Packaging Reduction Plan would Cissna, environmental outreach coordinator for informs residents where plastic and paper which are mostly processed within thee ban plastic straws, utensils, drink stirrers and GreenWaste of Palo Alto. “We just need to stop ultimately end up. GreenWaste Recovery United States, plastic wrap, take-out con-- plugs and require alternative compostable or generating them in the first place.” has appointed its director of sustainabil- tainers, plastic drink cups, coffee lids andd ity to take the lead and intends to begin all plastics marked No. 3-7, don’t have preliminary reporting later this year, any domestic markets and are the biggest working in tandem with the waste hauler source of plastic exports. and the San Jose recovery facility. “I view the numbered triangles (used to “Sustainability is in Palo Alto’s blood, identify recyclable plastics) as a gigantic and this where we can make our mark,” marketing gimmick put out by the virgin Wenzlau said. plastics producers to give consumers the There’s a reason for concern: 77% of impression that all plastics are recycla- the world’s mismanaged plastic waste ble,” Bowers said. “They’re not.” (plastic that is at high risk of making its As part of Palo Alto’s zero-waste way into watersheds and oceans due to goals to help curb the volume of plas- poor disposal practices) comes from the tic use, Bobel noted that city staff will same countries to which United States be bringing forward the first of three ichael Gross, Palo Alto has taken notice. Roughly director of sus- 44% of all landfill waste from the city is tainability at composed of construction and demoli- Zanker Recy- tion debris from the numerous develop- cling, beams ment projects across town. The city staff with pride as he intends to bring an ordinance requiring guides a tour of the 168-acre recycling the deconstruction and separation of ma- and composting operation in San Jose. terials at the source before City Council On the site of a former landfill, massive on May 20. The proposal would make machinery grinds lumber, crushes con- mandatory the sorting of salvage from crete, plucks asphalt shingles and sorts residential and commercial demolition scrap metal from demolition debris. projects, which would then be sent to the In the middle of the site, 16 anaerobic Zanker facility. digesters of the ZeroWaste Energy De- “We think those deconstruction-re- velopment Company convert Palo Alto’s lated initiatives are some of the largest and San Jose’s yard and food waste into short-term initiatives in terms of being renewable biogas energy and compost. able to impact diversion and impact Next door, a 240-foot conveyor belt waste,” said Ron Arp, zero waste man- churns and sorts 16 types of construction ager for Palo Alto. “It’s not only waste and demolition debris (C&D) materials diversion, keeping it out of landfills, it’s at 60 tons an hour. a better use.” “I’m just like the best-looking garbage Gross agreed. man you’ve ever seen,” Gross laughs as “The big thing about garbage recy- he talks about the scale of his operation. cling is getting rid of the stuff right and “I’m the only one out here doing this. making sure everything you take in you That C&D curbside line ... nobody in the get rid of,” he said. “You’ve got to find a industry has something that big.” home for it.” Q Top:T An employee at the ZeroWaste Energy Development Company sprays water onto one Last year the C&D operation pro- Staff Photographer and oof the 16 anaerobic digesters, where Palo Alto’s yard waste and food scraps will be placed cessed 185,000 tons of material and di- Videographer Veronica Weber can be ffor 21 days. Above: Michael Gross, director of sustainability for Zanker Recycling, holds verted 80% of it from the landfill. emailed at [email protected]. uup a handful of compost made from Palo Alto’s yard waste and food scraps. www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 25 Page 26 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 27 GUIDE TO 2019 SUMMER CAMPS FOR KIDS • VISIT PALOALTOONLINE.COM/CAMP_CONNECTION ATHLETICS Dance Connection Palo Alto Palo Alto onne Share the joy of dance with us! Our studio is an extended family mp C ction and a “home away from home” for our community of children Ca and teens. At Dance Connection, we value the positive energy and atmosphere that we continuously strive to provide. Summer 650) 326-8210. Dance Camps include all styles of dance for ages 4 and up and To advertise in this weekly directory, call ( features our new “This is Me!” Empowerment Camp along with Teen Jazz and Hip Hop Camps. A Summer Session for ages 3 to ACADEMICS ARTS, CULTURE, OTHER CAMPS adults will be offered from June 3-August 2. www.danceconnectionpaloalto.com/dance- Harker Summer Programs San Jose Castilleja Summer Camp connection-event-calendar/summer-dance-camps The Harker School’s summer programs for children K - grade 12 for Girls Palo Alto Palo Alto (650) 852-0418 or (650) 322-7032 offer the perfect balance of learning and fun! Programs are led by dedicated facult y and staff who are experts at combining summer Casti Camp offers girls entering gr. 2-6 a range of age-appropriate Kim Grant Tennis Palo Alto fun and learning. Strong academics and inspiring enrichment activities including athletics, art, science, computers, writing, Summer Camps Monterey Bay programs are offered in full day, partial and morning only sessions. crafts, cooking, drama and music classes each day along with Fun and specialized Junior Camps for Mini (3-5), Beginner, www.harker.org/summer (408) 553-5737 weekly field trips. Leadership program available for girls entering Intermediate, Advanced, High Performance and Elite tennis gr. 7-9. levels. Weekly programs designed by Kim Grant to improve player i2 Camp at Castilleja School Palo Alto www.castilleja.org/summercamp (650) 470-7833 technique, fitness, agility, mental toughness and all around game. i2 Camp offers week-long immersion programs that engage Weekly camps in Palo Alto and Sleep-Away Camps in Monterey middle school girls in the fields of science, technology, City of Mountain View Bay. SO MUCH FUN! engineering and math (STEM). The fun and intimate hands-on www.KimGrantTennis.com Text: (650) 690-0678 activities of the courses strive to excite and inspire participants Recreation Mountain View about STEM, creating enthusiasm that will hopefully spill over to Come have a blast with us this summer! We have something for Call: (650) 752-8061 their schoolwork and school choices in future years. everyone – Recreation Camps, Specialty Camps, Sports Camps, Nike Tennis Camps Bay Area www.castilleja.org/i2camp (650) 470-7833 Swim Lessons, and more! Programs begin June 4 – register early! Junior overnight and day tennis camps for boys and girls, ages www.mountainview.gov/register (650) 903-6331 9-18 offered throughout June, July and August. Adult weekend iD Tech Stanford/Bay Area clinics available June and August. Camps directed by head The world’s #1 summer STEM program held at Stanford, Palo Alto City of Palo Alto Summer Camps Palo Alto men’s coach, Paul Goldstein, head women’s coach, Lele Forood, High School, and 150+ locations nationwide. With innovative A wide array of camps, from theater and tennis to ceramics and and associate men’s and women’s coaches, Brandon Coupe and courses in coding, game development, robotics, and design, our coding. Kids in kindergarten through high school can participate Frankie Brennan. Join the fun and get better at tennis this summer. programs instill in-demand skills that embolden students to shape in camps during week-long sessions from June 3 to Aug 9. www.ussportscamps.com (800) NIKE-CAMP the future. iD Tech Camps (weeklong, 7-17), Alexa Café (weeklong, (800) 645-3226 all-girls, 10-15), iD Tech Academies (2-week, 13-18). www.cityofpaloalto.org/summercamps idtech.com/locations/california-summer-camps/ (650) 463-4949 Run for Fun Camps Bay Area stanford-university (844) 788-1858 Run for Fun’s mission is to provide creative and engaging play for Community School of Music Mountain View all youth by getting kids active in an inclusive community centered STANFORD EXPLORE: A Lecture Series on Community School of Mountain View Music and Arts (CSMA) around outdoor fun! We pride ourselves on hiring an enthusiastic, Biomedical Research Stanford Mountain View 50+ creative camps for Gr. K-8! Drawing, Painting, highly trained staff who love what they do. Summer 2019 features EXPLORE biomedical science at Stanford. Stanford EXPLORE Ceramics, Sculpture, Musical Theater, Summer Music Workshops, four weeks of Adventure Day Camp and two weeks of Overnight offers high school students the unique opportunity to learn from more! One and two-week sessions; full and half-day enrollment. Camp High Five. Adventure Day Camp is a new discovery every Stanford professors and graduate students about diverse topics Extended care from 8:30am-5:30pm. Financial aid offered. day filled with sports, crafts and nature, including explorations to in biomedical science, including bioengineering, neurobiology, Camp Jones Gulch, Capitola Beach, Foothills Park, Shoreline Lake immunology and many others. www.arts4all.org (650) 917-6800 ext. 0 and Great America. Camp High Five is six days and five nights explore.stanford.edu [email protected] Oshman Family JCC Camps Palo Alto of traditional overnight camp mixed with challenge-by-choice activities, campfires, friendships and lots of laughter. Summer at Sand Hill School Palo Alto Camps at the OFJCC introduce your child to new experiences while www.runforfuncamps.com/summer-camps-and- June 26 to July 23. If you’re looking for a great summer learning plus creating friendships in a fun and safe environment. We work to school-holiday-camps/camp-overview build confidence, stretch imaginations and teach new skills. fun option for your child and you want them to be ready for fall, (650) 823-5167 please join us at Sand Hill. The morning Literacy Program (8:30 to www.paloaltojcc.org/Camps (650) 223-8622 noon) provides structured, systematic instruction for students with Stanford Athletics & Youth Stanford learning challenges entering grades 1-8 in the fall. The afternoon Palo Alto Community Stanford Youth Programs brings you Camp Cardinal! Week-long Enrichment Camp (Noon to 4) focuses on performing arts, social Child Care (PACCC) Palo Alto day camp programs on campus for kids (grades K – 10) from June skills and fun. Choose morning, afternoon or full day. PACCC summer camps offer campers, grades 1st to 6th, a wide 3 – August 9. Space is limited so register online now. www.sandhillschool.org/summer (650) 688-3605 variety of engaging opportunities. We are excited to announce all campcardinal.org (650) 736-5436 Summer@Stratford Palo Alto/Bay Area of your returning favorites: Leaders in Training (L.I.T.), PACCC Special Stanford Baseball Camps Stanford Interest Units (S.I.U.), F.A.M.E. (Fine Arts, Music and Entertainment), Stratford infuses its STEAM (Science, Technology, Engineering, At Sunken Diamond on the campus of Stanford University. A J.V. Sports and Operation: Chef! Periodic field trips, special visitors Arts, and Math) curriculum into an innovative and enriching variety of camps are offered to benefit a wide range of age groups summer camp experience. Younger campers learn, explore, and and many engaging camp activities, songs and skits round out the and skill sets. Campers will gain instruction in several baseball engage in hands-on learning projects, while Elementary-age variety of offerings at PACCC Summer Camps. Open to campers skills, fundamentals, team concepts, and game play. students collaborate to tackle real-world problems by utilizing from all communities. Register online. www.stanfordbaseballcamp.com (650) 725-2054 academic principles and concepts in a fun and engaging way. www.paccc.org (650) 493-2361 At the Middle School level, individual subject-based enrichment Stanford Water Polo Camps Stanford classes are offered and tailored for each grade level. Stanford Jazz Workshop Stanford New to water polo or have experience, we have a camp for you. World-renowned jazz camps at Stanford. Week-long jazz Half day or full day options for boys and girls ages 7 and up. All stratfordschools.com/summer (650) 493-1141 camps provide fundamental skills, scrimmages and games. immersion programs for middle school musicians (July 8-12), high Write Now! Palo Alto school (July 14-19 and and July 21-26), and adults (July 28-Aug. 2). www.stanfordwaterpolocamps.com (650) 725-9016 Summer Writing Camps Pleasanton All instruments and vocals. No jazz experience necessary! Wheel Kids Addison Elementary, Improve your student’s writing skills this summer at Emerson www.stanfordjazz.org (650) 736-0324 Bike Camps Palo Alto School of Palo Alto and Hacienda School of Pleasanton. Courses Adventure Riding Camp for rising 1st - 8th gr, Two Wheelers Club this year are Expository Writing, Creative Writing and Presentation TheatreWorks Palo Alto for rising K - 3rd gr. Week-long programs from 8:30 - 4, starting Skills. Visit our website for more information. Silicon Valley Menlo Park June 3rd. Join us as we embark on bicycling adventures for the www.headsup.org Emerson: (650) 424-1267 April 1 - 5, June 3 - August 2. Kids have fun, create a character, and more experienced rider or help those just learning to ride. Hacienda: (925) 485-5750 learn lifelong performance skills at TheatreWorks Silicon Valley’s www.wheelkids.com/palo-alto (650) 646-5435 Theatre Camps. TheatreWorks offers camps during spring break YMCA of Silicon Valley ARTS, CULTURE, OTHER CAMPS (offered in Palo and Menlo Park, April 1 - 5) and summer camps Summer Camps Silicon Valley (six sessions offered in Palo Alto, Menlo Park, and Los Altos Art and Soul Camp Palo Alto At the Y, children and teens of all abilities acquire new skills, make between June 3 - August 2) for children and youth in grades K-6. Art, cooking, tinkering, yoga and mindfulness. We celebrate friends, and feel that they belong. With hundreds of Summer multiple perspectives and recognize the many ways for our Professional teaching artists lead students in activities including Day Camps plus Overnight Camps, you will find a camp that’s children to interpret their world. Summer Unplugged! is acting, dance, play writing, and stagecraft skills. Sibling discounts right for your family. Sign up today, camps are filling up! Financial appropriate for ages 6-11 years. Located at Walter Hays School. and extended care available. assistance is available. www.artandsoulpa.com (650) 269-0423 www.theatreworks.org/education (650) 463-7146 www.ymcasv.org/summercamp (408) 351-6473 Page 28 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com ArtsA weekly guide to music, & theater, art,Entertainment culture, books and more, edited by Karla Kane Scottish-American performer brings cabaret show to the JCC by Kaila Prins hether from his work in the theater to you, you hear it on the radio, it follows you. or on the large or small screens, W you know Alan Cumming — but KP: Unlike a musical with a clear sto- do you really know him? On April 14, the ryline, this is a cabaret-style show. As you Scottish-born star is bringing his critically- were writing the show, was there a story acclaimed one-person cabaret show, “Alan you wanted to tell? Cumming Sings Sappy Songs,” to the Osh- AC: The throughline is authenticity. Ev- man Family JCC in Palo Alto. erything I say on stage is true. Some of those “Sappy Songs” first premiered in 2015 things are really intense and some of those in New York City, and Cumming has since things are really funny. I ask the audience, toured it across the U.S., Canada, Australia “What is real and what is not?” At one point, and the United Kingdom, as well as recorded I pull the rug out from under the audience a live album. The show has been in hiberna- with a really vulnerable but totally made tion while he works on his new show, “Legal up story. Even though you can be duped by Immigrant,” which premiered in 2018, but the truth, everything I say on stage is true he’s waking it up for a special performance in — even the things that weren’t true. What Palo Alto just as winter gives way to spring. I mean by that is, it’s important to represent Toledano Phillip As “an honorary Jew after playing Eli who you are as a person. In my new show, I Alan Cumming will visit the Oshman Family JCC in Palo Alto with his cabaret show: Gold for seven seasons on ‘The Good Wife,’” talk about aging, because that’s something “Alan Cumming Sings Sappy Songs.” he said he’s excited to head to the JCC “with that’s true and present for me right now. a Jewish blessing!” funny, it also asks us to confront some particularly close to your heart or top The Weekly spoke with him as he rode a KP: Do you feel that there is a huge dif- weightier themes. How do you balance of mind right now? train from New York City to Boston to learn ference between a show where you are those themes with the humor? AC: It’s been freezing in New York City. more about the intimate show, from its cre- yourself versus a show in which you play AC: You just have to think about how you When it gets really cold, all of the homeless ation to what audience members can expect a part onstage? tell stories in real life. If you’re someone who shelters are jam-packed. The Ali Forney to experience. AC: I’ve done a lot of shows like this over talks a lot and tells stories, you know how to Center for LGBTQ youth has been helping the years and I’ve learned that the more au- slip in something real and vulnerable. Humor homeless youth whose parents have aban- KP: Why is this show called “Sappy thentic and vulnerable you’re able to be, you makes it more powerful. It’s a lot of trial and doned them because they told them they Songs?” can really connect with an audience when error, and when you tell a story many times, were gay or trans. It struck me the other day AC: I wanted to signal to the audience that you’re being yourself. It’s the same when you hone it and get better at telling the story. — how on earth do you survive? I was going to be emotional and go for it. The you’re an actor: The more of yourself that I’m Scottish, and I have a very dark sense show is authentic and vulnerable but the title comes through the role you’re playing, there’s of humor. It’s important to understand that, KP: And because I have many Who- is tongue-in-cheek. It is a funny show. less and less of a veil between you and the au- even for the most awful things in life, there’s vians in my life who would kill me if I dience. That doesn’t mean you have to “play still some humor to be found. You know didn’t ask: Can you talk a little bit about KP: Did you have any songs that were yourself.” But good acting is being prepared — laughing at funerals. ... There’s lots of your recent turn as King James I on too sappy to make the cut? to be vulnerable. laughs in “Hamlet” if you know where to “Doctor Who?” AC: (Chuckles) Some songs got axed but I find them. That’s how you survive. There’s AC: It was actually kind of awful! It wouldn’t have chosen them if they were too KP: How does the show change when a saying in Scotland: “You have to laugh or was wet and cold, and we were stranded sappy. The songs I sing are songs that I feel you move from an intimate venue like you greet (cry).” in Cardiff in the middle of a snowstorm. I can bring something to. People may have the (New York’s) Cafe Carlyle to another But I did it because, as a little boy grow- heard them already, but they may have been venue for a one-night performance? How KP: You’ve worked in pretty much ev- ing up in Scotland, I would watch “Doctor overproduced or didn’t hear what the song is do you engage the audience in unfamiliar ery performing medium there is. How do Who.” It just seemed like a fun thing to do, actually about. The songs I like to sing are spaces where you’re not “the home team?” you prepare yourself to switch back and although I knew it was going to be awful songs that have something to say. AC: (Chuckles) The number of people and forth? Do you have a medium you prefer when every scene in the script started with the size of the venue don’t equate with inti- to perform in? “EXT. Night” or “EXT. Day” in February KP: I’m sure that many people might macy. You could be in a stadium and still be AC: I like to mix and match, and the fact in Wales. I really like the idea that they’ve expect you to focus on musical theater, intimate and authentic. Mostly on tour, I play that I’m so eclectic means that when I go made Doctor Who a woman, and I got to but with the exception of some Sondheim, big concert halls. In New York, I mostly play back on tour, I come to the concerts more parody Scottish politicians I dislike with my musical theater makes up the minority of Joe’s Pub or Cafe Carlyle, although I have excited, more energized and looking forward accent. Q your set list. How did you go about choos- done bigger venues. I’m in a frame of mind to doing them. Because you’ve had a change, Freelance writer Kaila Prins can be ing songs? right now where I want to reach more people. something different. And then you go and do emailed at [email protected]. AC: I actually sing more songs from mu- I have a message and something I want to say, some filming. You come back more fresh- sicals than I expected to. I have done a lot of and I want to reach as many people as I can. faced each time you change genre. I find that theater but I’ve only been in two musicals: You can make people feel as intimate and when I do a lot of things at once, I actually What: “Alan Cumming Sings Sappy Songs.” “Cabaret” and “Threepenny Opera.” I have connected and like you’re looking into their become more focused. It’s something I’ve Where: Schultz Cultural Arts Hall, Oshman a niche: It’s dark and German. When I’m eyes in a concert hall as you can in a small mastered, staying completely in the moment. Family JCC, 3921 Fabian Way, Palo Alto. choosing songs, certain songs reach out to room. It’s just about how much ... you are When: Sunday, April 14, 7:30 p.m. me. Songs are funny things. The first time willing to show yourself. KP: I know that you’re very involved Cost: $150. you hear a song, you may think, “Oh, I don’t in charitable work in your “free” Info: paloaltojcc.org/Events/alan-cumming- like that song,” but then it keeps coming back KP: Even though this cabaret is very time. Are there any charities that are sings-sappy-songs-1. www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 29 Arts & Entertainment PRESENTS 34th ANNUAL SPRING TOUR ENTER THE GARDEN Friday, April 26 Saturday, April 27 10 A.M. - 4 P.M. View Five Private Palo Alto Gardens, Silent Auction, Shop the Marketplace, Over the Garden Fence & Plant Sale Christopher Ash Christopher In “Hershey Felder: A Paris Love Story,” a world premiere presented by TheatreWorks Silicon Valley, Felder shares a personal connection to the work of Claude Debussy. A pianist’s guide to Paris connection to Debussy, as well Hershey Felder’s latest celebrates the music of as to the city he loved, lends a Debussy and the City of Light touching and special quality to the show. There’s a surprising by Karla Kane bit where he gracefully moves s its title suggests, pia- — dances really — with a scarf, nist/actor/writer Hershey THEATER REVIEW adding to the general lyrical For tickets & Info: www.gamblegarden.org Felder’s latest one-man tone. 1431 Waverley Street, Palo Alto, CA 94301 (650) 329-1356 A show, “A Paris Love Story,” tells orchestra he encountered. We As a character and a life story, the story of a man’s relationship hear his mystical, nature-in- however, Debussy himself comes with the beloved French city. spired compositions including across as less interesting than Men’s relationship, actually, the famous “Clair de Lune” some of Felder’s other subjects. because in this case, the story (moonlight) and “La Mer” (the A bit dull, in fact, as he mostly Sowing the Seeds involves both composer Claude sea). And we hear, too, about his complains about other compos- Debussy and Felder himself. many ill-fated romances, includ- ers, compliments his own work “A Paris Love Story,” which is ing not one but two jilted flames or chronicles his various ro- for Community Engagement making its world premiere with who shoot themselves; his be- mantic exploits. He does have a TheatreWorks Silicon Valley, is loved only child “Chou-Chou;” cheeky French charm about him, warmly invites you to join us the latest in a string of big suc- and his excruciating, illness- though, when wryly watching cesses for Felder in Mountain plagued final years set against over young Felder and following for our annual View in which he inhabits — the horrors of the first world war. him throughout the city. And Spring fundraising event accent, facial hair and all — the We also wander with young while his music isn’t as familiar role of a great composer. Previ- Felder and ghostly Debussy past or immediately gripping as that ous stints have included Irving such landmarks as the Cathedral of some of the others in Felder’s featuring Keynote Speaker Berlin, Beethoven and Tchai- de Notre Dame and the Arc de stable, when the projections are kovsky. This show is a bit dif- Triomphe and into Debussy’s flowing and Felder is at the pia- Kent Koth ferent, however, in that Felder former flat. Felder’s acting and no, the effect is spellbinding. Executive Director, Seattle University Youth Initiative shares a very personal and spe- musicianship have been widely “A Paris Love Story” might and Center for Community Engagement cial connection to the work of — and deservedly — praised, not be the first Hershey Felder Debussy, who, we learn, was but let’s take a minute here to show I’d recommend to someone and former YCS Executive Director the favorite composer of his late laud the scenic and projection who’d never seen him before but mother. design by Felder and Christopher it will please his loyal fans and Thursday, April 18, 2019 In “A Paris Love Story,” Felder Ash. A Parisian bridge, lit by gas prove an enchanting introduc- switches between speaking as lamps, showcases the grand pia- tion to newcomers. There are 5:30 - 7:30pm himself and as Debussy, who no placed in the center. Above certainly worse ways to spend an also posthumously watches over are charming, animated chalk early spring evening than letting Check-in, Wine, Social & Savories at 5:30pm young Felder on his first trip to sketches of Paris coming to life a master like Felder take you on Program at 6:15pm followed by Social & Sweets Paris as a 19-year-old. Together and appearing to float as if by a dreamy trip through the Paris they offer information about De- magic, along with fish, soaring moonlight. Q bussy’s life and career as well as birds, snowfall and more. It’s a Arts & Entertainment Editor Lucie Stern Community Center take a journey throughout the gorgeous visual complement to Karla Kane can be emailed at ͙͛͘͝Ƥǡ historic boulevards and notewor- the dreamlike music and practi- [email protected]. thy landmarks of Paris. And, of cally makes the city a character Visit www.youthcommunityservice.org course, there is plenty of music, in its own right. What: “Hershey Felder: A Paris to learn more and RSVP both in the form of recorded or- The production is just one act, Love Story, Featuring the music chestrations and Felder’s always- no intermission, led by Felder’s of Claude Debussy.” Individual tickets $35 • Contributions will be invited impressive live playing. longtime director Trevor Hay. Where: Mountain View Center We learn that Debussy, who Because his shows allow him for the Performing Arts, lived from 1862-1918, was des- to address the audience directly 500 Castro St., Mountain View. perate to break free from the old- (and because he is very good at When: Through May 5 fashioned German-style trends it), Felder easily creates a warm (performance times vary). in music and always searching rapport with the crowd. He’s re- Cost: $40-$120. for the “new” in his own Impres- sponsive to the audience’s reac- Info: Theatreworks.org or sionist work, loathing Wagner tions, including in moments of 650-463-1960. 705 Alester, Room 4, Palo Alto, CA 94303 • 650.858.8019 and loving the Javanese gamelan humor. His inclusion of his own Page 30 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com Eating Out Asian Box chef Gracie Jones pivots to celiac-friendly bakery Story by Anna Medina | Photos by Veronica Weber fter ogling the goodies on because of the damage it causes to keep it gluten-free, especially display at Gracie Jones’ to the small intestine. since the change was straightfor- Gluten Free Bake Shop, It was such a kid who inadver- ward. They eliminated just two you might notice some charm- tently brought celiac disease to ingredients from the menu, soy ing drawings with “Thank you, chef Gracie Jones’ attention, just sauce and noodles. Asian Box’s Gracie” in unmistakable crayon under a decade ago when she was menu is still completely gluten- kid-scrawl decorating the front transitioning from working as a free, though it is not explicitly register area. Sure, it’s a widely- fine-dining chef to opening up advertized. known fact that kids love baked the fast-casual Asian Box. Jones, who has devoted her life Asian Box chef Gracie Jones opened her own gluten-free bakery in treats, but how many bakers re- “When we started with the proj- to “cooking nonstop” for 20 years, Palo Alto in 2017. ceive personal thank-you notes ect of Asian Box ... [Asian Box] did not intentionally set out to from them? became gluten-free because of a open up a gluten-free bake shop. Maybe it’s the ones who make family we met. That same year, When she moved into the space treats for kids who otherwise they found out that their son, who at 2706 Middlefield Road in Palo wouldn’t be able to enjoy the was 4 at the time, had celiac,” Alto, she was in charge of open- average chocolate chip cook- Jones said. While cooking at this ing up a commissary to produce ie — kids with celiac disease, family’s home as part of the pro- sauces for Asian Box. (The space an immune disease that pre- cess of developing the Asian Box sparked some controversy in 2017, vents people from eating gluten menu, Jones and the team decided when the city’s code enforcement officers received a complaint about it doubling as office space for Asian Box. Two partial cubi- cles with computers remain at the bakery today.) Confused about the nature of the space when it opened, cus- tomers would come in, looking to eat at Asian Box, so Jones started to offer some dishes and used the space as a test kitchen. Gluten-free cookies, vegan chocolate-banana-almond streusel muffins, donuts, cinnamon-apple galettes and strawberry-jam (continued on page 32) donuts at Gracie Jones Gluten Free Bake Shop. A steak, egg and kimchi banh mi served on a gluten-free baguette. Customers eat gluten free-goods at Gracie Jones Bake Shop on April 9, 2019. www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 31 Eating Out Bakery (continued from page 31) Over time, she noticed people asking about desserts, and Jones, who has a passion for baking but had not had the chance to pursue it, began experimenting. “I was keeping an eye on Asian Box, but on my free time, I would Join Us For Easter just bake certain little things to Easter Sunday, April 21 see what people thought,” she 6:30 am in the Memorial Garden said, adding that she enjoyed the 8:30 am* & 10:30 am* in Church with Festival Choir challenge of gluten-free baking. Sunday Worship | 8:30 and 10:45 am *Indicates child care available “My goal is, I want to make Sunday School | 9:30 am for ALL AGES! sure that people can’t tell the (limited summer schedule) 330 Ravenswood Ave., Menlo Park (650) 326-2083 difference,” Jones said. “I won’t www.trinitymenlopark.org serve it until it tastes exactly the Life Together Wednesdays | Something for everyone! way I want it.” 4:30 pm Confirmation (afternoon option) Because Jones is not person- 5:30 pm Youth Choir (grades 4+) ally gluten-free, she knows what Holy Week Services: 6:15 pm Life Together Dinner an item with gluten should taste Palm Sunday, April 14 like, so she starts from there. $5/person; $20/family 10:45 AM — Service in the 7:00 pm Confirmation (evening option) Sanctuary Jones refers to recipes with gluten and then, through trial and error, High School Youth Group Maundy Thursday, April 18 goes through many iterations of a Adult Choir 6:00 PM — Communion Worship single item before she is satisfied Taizé Evening Prayer | Second Sundays at 7:00 pm Good Friday, April 19 with the gluten-free result. And 7:00 PM — Worship and because gluten-free recipes call Reflection with Chancel for many different ingredients to Choir create the flour equivalent, she has Easter Sunday, created her own pre-mixed gluten- April 21: free flour made from brown and 8:30-10:30 AM white rice flour, sorghum and po- Easter Breakfast in tato and tapioca starch. Kohlstedt Hall Jones’ assortment of baked 10:45 AM goods is subject to change de- Service in the Sanctuary pending on her latest experiment, 625 Hamilton Ave. Children’s Easter Egg Hunt but she does regularly stock cus- Palo Alto and Party following tomer favorites like chocolate FirstPaloAlto.com worship! chip cookies, sprinkle donuts and Join us for Easter! paleo bagels. The oatmeal cookie, with new pastor, Rev. Bruce Reyes-Chow sampled by this reporter, achieved the perfect combination of chewi- ness and crispiness. If she’s work- Community Breakfast ~ 9:00 Fellowship Hall CELEBRATING LIFE ing on a special request, custom- Worship with Jazz & Brass ~ 10:30 Sanctuary ers might see a new item in the April 14 - 10:30 a.m. display case, such as lemon bars, Children’s Easter Egg Hunt ~ 11:45 Courtyard pies or brownies. In addition to Palm Sunday - Faure’s Requiem baked goods, she offers savory lunch items, including a banh mi www.fprespa.org • 1140 Cowper St. • 650-329-5659 Organ and Harp Accompaniment sandwich — a recipe she has been working on for years. April 19 - 7: 30 p.m. “I finally feel like I came up with a sandwich of bread that is HOLY WEEK & EASTER Good Friday Tenebrae comparable to a banh mi,” she L SAINT said of the Vietnamese sandwich L S April 14 - Palm Sunday A ’ Music and Readings traditionally made with a French- 8am Holy Eucharist CHURCH style baguette. “It wasn’t easy. I 10am 5EPQ5VSGIWWMSR *YGLEVMWX April 20 - 10:00 a.m. was testing it for a long time.” PA You can also find Jones’ sour- L LTO April 18 - Maundy Thursday O A Easter Egg Hunt dough and brioche bread locally at The Market at Edgewood, or 530pm 1MKLXYTTIV Toddlers to Fifth Grade pm her focaccia at Palo Alto Italian 7 Eucharist with footwashing restaurant Vino Enoteca. She April 21 - 6:30 a.m. also provides gluten-free pizza April 19 - Good Friday flour to Pizzeria Delfina’s five 12noon (SQQIQSVEXMSRSJXLI5EWWMSR 6:30 a.m. Sunrise Service locations, including in Palo Alto. :IRIVEXMSRSJXLI(VSWW 10:30 a.m. Easter Celebration (You can also buy the dry dough 6pm SPIQR*ZIRWSRKSJ mix at the bakery to make your XLI'YVMEPSJ(LVMWX own gluten-free pizza at home.) Covenant Presbyterian Church Her cookies and rice pudding are 670 East Meadow, Palo Alto April 20 - Holy Saturday sold at Asian Box. pm www.covenantpresbyterian.net Jones was clear on one thing: 8 ,VIEX:MKMPSJ*EWXIV She’s not baking for the gluten- [MXL7IGITXMSR free skeptics. “I would suggest for them not April 21 - Easter Sunday to try it; they’re going to try it, am 10 +IWXMZEP*YGLEVMWX Inspirations is a resource for ongoing but then they’re always going to 2YWMG8LI;LSPI3S]WI'VEWW be negative about something,” she JSPPS[IHF] religious services and special events. To said. *KK-YRX *EWXIV'VYRGL Instead, she’s focused on mak- inquire about or to reserve space, please email ing delicious food, in its own ALL SAINTS’ EPISCOPAL CHURCH right. Q ;ȷȒȇȀȜȇȚȋȀȇȇȋ5ȷȜȨ&ȜȋȨ [email protected]. Freelance writer Anna Medina www.asaints.org can be emailed at rosales@ alumni.stanford.edu. Page 32 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com and the actors’ thorough commit- ment to the specificity of early 19th-century discourse gives the history a dimensionality that be- lies the lack of conventional char- acter depth. Through their public words and actions, we learn all we need to know of men like Henry Hunt Studios Amazon of Courtesy (Rory Kinnear) — the celebrity radical known in his day as “the Orator” — and Samuel Bamford MoviesOPENINGS (Neil Bell), the local activist who bristles at Hunt’s superior man- ner. Leigh also poignantly — and Civil rights and wrongs ironically — frames the film with “Peterloo” portrays the 1819 Peterloo Massacre, where a peaceful the experience of a young Man- rally turned into one of the bloodiest episodes in British history. ‘Peterloo’ resurrects a historical tragedy cunian veteran (David Moorst) from the Battle of Waterloo who the opposing groups add texture Leigh again proves an extraor- 0001/2 (Aquarius) to draconian “justice” for petty continues to wear his red uniform to the otherwise dryly recounted dinarily adept purveyor of period crimes, the underclass in Man- through to his hometown’s battle economic realities, rabble-rousing drama despite having made his Seven-time Oscar nominee chester, England, begins to agi- — dubbed Peterloo for its town- and dissent-squelching speeches career as a chronicler of contem- Mike Leigh (“Topsy-Turvy”) tate. Leigh’s screenplay takes us square setting of St. Peter’s Field. and political skullduggery. Leigh porary England. If “Peterloo” is makes no concession to the pas- back and forth from government There, in the film’s stomach- wisely allows for the dissent with- somewhat medicinal, with no sive viewer with his new histori- officials (in offices, in Parlia- turning climax, British cavalry- in both camps as to courses of spoonfuls of sugar in sight, it also cal film “Peterloo.” Instead, he ment, in the proverbial smoke- men set upon an unarmed crowd action and distinctions within the is richly realized, a remarkable bustles his audience into a time filled rooms) and a citizenry (in of 60,000, bloodying and, in some beliefs that motivate them. Under- achievement of dramatized his- machine and transplants them to their cramped dwellings, street cases, killing men, women and pinning it all, Leigh’s team of art- tory with the understanding that a time and place — 1819 Eng- stalls and taverns) that chooses to children. The massacre, which ists collectively puts many period the more things change, the more land — for full immersion into organize in the face of powerful occurred during a peaceful pro- films to shame with their unshowy they stay the same. the physical and social landscape opposition. democracy rally, turned into one but astonishingly detailed work, Rated PG-13 for a sequence of where the politically charged Pe- With his appropriately decen- of the bloodiest and most notori- including the beautiful photogra- violence and chaos. Two hours, terloo Massacre played out be- tralized narrative, Leigh gives ous episodes in British history. phy of Dick Pope and the just-so 34 minutes. tween a pro-democracy working us the lay of the land, rigorously The personality clashes within costumes of Jacqueline Durran. — Peter Canavese class and an elitist government. guiding his actors through a com- The film’s early passages es- bination of well-researched ora- tablish a hardscrabble existence torical and written rhetoric of the Answers to this week’s puzzles, which can be found on page 51. for those who aren’t landowners day and the director’s practiced and lack the power of the polls use of improvisation. The results to protect their own interests. can feel like a living textbook, Lacking suffrage, languishing heavily stentorian and at times under policies like a bread tax long-winded and repetitive, but (a.k.a. the Corn Laws) and subject this is the stuff of political debate, MOVIES NOW SHOWING After (PG-13) Century 20: Fri. - Sun. Amazing Grace (G) Palo Alto Square: Fri. - Sun. Apollo 11 (Not Rated) Century 16: Fri. - Sun. The Best of Enemies (PG-13) Century 16: Fri. - Sun. Century 20: Fri. - Sun. Captain Marvel (PG-13) +++ Century 16: Fri. - Sun. Century 20: Fri. - Sun. Diane (Not Rated) Guild Theatre: Fri. - Sun. Dumbo (PG-13) ++1/2 Century 16: Fri. - Sun. Century 20: Fri. - Sun. Five Feet Apart (PG-13) Century 20: Fri. - Sun. Gloria Bell (R) Aquarius Theatre: Fri. - Sun. Hellboy (R) Century 16: Fri. - Sun. Century 20: Fri. - Sun. Hotel Mumbai (R) Aquarius Theatre: Fri. - Sun. Century 20: Fri. - Sun. How To Train Your Dragon: The Hidden World (PG) +++ Century 16: Fri. - Sun. Century 20: Fri. - Sun. Little (PG-13) Century 16: Fri. - Sun. Century 20: Fri. - Sun. Mia and the White Lion (PG) Century 20: Fri. - Sun. Missing Link (PG) Century 16: Fri. - Sun. Century 20: Fri. - Sun. The Mustang (R) Century 20: Fri. - Sun. Palo Alto Square: Fri. - Sun. Pet Sematary (R) Century 16: Fri. - Sun. Century 20: Fri. - Sun. Peterloo (PG-13) Aquarius Theatre: Fri. - Sun. Psycho (1960) (Not Rated) Stanford Theatre: Fri. - Sun. Shazam! (PG-13) +++ Century 16: Fri. - Sun. Century 20: Fri. - Sun. The Trouble with Harry (1955) (PG) Stanford Theatre: Fri. - Sun. Us (R) +++1/2 Century 16: Fri. - Sun. Century 20: Fri. - Sun. Wonder Park (PG) Century 20: Fri. - Sun. Aquarius: 430 Emerson St., Palo Alto (For recorded listings: 327-3241) tinyurl.com/Aquariuspa Century Cinema 16: 1500 N. Shoreline Blvd., Mountain View tinyurl.com/Century16 Century 20 Downtown: 825 Middlefield Road, Redwood City tinyurl.com/Century20 CineArts at Palo Alto Square: 3000 El Camino Real, Palo Alto (For information: 493-0128) tinyurl.com/Pasquare Guild: 949 El Camino Real, Menlo Park (For recorded listings: 566-8367) tinyurl.com/Guildmp ShowPlace Icon: 2575 California St. #601, Mountain View tinyurl.com/iconMountainView Stanford Theatre: 221 University Ave., Palo Alto (For recorded listings: 324-3700) Stanfordtheatre.org Find trailers, star ratings and reviews on the web at PaloAltoOnline.com/movies + Skip it ++ Some redeeming qualities +++ A good bet ++++ Outstanding www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 33 Stanford Historical Society and Stanford Continuing Studies present 150TH GOLD SPIKE CELEBRATION: Transcontinental Railroad Film Series “PHENOMENAL!” BroadwayWorld The events surrounding the building and completion of the Transcontinental Railroad are woven into the history and lore of the American West. Join us for a series of films, each introduced by historians, film scholars, and researchers, that attempt to HERSHEY FELDER put these historical events in perspective. A discussion will follow each screening. April 15: The Iron Horse (1924) A Paris Love Story April 22: Union Pacific (1939) April 29: Iron Road (2009) FEATURING THE MUSIC OF May 6: American Experience: Transcontinental Railroad (2003) May 13: Once Upon a Time in the West (1968) CLAUDE DEBUSSY May 20: The Railroad segment of How the West Was Won (1962); Hell on Wheels (2013); and This Is America, Charlie Brown: The Building of the Transcontinental Railroad (1996) Mondays, April 15 – May 20 • 7:00 pm TheatreWorks Various locations • Stanford University SILICON VALLEY Free and open to the public Now thru May 5 TICKETS GOING FAST! To register, please visit: Mountain View Center for the Performing Arts continuingstudies.stanford.edu/GSFilms theatreworks.org 650.463.1960 Stanford Continuing Studies presents Groomed: A Documentary Film Felipe’s Pre-Screening and Discussion Markets European & Mediterranean Specialties/ Local Dairy & Imported Cheese/ Organic & Conventional Produce PRODUCE SPECIALS Prices valid April 12-18, 2019 Groomed is the intimate story of filmmaker Gwen van de Pas as she returns to her hometown in search of answers about the man who sexually abused her as a child and finally seeks justice after decades of silence. The film addresses a common type of psychological manipulation called Fuji Bananas Roma California “grooming”: how it holds survivors back from reporting abuse, how to recognize it, and Apples Tomatoes Almonds —ultimately—how to stop it. What begins as an exploration into grooming becomes a dramatic 49 journey where Gwen encounters unexpected revelations in her case and boldly confronts the evil 99 cents/lb. 99 $4.99 that has been a major part of her life. cents/lb. cents/lb. per lb. The film screening will be followed by a discussion with director Gwen van de Pas as well as Visit us at any of our three locations! filmmaker and Stanford Graduate School of Business lecturer Bill Guttentag. The discussion will Cupertino Market Felipe’s Market Foothill Produce be moderated by Stanford Graduate School of Business lecturer and former assistant managing 19725 Stevens Creek Blvd 1101 W. El Camino Real 2310 Homestead Rd Suite D Cupertino, Ca 95014 Sunnyvale, Ca 94087 Los Altos, Ca 94024 editor of The New York Times Glenn Kramon. (408) 777-9111 (408) 720-8111 (408) 735-7775 CupertinoMarket.com FelipesMarket.com FoothillProduce.net Thursday, April 18 • 7:00 pm We have Kosher for Passover Items! CEMEX Auditorium, GSB Knight Management Center 10% off 10% off 10% entire 10% entire Stanford University • Free and open to the public produce Kosher for purchase! Passover OFF OFF purchase! More information: Valid April 12-18, 2019 COUPON COUPON Valid April 12-18, 2019 continuingstudies.stanford.edu/events Page 34 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com OPEN HOME GUIDE 48 Also online at PaloAltoOnline.com HomeA weekly guide to home, garden & and realReal estate news Estate Home Front RHODODENDRONS SALE ... The De Anza Chapter of the American Rhododendron Society is holding a plant sale from 9 a.m. to 1 p.m., Saturday, April 27, in front of the Masonic Lodge at 146 Main St., Los Altos. Organizers said they plan to have vireya series rhododendrons from Pacific Island Nursery at the event, pending their availability. Vireyas make superb container plants, which are perfect for a small and patio gardens. Coming from the tropics, vireyas can bloom several times a year. AFFORDABLE HOUSING BREAKS GROUND ... Palo Alto Housing celebrated the ground-breaking of 2821 ECR Apartments, a $42-milion affordable Hidden Villa launched its annual Homesteading Day in 2018 to teach visitors skills to make and grow their own food. This year’s event on apartment community at 2821 April 27 will include demonstrations on everything from beekeeping to cider-making. Photo courtesy of Hidden Villa. El Camino Real in Redwood City, on April 11. The project includes 67 studio and one- The tech-savvy find their bedroom apartments for low- income families, veterans and individuals with special needs earning up to 70% of the San inner farmer Mateo County Area Median income, according to a press release from Palo Alto Housing. Hidden Villa farm’s Homesteading Day teaches Financing for the development residents how to live off the land, or at least is being provided in part by the County of San Mateo through make their own micro beer and cheese voter-approved Measure K. by Melissa McKenzie Palo Alto Housing, the nonprofit developer that manages the hink of the word “homesteading” and soapmaking, seed saving and cider-making. affordable-housing programs instantly images of wide-open prairies, “Being able to do (something) yourself is in the Bay Area, is on target orchards and farm life come to mind. But something people get really excited about, and to nearly double its number T along the Midpeninsula, where real estate is at that’s a big part of this event for us,” Thompson of housing units in the next a premium and not everyone has multiple acres said. “These are the skills that people have used few years, according to the of vacant land on their property, homesteading to sustain civilization, in a way, and build our nonprofit. Over the past year, is often a much simpler activity. nation from the very beginning. It’s exciting to Palo Alto Housing has had more Homesteading simply can be engaging in see that coming around in a more technology- than 600 units in various stags something like fermenting beer, cheesemaking, savvy area because I think it connects people Clockwise from top left: Clifford the calf of planning and development in caring for chickens or saving a little money by to things that are essentially human and make is among the barnyard animals that live the works. growing a garden and preserving some food, us who we are.” at Hidden Villa, a nonprofit working farm said Blair Thompson, Hidden Villa’s Animal Thompson said the key is to find an activity where visitors can get an upclose look at the SPRING BLOOMS ON Husbandry Manager. These are all types of that you enjoy. farming process. Blair Thompson, animal DISPLAY... Filoli is offering a inexpensive and non-space consuming ways to “You have to enjoy doing it because any of husbandry farmer at Hidden Villa in Los spring wildflower hike through start participating in the homesteading move- these things take time,” he said. Altos, holds pullet eggs, which are laid by its preserve from 11 a.m. to ment, which focuses on helping people become You might be a little disappointed with brew- young hens and are typically smaller than 12:30 p.m. on Saturday, April self-reliant. ing your first round of micro beer, for example, regular eggs. Thompson feeds a brood of 13. Get an upclose look at “You just need to have some interest in the but as you get into it and have fun with it, you can chickens that live on the Los Altos Hills farm. native wildflowers and learn skills of building and creating a home ... but create flavors that only you can make because it Photos by Jenny Rodriguez. about their unique qualities it doesn’t have to mean you own a home or an will be in the flavors and styles you want. movement, he said. and how they adapt and thrive. acre and are going to have a massive garden,” “Once you’re good at making your own, you “I think folks in our area have jobs that aren’t Tours are open to children 5 and Thompson said. can do it for cents. It’s all practice,” he said. physically connected to their bodies, and I think older. For more information, go While homesteading has been gaining local Alternately, housing livestock or chickens will being able to do something that has a little bit to bit.ly/FiloliSpringHike. steam among everyone from students to angel require a considerable amount of startup capital, more of a tangible reality that you can see and investors, not everyone is familiar with the con- but it, too, can lead to an overall cost savings touch and taste is really important for people,” Send notices of news and events related to real estate, interior design, home cept or has the skills. for animal owners. Thompson said what each Thompson said. Q improvement and gardening to Home In an effort to make homesteading accessible person is able to do will be based on what their Melissa McKenzie is a freelance writer Front, Palo Alto Weekly, P.O. Box 1610, to everyone, Hidden Villa farm in Los Altos city allows them to have on their property, and for the Weekly. She can be emailed at Palo Alto, CA 94302, or email editor@ Hills hosts an annual Homesteading Day that regulations will vary between each city. [email protected]. paweekly.com. Deadline is one week before publication. gives residents an upclose look at everything In Palo Alto, for example, permits are re- from beer brewing and sheep-dog herding to quired to keep horses, goats, sheep, pigs, chick- food preservation, backyard chicken care, com- ens, ducks and turkeys, and written permission Hidden Villa Homesteading Day READ MORE ONLINE posting, fruit-tree pruning and fiber arts through must be obtained from neighbors for a home- When: Saturday, April 27, 9:30 a.m. to 4 p.m. PaloAltoOnline.com hands-on demonstrations. owner to own hens. Cost: All-day pass $30/person; Sheep shearing This year’s second annual Homesteading Day The most important thing to remember is (morning only) $20/person; Homesteading (after- There are more real estate features noon only) $15/person. Children under 2 are free. online. Go to PaloAltoOnline.com/ will be held on Saturday, April 27, and will in- that anyone, whether they live in an RV or on Info: For more information or to register, go to real_estate. clude experts on sheep-shearing, beekeeping, a ranch, can participate in the homesteading hiddenvilla.org. www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 35 Home & Real Estate HOME SALES Yoshikawa for $4,350,000 on 03- Co LLC to Y. & C. Zhang for Home sales are provided by Cali- 04-19; previous sale 07-17-2017, $1,370,000 on 03-04-19 SALES AT A GLANCE fornia REsource, a real estate in- $3,200,000 182 Ada Avenue #B R. Kanitkar formation company that obtains to M. & S. Li for $1,480,000 on Menlo Park 03-06-19 Atherton Mountain View the information from the County Total sales reported: 1 Total sales reported: 16 1326 Hoover Street #8 1326 1731 Spring Street D & K Par- Recorder’s Office. Information Lowest sales price: $4,700,000 Lowest sales price: $498,000 Hoover Street LLC to Ellis Trust for sons Family Trust to R. & S. Gras is recorded from the deeds after Highest sales price: $4,700,000 Highest sales price: $2,450,000 $1,675,000 on 03-07-19; previous for $1,575,000 on 03-08-19; previ- the close of escrow and pub- Median sales price: $4,700,000 Median sales price: $1,605,000 sale 09-22-2017, $10,500,000 ous sale 07-23-1998, $292,000 lished within four to six weeks. Average sales price: $4,700,000 Average sales price: $1,578,400 1760 Oakdell Drive Huber Qtip 3850 Domain Way Pulte Home Atherton Trust to Maywood Trust for Co LLC to S. & V. Deb for $2,567,500 on 03-08-19; previous East Palo Alto Palo Alto 56 Holbrook Lane Charlotte $1,635,000 on 03-05-19 Total sales reported: 6 Total sales reported: 14 sale 07-14-2017, $5,135,000 Ventures LLC to A. Zaffaroni for 631 Tyrella Avenue D. Quong to Lowest sales price: $777,000 Lowest sales price: $250,000 535 Placitas Avenue Barbara $4,700,000 on 03-06-19; previous J. & C. Guo for $1,659,000 on 03- Highest sales price: $1,275,000 Highest sales price: $7,900,000 B Hinman Living Trust to S. & D. sale 06-27-2016, $1,925,000 08-19; previous sale 01-08-2016, Median sales price: $965,750 Median sales price: $2,190,000 Shoemaker for $2,595,000 on 03- $1,390,000 Average sales price: $980,600 Average sales price: $2,518,500 East Palo Alto 08-19; previous sale 07-16-2014, 300 Cherokee Loop San Luis 1174 Laurel Avenue I. & K. $1,978,000 Avenue Lp to S. Banerjee for Los Altos Portola Valley Walker to Aggrawal Family Trust 1425 Mills Court A. Flaig to D. & $1,795,000 on 03-05-19 Total sales reported: 4 Total sales reported: 1 for $777,000 on 03-08-19 D. Pickham for $2,600,000 on 03- 2459 Tamalpais Street Elyse Lowest sales price: $1,475,000 Lowest sales price: $2,800,000 2551 Emmett Way G. Farmer to 08-19 (Previous Sale 11-24-2003, J Krupnick Trust to A. Joyce for Highest sales price: $4,350,00z Highest sales price: $2,800,000 Z. Xi for $820,000 on 03-04-19 $1,130,000) $1,898,000 on 03-08-19 Median sales price: $2,675,000 Median sales price: $2,800,000 463 Larkspur Drive G. Khoury 236 Robin Way Daryl W Al- 331 Aldean Avenue One Marital Average sales price: $2,793,800 Average sales price: $2,800,000 to K. Goins for $920,000 on 03- ger Trust to H. & W. Allen for Trust to B. Tang for $1,975,000 on 07-19; previous sale 10-30-2018, $2,875,000 on 03-08-19; previous 03-06-19 Menlo Park Woodside $940,000 sale 09-12-2011, $989,000 240 Shumway Lane Han-Lin Total sales reported: 6 Total sales reported: 2 555 Bell StreetG. Williams to K. 1794 Oakdell Drive Deborah A Family Trust to D. & D. Horn for Lowest sales price: $1,675,000 Lowest sales price: $2,472,500 Williams for $1,011,500 on 03- Rau Trust to K. & M. Curtis for $2,150,000 on 03-06-19; previous Highest sales price: $3,788,000 Highest sales price: $4,200,000 05-19 $3,788,000 on 03-07-19; previous sale 10-13-2014, $1,882,000 Median sales price: $2,597,500 Median sales price: $3,336,250 2081 Ralmar Avenue Milillo 2017 sale 08-01-1987, $402,000 211 Monroe Drive J. Lee to Y. Average sales price: $2,683,400 Average sales price: $3,336,300 Trust to Analisa M Pratt Trust for & L. Yuan for $2,320,000 on 03- Source: California REsource $1,080,000 on 03-08-19; previous Mountain View 08-19 744 San Lucas Avenue Kintana Sale 08-23-2004, $499,000 1866 Peacock Avenue Poll Liv- Living Trust to Kintana Family 895 Tea Court M. Aguilar to P. & ing Trust to A. & V. Radchenko for J. Luk for $1,371,000 on 03-07-19 08-19; previous sale 10-05-2012, 08-19; previous sale 06-20-2016, Trust for $498,000 on 03-05- N. Kumar for $1,275,000 on 03- $2,450,000 on 03-08-19; previous 3282 Berryessa Street Muir $1,649,000 $4,260,000 19; previous sale 04-01-1992, 08-19; previous sale 04-15-2009, sale 11-03-2015, $2,100,000 Residl Invs LLC to M. & W. Yang 113 Seale Avenue 109 Seale $255,000 $385,000 for $1,713,000 on 03-08-19; previ- LLC to Muma Family Trust for Portola Valley 50 East Middlefield Road #22 Palo Alto ous sale 02-12-2019, $1,713,000 $2,775,000 on 03-06-19; previous 250 Dedalera Drive Thomas-Ross K. Mcmullen to D. & S. Hollatz for Los Altos 3173 Maddux Drive Demazeliere 128 Middlefield Road P. & N. sale 11-13-2018, $2,705,000 Family Trust to K. & M. Matthews $702,000 on 03-08-19 100 1st Street #109 Hyman 1993 Trust to Breaux Survivors Dusane to A. Lam for $1,800,000 3476 Janice Way Fimily Simon for $2,800,000 on 03-08-19; previ- 67 Gladys Avenue S. Gras to L. & Family Trust to Sander-Digiovanni Trust for $250,000 on 03-05-19 on 03-05-19; previous sale 10-22- Trust to C. & B. Elkariblieh for ous sale 06-26-2018, $2,900,000 M. Brenner for $1,125,000 on 03- Family Trust for $1,475,000 on 03- 4250 El Camino Real #B318 2008, $899,000 $2,820,000 on 03-04-19 07-19; previous sale 06-27-2005, Woodside 06-19; previous sale 01-08-2015, Anne V Mullin Trust to Maple 437 College Avenue Hoffmann 907 El Cajon Way Resneck & $490,000 131 Alta Vista Road Ashley $978,000 Asset LLC for $1,100,000 on 03- Family Living Trust to A. & J. Bau Meyers Family Trust to B. & J. Ro- 181 Ada Avenue #8 C. Chang to Bjorklund 2004 Trust to M. & Z. 28 Deep Well Lane Chambers 07-19; previous sale 03-06-2006, for $2,080,000 on 03-05-19; pre- soff for $3,200,000 on 03-08-19 A. Razzaghi for $1,255,000 on 03- Simkover for $2,472,500 on 03- Family Trust to M. & R. Aubert for $491,000 vious sale 12-07-2016, $1,918,000 1270 Cedar Street Becker Fam- 06-19; previous sale 04-29-2009, 08-19; previous sale 03-01-1991, $2,250,000 on 03-08-19 4250 El Camino Real #B217 804 Sutter Avenue Sandys Fam ily Trust to S. & A. Bradley for $571,000 $360,000 145 Pine Lane Pellegrini Family Mary A Wolpman Trust to V. Residual Trust B to Saini Living $4,100,000 on 03-08-19; previous 183 Darya Court J. Christopher 220 Crest Road Willie L Mccovey Trust to Michael & Shelly Trust for Tekriwal for $1,150,000 on 03- Trust for $2,300,000 on 03-06-19 sale 02-21-2012, $2,435,000 to Y. & Z. Dai for $1,368,000 on Living Trust to S. & R. Agrawal for $3,100,000 on 03-07-19 07-19; previous sale 01-01-1986, 3227 Bryant Street G. Azzi to B. 520 Tennyson Avenue Gassee 03-08-19 $4,200,000 on 03-06-19 10275 Kenbar Road Nirvana $185,000 & J. Jung for $2,700,000 on 03- Family Living Trust to Burns Fam- Investment Group LLC to K. & H. 3854 Domain Way Pulte Home 1615 Amherst Way S. Leland to ily Trust for $7,900,000 on 03- 4250 El Camino Real #B319, Palo Alto Elegant Palo Alto Redwoods Condo www.4250ElCaminoRealB319.com •2 Bed •1 Bath •960 Sq. Ft. •3 Parking Spaces OPEN HOUSE Offered at $988,000 Saturday 4/13 & Sunday 4/14 | 1:30 - 5:00 pm Heng Seroff Group Kei Group 650.516.7506 / 650.690.2858 408.246.8888 [email protected] [email protected] [email protected] DRE#D 01912393, 01925245 DRE# 01884007, 01921791 Page 36 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 37 232 Coleridge Avenue, Palo Alto 3,085 Sq Ft | 28,750 Sq Ft Lot | Offered at $17,500,000 232Coleridge.com This classic beauty built in 1925 is situated on one of the most desirable streets in prestigious Old Palo Alto. The home’s distinctive stucco façade, deeply recessed ^O|psdbOlBbO_MddoÛsWaJOoOMJB_Kdb|BbMzodtUVsWodbUoW__Ozdo^BoOMObWbU features of the Spanish Colonial Revival style that is the iconic architectural signature of the City of Palo Alto. 2VOVdaOĆpKdaTdosBJ_OBbMzO__øMOpWUbOMddol_BbWbK_tMOpVWUVKOW_WbUpÛBbM well-proportioned rooms with large windows and French doors for maximum natural light and harmonious integration of interior and exterior spaces. Image Source: The City of Palo Alto Parcel Report Carol Carnevale and Nicole Aron 59 Palo Alto sales...and counting! 650.465.5958 | 650.740.7954 [email protected] [email protected] CarolandNicole.com DRE 00946687 | DRE 00952657 Rankings provided courtesy of Real Trends, The Thousand list of individual agents by total sales volume in 2018. Compass is a real estate broker licensed by the State of California and abides by Equal Housing Opportunity laws. WKObpO!taJOoà__aBsOoWB_loOpObsOMVOoOWbWpWbsObMOMTdoWbTdoaBsWdbB_ltoldpOpdb_|BbMWpKdalW_OMTodapdtoKOpMOOaOMoO_WBJ_OJtsVBpbdsJOObyOoWOMà VBbUOpWbloWKOÛKdbMWsWdbÛpB_OdozWsVMoBzB_aB|JO made without notice. No statement is made as to accuracy of any description. All measurements and square footage are approximate. Page 38 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com 1300 Hamilton Avenue, Palo Alto Û/nsŚÛ/nsdsŚ#TTOoOMBsĝÛÛ BaW_sdbyObtOàKda BUbWKObs oOpKObs+Bo^VdaOTOBstoOpO_OUBbsBbMplBKWdtp_WUVsø__OM oddapBbMO{soBdoMWbBo|KoBTspaBbpVWlàBbMpdaOK_BppWKMOsBW_pÛVWUVøKdTTOoOM KOW_WbUpÛlWKstoOoBW_pÛBbMoWKVzddMddopVBoadbWOzWsVBps|_WpVKdbsOaldoBo| lB_OssOBbMWbsOoWdoMOpWUbÛKoOBsWbUBzBoaBbMzO_KdaWbUBaJWBbKOTdo KdaTdosBJ_O_WyWbUà 2VOVtUO^WsKVObWpBooBbUOMBodtbMBUoBbWsOp_BJKObsOoWp_BbMzWsVJoOB^TBps JBoà9WsVWspBJtbMBbspsdoBUOÛpzOOlWbUKdtbsOopÛlodTOppWdbB_ntB_Ws| Bll_WBbKOpBbMBbOBoJ|VOoJUBoMObÛsVO^WsKVObWpMOpWUbOMsdlodyWMOBbWMOB_ zdo^WbUObyWodbaObsTdosVOVdaOKVOTà2VOBM]dWbWbUTBaW_|oddaTOBstoOp zWbMdzzB__pToBaWbUlOBKOTt_yWOzpdTsVOJOBtsWTt_UBoMObà JBpOaObsaOMWBoddaBKKdaadMBsOpVdaOObsOosBWbaObszVW_OsVOtbWntO oMddoJBsVOMWbbBstoB__WUVsdTTOopaBb|ldppWJW_WsWOp÷KVW_MoObĆpl_B|oddaÛ |dUBÛBosWpspstMWdà 2VOoOBoOJOModdapBbMldppWJW_WsWOpTdoadoOMOlObMWbUdbsVObOzdzbOopĆ bOOMpÛBbMBMOsBKVOMUtOpsBlBosaObszWsV^WsKVObBbMJBsVà 2VOoBoOÛİpnàTsà_dsTOBstoOpBpzWaaWbUldd_BbMBMO_WUVsTt_loWyBsO UBoMObzWsVaBstoOUoOObOo|ÛTotWssoOOpBbMpOBpdbB_Kd_doà _dpOsdMdzbsdzb+B_d_sdœO{KOlsWdbB_pKVdd_pà Carol Carnevale and Nicole Aron 591 Palo Alto sales...and counting! 650.465.5958 | 650.740.7954 [email protected] [email protected] CarolandNicole.com DRE 00946687 | DRE 00952657 .Bb^WbUplodyWMOMKdtosOp|dT.OB_2oObMpÛ2VO2VdtpBbM_WpsdTWbMWyWMtB_BUObspJ|sdsB_pB_Opyd_taOWbà dalBppWpBoOB_OpsBsOJod^Oo_WKObpOMJ|sVO/sBsOdT B_WTdobWBBbMBJWMOpJ|ntB_dtpWbU#lldostbWs|_Bzpà WKObpO!taJOoà__aBsOoWB_loOpObsOMVOoOWbWpWbsObMOMTdoWbTdoaBsWdbB_ltoldpOpdb_|BbMWpKdalW_OMTodapdtoKOpMOOaOMoO_WBJ_OJtsVBpbdsJOObyOoWOMà VBbUOpWbloWKOÛKdbMWsWdbÛpB_OdozWsVMoBzB_aB|JO aBMOzWsVdtsbdsWKOà!dpsBsOaObsWpaBMOBpsdBKKtoBK|dTBb|MOpKoWlsWdbà__aOBptoOaObspBbMpntBoOTddsBUOBoOBllod{WaBsOà www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 39 Secluded Estate Site on 15 Acres Once in a lifetime opportunity to build your dream retreat in wine country. Secluded and gated estate property with 15 flat acres, open meadows and verdant forests. Mostly plantable with abundant well water. This area is becoming a high-end enclave with a nearby estate property nearing completion and the other completed. Perfect for vines or a ranch of your own. Serene and quiet yet only 12 minutes from Calistoga in Sonoma County. FranzValley15Acres.com Estate Site on 28 Stunning Acres on the Napa-Sonoma Border Join this high-end gated enclave and escape to the serenity and seclusion of wine country. 28 stunning acres in Sonoma County. Mountain views, a knoll view site, open meadows, lush forests, and two building sites. So many possibilities await you. 11 plantable acres with abundant well water; plenty of room for a vineyard and a ranch of your own. FranzValley28Acres.com · $1,950,000 Top Producer Sieba Peterson Jeffrey Earl Warren Wine Country 2018 707.932.1276 707.486.1025 Each Office is Independently [email protected] [email protected] Owned and Operated. Lic. #01460836 Lic. #00981449 532 Shorebird Circle, #6203, Redwood City OPEN HOUSE: SAT & SUN 1- 4 PM • Waterview Condo Living 1568 sq. ft. • Fireplace • Attached Garage plus Storage • 2 Bedroom, 2 baths • Soaring Ceilings • 2 Pools • Spacious Loft with Built-in Bookcases • Skylights • Jacuzzi • Eat-in Kitchen • Shoji Doors • Household Pet Allowed • Breakfast Bar • Elongated Deck Overlooking Waterways • Boat Dock • Living Room/Dining Room Combo • Washer/Dryer Inside • Community Tennis Courts Offered for $1,290,000 Doris Messina, Realtor, CHMS Intero, A Berkshire Hathaway Affiliate CalDRE#01385521 930 Santa Cruz Ave. [email protected] 650-248-6069 Menlo Park, CA 94025 Page 40 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 41 Page 42 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com OPEN HOUSE SAT & SUN 1:30-4:30PM 668 SALVATIERRA STREET, STANFORD ELEGANT HOME IN PRIME LOCATION NEAR CAMPUS Elegant light filled traditional home in a prime location near Stanford campus. Lovely gardens and spring blossoms frame this beautifully appointed and updated single story residence which features gracious formal dining room, gracious living room with a vaulted beam ceiling and wood burning fireplace. The remodeled kitchen opens to a family room with built-in cabinetry and sliding glass doors lead to spacious rear patio and yard. The rear patio and gardens are ideal for entertaining and indoor/outdoor living! Spacious master suite with access to rear patio. Hardwood floors throughout most of the home and wall-to-wall carpeting in the bedrooms. With its excellent Stanford location and access to top-rated Palo Alto schools, this is truly a wonderful place to call home. • 3 Bedrooms & 3 Bathrooms plus Sitting Room/Library and • Living Space: 2,364 Sq. Ft. per county records Family Room • Lot Size: 12,772 Sq. Ft. per county records • Elegant Living Room with fireplace • Excellent Palo Alto Schools: Nixon Elementary, Fletcher Middle, • Formal Dining Room Gunn High (buyer to verify enrollment). • Attached 2 car garage • Available to Qualified Stanford Faculty and Staff only OFFERED AT $2,795,000 | WWW.668SALVATIERRA.COM This information was supplied by third party sources. Sales Associate believes this information is correct but has QRWYHULÜHGWKLVLQIRUPDWLRQDQGDVVXPHVQROHJDOUHVSRQVLELOLW\IRULWVDFFXUDF\%X\HUVKRXOGYHULI\DFFXUDF\DQG LQYHVWLJDWHWR%X\HUoVRZQVDWLVIDFWLRQ SUNDAYOPEN 1:30-4:30PM HOUSE 142 SANTA RITA AVENUE, PALO ALTO OLD PALO ALTO OPPORTUNITY Located on a private corner in the coveted Old Palo Alto, this charming single story residence features 2 bedrooms plus a family room. An entry foyer welcomes the visitor to this lovely traditional home with divided light wood windows and oak hardwood floors throughout most of the home. With its premier location in the heart of Old Palo Alto, every amenity needed is in close proximity – Greene Middle School, Bowden Park and an array of fine shopping and dining on renowned California Avenue blocks away. Plus, Silicon Valley tech centers, Stanford University, and commuter routes to the greater Bay Area are all within easy reach. • 2 Bedrooms & 2 Bathrooms plus Family Room • Living Space: 1,448 sq ft per county records • Gracious Living Room with fireplace • Lot Size: 5,625 sq ft per county records • Formal Dining Room and Eat-In Kitchen • Excellent Palo Alto Schools: Walter Hays Elementary, Greene Middle, Palo Alto • Detached 2 car garage High (buyer to verify enrollment) OFFERED AT $2,850,000 | WWW.142SANTARITA.COM (650) 475-2030 (650) 475-2035 [email protected] [email protected] DRE# 01009791 DRE# 01747147 www.LeannahandLaurel.com www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 43 OPEN HOUSE Saturday 4/13 & Sunday 4/14 1:30-4:30PM 542 CENTER DRIVE, PALO ALTO Offered at $5,949,995 8LMWKSVKISYW8YHSVMRGSZIXIH'VIWGIRX4EVOSJJIVWFIHVSSQWERHFEXLVSSQWMRETEVOPMOIWIXXMRK;MHITPEROVI½RMWLIHSVMKMREP SEO¾SSVWZEYPXIHFIEQIHGIMPMRKWERHSVMKMREPEVGLIHHSSV[E]WLMKLPMKLXXLI½VWX¾SSVPMZMRKWTEGIW[LMGLMRGPYHIEWXYRRMRKPMZMRK VSSQEWM^EFPIJSVQEPHMRMRKVSSQERHEPMKLX½PPIHOMXGLIRJEQMP]VSSQ[MXL½VITPEGI%REHNSMRMRKWYRVSSQ[MXLFYMPXMRWGSYPHWIVZI EWERSJ½GIFVIEOJEWXSVJEQMP]KEQIVSSQ-REHHMXMSRXSXLIPY\YVMSYW1EWXIV7YMXIXLIYTWXEMVWJIEXYVIWXLVIIEHHMXMSREPFIHVSSQW [LMPIXLI½JXLFIHVSSQ[MXLIRWYMXIFEXLVSYRHWSYXXLI½VWX¾SSV8LIKEVHIRWEVIEWIRGLERXMRKEWXLILSQISJJIVMRK.ETERIWIQETPIW JVYMXXVIIWEZIKIXEFPIKEVHIRERH[MWXIVMEGSZIVIHEVFSVW%RI\TERWMZIPE[RWITEVEXIWXLILSYWIJVSQXLIWTEVOPMRKTSSPLSXXYFERH GLERKMRKGEFEREWUJXSJPMZMRKWTEGI EGEVKEVEKISRERSZIVWM^IHWUJXPSX)\GIPPIRX4EPS%PXSWGLSSPW (YZIRIGO +VIIRI1MHHPI4EPS%PXS,MKL ERHGPSWITVS\MQMX]XSEPPXLEX7MPMGSR:EPPI]LEWXSSJJIVGSQTPIXIXLIETTIEP This information was supplied by third party sources. Sales Associate believes this information is correct but has QRWYHULÜHGWKLVLQIRUPDWLRQDQGDVVXPHVQROHJDOUHVSRQVLELOLW\IRULWVDFFXUDF\%X\HUVKRXOGYHULI\DFFXUDF\DQG LQYHVWLJDWHWR%X\HUoVRZQVDWLVIDFWLRQ BRIAN CHANCELLOR (650) 303-5511 [email protected] brianchancellor.com DRE# 01174998 Page 44 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com $$$ "#%& •2 bedrooms, 1.5 bathrooms in each unit •Situated on a large corner lot with two •Open floor plans with remodeled kitchens separate street addresses •Dual pane windows throughout •Excellent rental history •Remodeled bathrooms •Centrally located near shopping, schools, •Upgraded flooring parks, libraries, transportation and more! •Central air conditioning •2,122 Sqr Ft (1,061 each unit) approx. •In unit laundry •9,265 lot size approx. •Detached workshop/storage shed OFFERED AT $2,395,000 Listed by Timothy Foy • 2775 Middlefield Road • Phone: 650.321.1596 • www.midtownpaloalto.com www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 45 THE ADDRESS IS THE PENINSU THE EXPERIENCE IS AIN PINEL LOS ALTOS HILLS $5,997,500 ATHERTON $4,999,999 MENLO PARK $4,188,000 MOUNTAIN VIEW $2,598,000 25620 Frampton Court | 5bd/5ba 1 Heritage Court | 5bd/7ba 655 Gilbert Avenue | 4bd/3.5ba 932 Rincon Streeet | 3bd/2.5ba Rick & Suzanne Bell | 650.209.1513 Stephanie Nash | 650.995.3820 Ray Hogue/Stacey Woods | 650.964.3722 Angie Galatolo | 650.704.8168 License # 01051633 | 01422075 License # 01104524 License # 01980343 | 02002137 License # 01701418 BY APPOINTMENT BY APPOINTMENT BY APPOINTMENT BY APPOINTMENT SARATOGA $2,588,000 MENLO PARK $2,498,000 LOS GATOS $2,495,000 SUNNYVALE $2,395,000 13685 Quito Road | 5bd/3ba 2024 Gordon Avenue | 3bd/2ba 150 College Avenue | 3bd/2.5ba 1074 Westchester Drive | 3bd/2ba Sophie Jo | 650.918.8994 Brad Verma | 650.665.0894 Denise Welsh | 415.999.0727 Shelly Roberson | 650.464.3797 License # 02001722 License # 02033592 License # 00939903 License # 01143296 BY APPOINTMENT OPEN SAT & SUN 2:00-4:00 OPEN SAT & SUN 1:00-4:00 BY APPOINTMENT SAN CARLOS $2,295,000 STANFORD $2,200,000 MENLO PARK $2,198,000 MENLO PARK $2,095,000 10 Shratton Avenue | 4bd/3ba 820 Pine Hill Road | 3bd/2ba 1326 Hoover Street #5 | 3bd/2.5ba 789 16th Avenue | 4bd/3ba Steve & Julie Quattrone | 650.505.4900 Shari Ornstein/Pamela Culp | 650.814.6682 Liz Daschbach | 650.207.0781 Katy Thielke Straser | 650.888.2389 License # 01463726 | 01519860 License # 01028693 | 00896337 License # 00969220 License # 01308970 OPEN SAT & SUN 12:00-5:00 OPEN SAT & SUN 1:30-4:30 OPEN SAT & SUN 2:00-4:00 OPEN SAT 12:00-5:00 & SUN 1:00-4:00 MOUNTAIN VIEW $1,695,000 REDWOOD CITY $1,680,000 REDWOOD CITY $1,550,000 MENLO PARK $1,199,000 2544 Mardell Way | 3bd/2ba 2740 Carolina Avenue | 4bd/2ba 1785 Maryland Street | 3bd/1ba 150 Alma Street #213 | 2bd/2ba Jim & Jimmy Nappo | 650.861.7661 Stephanie Nash | 650.995.3820 Liz Rhodes/Michele Harkov | 650.722.3000 Liz Daschbach | 650.207.0781 License # 00767311 | 01439226 License # 01104524 License # 01179852 | 01838875 License # 00969220 BY APPOINTMENT BY APPOINTMENT OPEN SAT & SUN 1:00-4:00 OPEN SUNDAY 1:30-4:30 APR.COM Over 30 Real Estate Offices Serving The Bay Area Including Palo Alto Los Altos Menlo Park Menlo Park-Downtown Woodside 650.323.1111 650.941.1111 650.462.1111 650.304.3100 650.529.1111 Square footage, acreage, and other information herein, has been received from one or more of a variety of different sources. Page 46 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com Such information has not been verified by Alain Pinel Realtors®. If important to buyers, buyers should conduct their own investigation. New Listing 8 CAMBORNE AVE SAN CARLOS OFFERED AT $1,949,000 4 BED | 2 BATH 1,860 SQ FT | 6,750 SQ FT OPEN SAT & SUN 1:30-4:30PM HILLSIDE LUXURY IN SAN CARLOS Perched on the side of a sun kissed peak in San Carlos’ prized Devonshire Canyon neighborhood, this immaculately remodeled classic ranch home offers both views and luxury. As you enter the home, you are greeted by an entry hallway with a stunning skylight, which opens up into a sumptuously sized great room with space for both living and dining, BbKVdoOMJ|JoOBsVsB^WbUyWOzpdTsVOyOoMBbs/Bb Bo_dpVW__ppOObsVodtUVdyOopWOMddoøsdøKOW_WbUzWbMdzpàssBKVOM to this space is the gourmet kitchen, which has been impeccably remodeled with beautiful custom cabinetry and top notch Bll_WBbKOpÛWbK_tMWbUB9d_ToBbUOà dzbpsBWopWpBbBMMWsWdbB_TBaW_|oddazWsVoOl_BKOÛ^WsKVObOssOÛBbMBKKOppsdsVO ploBz_WbUMOK^ÛzVWKV_OBMpsdBoBoOBbMVWUV_|KdyOsOMBs|BoMzWsVBloWpsWbO_|aBbWKtoOM_Bzbà 2VOVdtpOĆpTdtozO__øBlldWbsOMJOModdapBoOpWstBsOMWbBaBbbOosVBsaB^OpsVOasoOaObMdtp_|O{WJ_OTdoBb|dzbOoĆp needs. The master bedroom is downstairs and supremely private, with an additional downstairs bedroom that opens up to sVOdyOopWOMMOK^à3lpsBWop|dtKBbbMszdadoOJOModdapÛdbOdTzVWKVTOBstoOpJOBtsWTt_oObKVMddop_OBMWbUsdsVO Todbs|BoMà_t{toWdtpVB__JBsVoddaKBbJOTdtbMdbOBKVddoà3bJOBsBJ_Olod{WaWs|sdsdløoBsOM/Bb Bo_dppKVdd_pÛ major local employers and commute routes, and local parks and trails complete the picture. Don’t miss your chance to own the classic California outdoor lifestyle that the Devonshire Canyon is known for! ENJOY AN INTERACTIVE 3D TOUR AND PROPERTY VIDEO AT WWW.8CAMBORNE.COM James Steele +1 650 796 2523 [email protected] ThriveInSiliconValley.com DRE 01872027 Compass is a licensed real estate broker (01991628) in the State of California and abides by Equal Housing Opportunity laws. All material presented herein is intended for informational purposes only. Information is compiled from sourceswww.PaloAltoOnline.com deemed reliable but is subject to errors, omissions, • Palochanges inAlto price, condition,Weekly sale, or• withdrawApril without 12, 2019 notice. No • statement Page is 47made as to accuracy of any description. All measurements and square footages are approximate. Exact dimensions can be obtained by retaining the services of an architect or engineer. This is not intended to solicit property already listed. 2190 Avy Av $3,725,000 2281 Byron St $7,998,000 LEGEND: CONDO (C), TOWNHOME (T). OPEN HOMES Sun 2-4 4 BD/3.5 BA Sat 1:30-4:30 5 BD/5.5 BA Golden Gate Sotheby’s International Realty DeLeon Realty 900-7000 21 Willow Rd #9 (C) $1,298,000 ATHERTON 395-7677 1429 Emerson St $7,998,000 Sat/Sun 2-4 2 BD/2 BA 362 Camino Al Lago $2,998,000 3880 Alameda de Las Pulgas $3,488,000 Sun 1:30-4:30 5 BD/3.5 BA Compass 208-5196 Sat/Sun 1-5 3 BD/2 BA Sat 1:30-4:30 5 BD/4 BA Alain Pinel Realtors 384-5392 4411 Fair Oaks Av $1,799,000 DeLeon Realty 900-7000 DeLeon Realty 900-7000 1800 Webster St $7,998,000 Sat/Sun 1:30-4:30 3 BD/2 BA 3 Irving Av $4,895,000 900 Hobart St $4,895,000 Sat/Sun 1:30-4:30 5 BD/5.5 BA Alain Pinel Realtors 814-0858 Sun 1:30-4:30 4 BD/3 BA Sun 1:30-4:30 5 BD/3.5 BA Compass 906-8008 2024 Gordon Av $2,498,000 Compass 465-7460 Compass 465-7459 417 Seneca St $6,988,000 Sat/Sun 2-4 3 BD/2 BA 90 Macbain Av $5,995,000 130 Royal Oaks Ct $5,998,000 Sun 1:30-4:30 6 BD/4.5 BA Alain Pinel Realtors 665-0894 Sat/Sun 1:30-4 5 BD/3.5 BA Sun 2-4 5 BD/4.5 BA DeLeon Realty 900-7000 Coldwell Banker 465-6210 35 Hallmark Cir $3,999,950 Alain Pinel Realtors 533-5102 Sat/Sun 1:30-4:30 3 BD/2.5 BA 39 Sneckner Ct $5,488,000 PORTOLA VALLEY LOS ALTOS Compass 333-3833 Sun 1:30-4:30 5 BD/5.5 BA 181 Erica Way $2,495,000 Coldwell Banker 793-1000 483 Los Ninos $2,998,000 224 Hedge Rd $1,798,000 Sat/Sun 1:30-4:30 4 BD/3 BA Sat/Sun 1:30-4:30 3 BD/2 BA Sat/Sun 1:30-4:30 3 BD/1 BA 2070 Sterling Av $3,598,000 Intero 543-7740 Alain Pinel Realtors 823-8057 Compass 465-7459 Sat/Sun 1:30-4:30 5 BD/4 BA 2 Portola Green Ct $3,100,000 Intero 947-3700 1495 Cedar Pl $2,798,000 119 Hillside Av $1,988,000 Sat/Sun 1:30-4:30 4 BD/2 BA Sun 1:30-4:30 4 BD/2 BA Sat/Sun 1-5 3 BD/2.5 BA Alain Pinel Realtors 704-1865 Alain Pinel Realtors 823-8057 DeLeon Realty 900-7000 MOUNTAIN VIEW 1389 San Domar Dr (Duplex) $2,395,000 1326 Hoover St #5 $2,198,000 REDWOOD CITY 241 Delphi Cir $4,200,000 Sat/Sun 1:30-4:30 2 BD/1.5 BA Sat/Sun 2-4 3 BD/2.5 BA 231 B St $1,295,000 Sat/Sun 1-5 4 BD/3.5 BA Midtown Realty, Inc. 387-5078 Intero 947-4700 Alain Pinel Realtors 207-0781 Sun 1-4 2 BD/2 BA 500 Front Ln $1,788,000 44 La Loma Dr $3,198,000 Alain Pinel Realtors 208-5425 351 Juanita Way $3,895,000 Sat/Sun 12-5 3 BD/2.5 BA Sat/Sun 2-4 3 BD/2.5 BA 102 Nueva Av $1,195,000 Sat/Sun 1:30-4:30 4 BD/3 BA Keller Williams Realty 468-0607 Sat/Sun 1:30-4:30 2 BD/1 BA Alain Pinel Realtors 346-4727 Golden Gate Sotheby’s International Realty 242-2473 110 Plum Ct $2,128,000 Alain Pinel Realtors 434-4318 1401 Brookmill Rd $2,998,000 Sat/Sun 1:30-4:30 4 BD/3 BA 532 Shorebird Cir #6203 (C) $1,290,000 Sat/Sun 1:30-4:30 5 BD/4 BA 7 Montana Ln $3,299,000 Sereno Group 947-2929 Sat/Sun 1-4 3 BD/2.5 BA Sat/Sun 1-4 2 BD/2 BA Intero 947-4700 1639 Spring St $1,998,000 Coldwell Banker 465-4663 Intero 543-7740 168 Loucks Av $4,998,000 Sat/Sun 1:30-4:30 4 BD/3 BA 985 8th Av $2,398,888 Sat/Sun 1:30-4:30 5 BD/7 BA 318 Oakwood Pl $2,420,000 Intero 947-4700 Sat/Sun 1:30-4:30 3 BD/2 BA Sat 1:30-3:30 3 BD/4 BA Intero 947-4700 1631 Grant Rd (T) $1,738,000 Keller Williams Realty 255-2977 Intero 543-7740 Sat/Sun 1:30-4:30 4 BD/3 BA LOS ALTOS HILLS 873 Partridge Av $2,395,000 Intero 947-4700 540 Leahy St $1,380,000 Sat/Sun 1-3 3 BD/2.5 BA 25055 La Loma Dr $8,988,000 Sat/Sun 1-4 3 BD/2 BA Coldwell Banker 678-7765 Sun 1:30-4:30 5 BD/5+2 H BA Compass 465-5971 PALO ALTO DeLeon Realty 900-7000 807 Paulson Cir $2,988,000 4250 El Camino Real #B319 $988,000 1785 Maryland St $1,550,000 Sat/Sun 1-5 3 BD/2.5 BA Sat/Sun 1:30-5 2 BD/1 BA Sat/Sun 1-4 3 BD/1 BA MENLO PARK DeLeon Realty 900-7000 Keller Williams Realty 516-7506 Alain Pinel Realtors 722-3000 150 Alma St #213 $1,199,000 2021 Santa Cruz Av $1,999,000 777 San Antonio Rd 21 (C) $1,095,000 1871 Maddux Dr $1,598,000 Sun 1:30-4:30 2 BD/2 BA Sun 1:30-4:30 3 BD/1.5 BA Sun 1:30-4:30 2 BD/1 BA Sat/Sun 1:30-4:30 4 BD/2 BA Alain Pinel Realtors 207-0781 Alain Pinel Realtors 787-4498 Midtown Realty, Inc. 387-5078 Coldwell Banker 465-8930 20 Willow Rd (C) $1,249,000 2325 Tioga Dr $4,495,000 717/723 Ellsworth Pl $2,488,000 421 Ruby St $1,698,000 Sat/Sun 1-4 2 BD/2 BA Sat 1:30-4 3 BD/3 BA Sat 1:30-4:30 4 BD/2 BA Sat/Sun 1:30-4:30 4 BD/3 BA Alain Pinel Realtors 733-3358 Coldwell Banker 619-3621 DeLeon Realty 900-7000 Compass 906-8008 638 Middlefield Rd $3,349,500 25 Seki Ct $3,950,000 Sun 1:30-4:30 4 BD/3.5 BA Sat/Sun 1:30-4:30 5 BD/4.5 BA IRREPLACEABLE CORE MENLO PARK Coldwell Banker 619-6461 Alain Pinel Realtors 400-1317 OFFICE INVESTMENT OPPORTUNITY MENLO PARK, CALIFORNIA SPRING HAS SPRUNG A MOVE? A NEW JOB? A NEW SPOUSE? FOR SALE = A NEW HOUSE!! Contact: Today’s news, sports JAN STROHECKER, SRES & hot picks “Experience Counts 32 Years Top Sales Performance” Realtor, DRE #00620365 Fresh news Residential • Land • 1031 Exchanges Direct: (650) 906-6516 delivered Email: [email protected] daily www.janstrohecker.com Sign up today at CALL Jan Today PaloAltoOnline.com/ for Best Results! express ® SIZE: 43,083 SF Contact: Ben Bullock, E: [email protected], T: 415.276.6927, CA Lic# 01885337 ® or Thomas Foley, E: [email protected], T: 415. 276.6091, CA Lic# 01997105 The DeLeon Difference 650.543.8500 www.deleonrealty.com KIÁSFRP Holliday GP Corp. (“HFF”), California Department of Real Estate CA License #01385740 650.543.8500 | www.deleonrealty.com | DeLeon Realty CalBRE #01903224 Page 48 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com Sports Shorts A LITTLE DRAFTY ... Stanford senior Alanna Smith was reunited with her Australian National Team coach Sandy Brondello when she became the Phoenix Mercury’s first Local sports news and schedules, edited by Rick Eymer round draft pick, the eighth overall Sports pick, of the WNBA Draft at Nike NYHQ in New York on Wednesday. Smith and Brondello helped Team Australia to the silver medal at the 2018 World Cup, losing in the championship game to the United States, comprised of veteran WNBA players. Phoenix finished 20-14 last season, reaching the league’s final four for the sixth consecutive season. The Mercury begin training camp May 5 and opens the season May 25 at Seattle. The 6-foot-4 forward with a 3-point touch became the 26th Stanford player drafted into the WNBA and the 12th first-round selection. Smith, an All-American, had a superb senior season in which she shot 51.5 percent from the field, 39.7 percent from behind the arc and averaged a team-high 19.4 points per game to go with Photo courtesy of Duncan Lord 8.6 rebounds and 2.2 blocks. She Justin Nam hits a grand slam, sparking Menlo School to a sixth straight victory and a place in the top three of the PAL Bay Division. is just the fourth NCAA women’s basketball player over the past 20 years to put together a career of PREP BASEBALL 1,600 points, 150 made triples and 200 blocks. Smith, who had 81 triples, 78 blocks and 699 points Menlo asserts itself into league race this year, is the only NCAA women’s basketball player to accumulate 70 Local schools are all capable of playing in the postseason 3-pointers, 70 blocks and 600 points in a season in the last 20 years. Her by Rick Eymer (9-8-1, 4-2) twice and handing Bur- Julien Hernandez (4-2) earned the bottom of the fourth, but Menlo had 81 made 3-pointers this season are he various local high school lingame its only league loss. win, allowing seven hits, striking already took a 7-0 lead with two the second most for a player her league baseball races seemed Sacred Heart Prep snapped out of out four and walking one in 3 2/3 runs when Max Chou and Nam height over the past 20 seasons. She to be headed in one direction its three-game losing streak with an innings. Fellow junior Kiefer Lord came around on a balk and wild was 34th in the country in scoring T last week. This week, races have be- 11-8 nonleague victory over Santa came in for the save, his third of the pitch in the top half of the inning. (19.4) and 33rd in blocks per game come jumbled and seemingly going Teresa on Wednesday. The Gators season. In nonleague action, Reece (2.17), the only player in the NCAA in every which direction. have a home game against Pacific Juniors Max Chou and Ian Col- Lindquist hit a home run and drove in the top 40 in both categories. Take Menlo School, for example. Grove at 3 p.m. Saturday and a lins each collected four hits. Nam in four runs as Sacred Heart Prep Smith’s 78 rejections are second The Knights were nearly left on the game at Pacific Grove on Wednes- and junior Luca Espinosa each topped Santa Teresa 11-8 in a non- in Stanford history behind Jayne junk pile after losing their first two day before returning to league ac- added a pair. league slugfest Wednesday in San Appel’s 84 in 2007-08 and her 81 Peninsula Athletic League Bay Di- tion on April 24. The third inning proved to be the Jose. made 3-pointers are tied for eighth, vision games. Since then, though, Palo Alto (11-5, 6-3) was riding turning point for the Knights. Espi- Lindquist’s home run was a solo as is the 699 points she scored. She Menlo has become very much a hot a 10-game winning streak and has nosa led off with a single and JC Ng shot and inside the park to fin- is just the fourth player in program topic. since lost three of four, including and Charlie Giesler both walked to ish the scoring. He did drive in history to earn both All-America and Senior Justin Nam helped make Wednesday’s 8-1 loss to Wilcox in load the bases with none out. Nam the first run with fielder’s choice academic All-America honors, joining that happen with one swing of the SCVAL De Anza Division. The followed by blasting a shot to deep in the first inning and then added Chiney Ogwumike, Kristin Folkl and the bat on Wednesday. He’ll get Vikings, in third place, look to snap left, giving Menlo a 5-0 lead. Kate Starbird. Since the WNBA’s a chance to do his part from the back Friday when they play the Carlmont scored five times in the (continued on page 50) inaugural season (1997), 29 former mound on Friday when the Knights Chargers in Santa Clara at 4 p.m. Stanford players have appeared in (9-4, 3-2) play Carlmont on Fri- Friday. a regular-season game and seven day at 4 p.m. in Atherton, with the Gunn (7-6, 7-1 entering Thurs- players have won a combined eight chance to overtake the Scots (9-7, day’s game against Fremont) is at WNBA championships. 4-2) for a share of second place be- the top of the SCVAL El Camino hind PAL Bay leader Burlingame Division standings thanks in large FAIRWAYS AND GREENS ... (8-2, 6-1). part to getting the big hit or clutch Receiving season-best showings Nam hit a grand slam in Menlo’s pitching. from junior Ziyi Wang and 15-8 victory over Carlmont, the Eric Epstein doubled home two sophomore Kelsey Zeng, the third- high point of the Knights’ sixth runs in the bottom of the seventh on ranked Stanford women’s golf team consecutive victory. In fact, Menlo Tuesday to lead the Titans to a 4-3 finished third on Tuesday in the hasn’t lost since dropping its first victory over Fremont. Silverado Showdown at Silverado two PAL games to Sacred Heart Menlo-Atherton (6-8, 5-2) also Resort and Spa. The Cardinal Prep. seems to win at the right time combined for a last-round score of Wednesday’s victory emphasized to remain in contention in the 6-over 294 on the North Course for that the race is far from over. The PAL Ocean Division. The Bears a 54-hole total of 17-over 881. No. Knights still have nine PAL con- knocked off San Mateo on Tuesday 16 Northwestern won the 18-team tests remaining to play, plenty of and was hoping to sweep the series tournament with a score of 6-over time for upward mobility. Thursday. M-A has next week off 870, followed by No. 2 USC at 10- Menlo responsed to its early set- from league play. over 874. Wang earned her highest backs, on the heels of several games Woodside (6-5, 2-3) lost to Se- finish of the season by closing with a lost to the weather, by coming back quoia on Tuesday and was look- 2-over-par 74 and tied for seventh at and sweeping The King’s Academy, ing to split its series Thursday. 3-over 219. It was Wang’s third top- last year’s PAL Ocean Division. The Wildcats play El Camino on 10 showing of the season and sixth TKA has made its presence felt Tuesday at 4 p.m. in South San File photo in the last two years. Zeng (79) tied in the Bay Division, beating the de- Francisco. Reece Lindquist hit a home run in Sacred Heart Prep’s 11-8 victory for 23rd at 8-over 224 for her best fending PAL Bay champion Gators Meanwhile in Belmont, Menlo’s over Santa Teresa. performance at Stanford. Q www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 49 interested in this matter appear before this you are or may be responsible for paying off Sports court at the hearing indicated below to show all liens senior to the lien being auctioned cause, if any, why the petition for change of off, before you can receive clear title to the name should not be granted. Any person property. You are encouraged to investigate Public objecting to the name changes described the existence, priority, and size of outstanding above must file a written objection that liens that may exist on this property by ON THE AIR Prep baseball includes the reasons for the objection at least contacting the county recorder’s office or a Friday (continued from page 49) two court days before the matter is scheduled title insurance company, either of which may Notices to be heard and must appear at the hearing charge you a fee for this information. If you College women’s lacrosse: Stanford to show cause why the petition should not consult either of these resources, you should at Colorado, 3 p.m., Pac-12 Networks two RBIs in the fourth. be granted. If no written objection is timely be aware that the same lender may hold College baseball: Washington at Yianni Gardner doubled and 995 Fictitious Name filed, the court may grant the petition without more than one mortgage or deed of trust on Stanford, 7 p.m., Pac-12 Networks drove in two runs. Ronan Donnelly Statement a hearing. the property. NOTICE TO PROPERTY OWNER: College softball: Utah at Stanford, 7 NOTICE OF HEARING: July 09, 2019, 8:45 The sale date shown on this notice of sale p.m., Pac-12 Networks added three hits, including a double, STEVE JOKI CUSTOM WOODWORKING a.m., Room: Probate of the Superior Court of may be postponed one or more times by the Saturday and drove in a run. Aidan Macaluso FICTITIOUS BUSINESS NAME STATEMENT California, County of Santa Clara, 191 N. First mortgagee, beneficiary, trustee, or a court, also had two hits and drove in a run. File No.: FBN652132 Street, San Jose, CA 95113. pursuant to Section 2924g of the California College football: Spring Game at The following person (persons) is (are) doing A copy of this ORDER TO SHOW CAUSE shall Civil Code. The law requires that information Stanford , 1 p.m., Pac-12 Networks Ryan Mo, Will Moldow and Ted- business as: be published at least once each week for about trustee sale postponements be made College softball: Utah at Stanford, 3 dy Purcell also drove in runs for the Steve Joki Custom Woodworking, located at four successive weeks prior to the date set available to you and to the public, as a p.m., Pac-12 Plus Live Stream Gators (9-8-1), who welcome San for hearing on the petition in the following courtesy to those not present at the sale. 3650 Louis Rd., Palo Alto, CA 94303, Santa College baseball: Washington at Ramon Valley to Atherton for a 3 newspaper of general circulation, printed in If you wish to learn whether your sale date Clara County. Stanford, 7 p.m., Pac-12 Networks This business is owned by: An Individual. this county: PALO ALTO WEEKLY has been postponed, and, if applicable, p.m. nonleague game Saturday. The name and residence address of the Date: Mar. 13, 2019. the rescheduled time and date for the sale Sunday Palo Alto has been outscored registrant(s) is(are): /s/ Julie A. Emede of this property, you may call FOR SALES College softball: Utah at Stanford, 11-1 in its last two games but has STEVEN GEORGE JOKI JUDGE OF THE SUPERIOR COURT INFORMATION, PLEASE CALL (855)986- noon., Pac-12 Networks (PAW Mar. 22, 29; Apr. 5, 12, 2019) 9342, or visit this Internet Web site www. a pitching staff that can turn things 3650 Louis Rd. College women’s lacrosse: Stanford superiordefault.com using the file number around. Palo Alto, CA 94303 APN: 003-35-097 T.S. No.: 2018-2359 NOTICE at Oregon, 1 p.m., Oregon Live Stream Registrant began transacting business under OF TRUSTEE’S SALE YOU ARE IN DEFAULT assigned to this case 2018-2359. Information Palo Alto is three games back of the fictitious business name(s) listed above on about postponements that are very short College baseball: Washington at UNDER A DEED OF TRUST DATED 10/19/2007. Stanford, 2 p.m., Pac-12 Networks league-leader Los Altos and a half- 02/26/2019. UNLESS YOU TAKE ACTION TO PROTECT YOUR in duration or that occur close in time to game behind Los Gatos. Wilcox This statement was filed with the County the scheduled sale may not immediately Tuesday PROPERTY, IT MAY BE SOLD AT A PUBLIC can overtake the Vikings with a win Clerk-Recorder of Santa Clara County on SALE. IF YOU NEED AN EXPLANATION OF THE be reflected in the telephone information College baseball: UC Davis at Stan- March 5, 2019. NATURE OF THE PROCEEDING AGAINST YOU, or on the Internet Web site. The best way ford, 5 p.m., Stanford Live Stream Friday in Santa Clara. (PAW Mar. 29; Apr. 5, 12, 19, 2019) YOU SHOULD CONTACT A LAWYER. Will sell to verify postponement information is to Aidan Berger ended the Char- attend the scheduled sale. Date: 3/20/2019. Wednesday WAN DA ALL IN ONE PROFESSIONAL SERVICES at a public auction sale to the highest bidder, S.B.S. TRUST DEED NETWORK, A CALIFORNIA Stanford at gers’ no-hit bid with a one-out sin- FICTITIOUS BUSINESS NAME STATEMENT payable at the time of sale inlawful money College women’s golf: CORPORATION. 31194 La Baya Drive, Suite Pac-12 Championships, 2 p.m., Pac-12 gle in the fourth. Matthew Caren File No.: FBN652878 of the United States, by a cashier’s check 106, Westlake Village, California, 91362 The following person (persons) is (are) doing drawn on a state of national bank, check Networks followed with a walk and eventu- drawn by a state or federal credit union, or (818)991-4600. By: Colleen Irby, Trustee Sale Thursday business as: Officer. WE ARE ATTEMPTING TO COLLECT A ally scored the only run on an error. a check drawn by a state or federal savings Stanford at Arizo- Wan Da All In One Professional Services, DEBT, AND ANY INFORMATION WE OBTAIN College softball: Paly, which drew six walks, had located at 1738 N. Milpitas Blvd., Milpitas, CA and loan association, or savings association, na, 6 p.m., Arizona Live Stream 2 or savings bank specified in Section 5102 WILL BE USED FOR THAT PURPOSE. (03/29/19, runners on in all but the second and 95035, Santa Clara County. College baseball: Stanford at Or- of the Financial Code and authorized to do 04/05/19, 04/12/19 TS# 2018-2359 SDI-14429) fifth innings and could not take ad- This business is owned by: An Individual. PAW egon, 7 p.m., Pac-12 Networks The name and residence address of the business in this state will be held by the vantage. Q registrant(s) is(are): duly appointed trustee as shown below, of NOTICE OF PETITION TO ADMINISTER ESTATE QINGFENG LIAO all right, title, and interest conveyed to and OF: 1738 N. Milpitas Blvd. now held by the trustee in the hereinafter ISABEL COSTA Milpitas, CA 95035 described property under and pursuant to a Case No.: 19PR185558 ATHLETES OF THE WEEK Registrant began transacting business under Deed of Trust described below. The sale will To all heirs, beneficiaries, creditors, contingent the fictitious business name(s) listed above on be made, but without covenant or warranty, creditors, and persons who may otherwise 01/01/2019. express or implied, regarding title, possession, be interested in the will or estate, or both, of This statement was filed with the County or encumbrances, to pay the remaining ISABEL COSTA. Clerk-Recorder of Santa Clara County on principal sum of the note(s) secured by the A Petition for Probate has been filed by: March 22, 2019. Deed of Trust, with interest and late charges SCOTT COSTA in the Superior Court of (PAW Mar. 29; Apr. 5, 12, 19, 2019) thereon, as provided in the note(s), advances, California, County of SANTA CLARA. under the terms of the Deed of Trust, interest The Petition for Probate requests that: 997 All Other Legals thereon, fees, charges, and expenses of the SCOTT COSTA be appointed as personal ORDER TO SHOW CAUSE FOR CHANGE OF Trustee for the total amount (at the time of representative to administer the estate of the NAME SUPERIOR COURT OF THE STATE OF the initial publication of the Notice of Sale) decedent. CALIFORNIA FOR THE COUNTY OF SANTA reasonably estimated to be set forth below. The petition requests authority to administer CLARA The amount may be greater on the day of the estate under the Independent Case No.: 19CV345267 sale. Trustor: Benyam Mulugeta and Paula Administration of Estates Act. (This authority TO ALL INTERESTED PERSONS: R.B. Mulugeta Duly Appointed Trustee: S.B.S. will allow the personal representative to Petitioner: DORIS LORRAINE WITMER filed a TRUST DEED NETWORK, A CALIFORNIA take many actions without obtaining court petition with this court for a decree changing CORPORATION Deed of Trust recorded approval. Before taking certain very important 10/24/2007, as Instrument No. 19627632 in actions, however, the personal representative names as follows: book XX, page, XX of Official Records in the will be required to give notice to interested DORIS LORRAINE WITMER aka DORIS office of the Recorder of Santa Clara County, persons unless they have waived notice LORRAINE WITMER HILLEMAN aka LORRAINE California. Date of Sale: 4/18/2019 at 10:00 or consented to the proposed action.) The W. HILLEMAN aka LORRAINE HILLEMAN to AM Place of Sale: AT THE GATED NORTH independent administration authority will LORRAINE WITMER HILLEMAN. MARKET STREET ENTRANCE OF THE SUPERIOR be granted unless an interested person files THE COURT ORDERS that all persons COURTHOUSE, 191 N. FIRST STREET, SAN JOSE, an objection to the petition and shows good interested in this matter appear before this CA Amount of unpaid balance and other cause why the court should not grant the court at the hearing indicated below to show reasonable estimated charges: $372,398.66 authority. cause, if any, why the petition for change of Property being sold “as is- Where is” Street A HEARING on the petition will be held on name should not be granted. Any person Address or other common designation of real June 24, 2019 at 9:00 a.m. in Dept.: 13 of the objecting to the name changes described property: 1025 Harker Avenue, Palo Alto, CA Superior Court of California, County of Santa above must file a written objection that Genna Gibbons Jared Freeman 94301 A.P.N.: 003-35-097. EXHIBIT “A” Legal Clara, located at 191 N. First St., San Jose, CA, includes the reasons for the objection at least SACRED HEART PREP Description Lot 4, as shown upon that certain 95113. GUNN TRACK AND FIELD two court days before the matter is scheduled LACROSSE Map entitled, “Tract No. 5344 in the City of If you object to the granting of the petition, to be heard and must appear at the hearing Palo Alto,” which Map was filed for record in you should appear at the hearing and state The senior had a huge to show cause why the petition should not The sophomore scored the Office of the Recorder of the County of your objections or file written objections with discus throw of 172-0 at be granted. If no written objection is timely Santa Clara, State of California, on February the court before the hearing. Your appearance 13 goals in two West Bay filed, the court may grant the petition without the Arcadia Invitational 16, 1973 in Book 316 of Maps at Page 54. THE may be in person or by your attorney. Athletic League Foothill a hearing. over the weekend to finish BENEFICIARY MAY ELECT, IN ITS DISCRETION, If you are a creditor or a contingent creditor NOTICE OF HEARING: July, 30, 2019, 8:45 Division matches to help TO EXERCISE ITS RIGHTS AND REMEDIES of the decedent, you must file your claim with third in the Invitational a.m., Room: Probate of the Superior Court of the Gators solidify their hold IN ANY MANNER PERMITTED UNDER THE the court and mail a copy to the personal Division. The throw moved California, County of Santa Clara, 191 N. First CALIFORNIA UNIFORM COMMERCIAL CODE, representative appointed by the court within on first place. She scored a Street, San Jose, CA 95113. him into second on Gunn’s OR ANY OTHER APPLICABLE SECTION, AS TO the later of either (1) four months from the career-high seven goals in a A copy of this ORDER TO SHOW CAUSE shall ALL OR SOME OF THE PERSONAL PROPERTY, date of first issuance of letters to a general all-time list. be published at least once each week for win over Mitty. FIXTURES AND OTHER GENERAL TANGIBLES personal representative, as defined in section four successive weeks prior to the date set AND INTANGIBLES MORE PARTICULARY 58 (b) of the California Probate Code, or (2) for hearing on the petition in the following DESCRIBED IN THE DEED OF TRUST, 60 days from the date of mailing or personal newspaper of general circulation, printed in GUARANTEES, UCC’S, SECURITY AGREEMENTS. delivery to you of a notice under section Honorable mention this county: The undersigned Trustee disclaims any liability 9052 of the California Probate Code. Other PALO ALTO WEEKLY for any incorrectness of the street address California statutes and legal authority may Allison Carter Billy Barnds Date: March 27, 2019 or other common designation, if any, shown affect your rights as a creditor. You may want Sacred Heart Prep lacrosse Sacred Heart Prep lacrosse /s/ above. If no street address or other common to consult with an attorney knowledgeable in JUDGE OF THE SUPERIOR COURT designation is shown, directions to the California law. Taylor DeGroff Tommy Barnds (PAW Apr. 5, 12, 19, 26, 2019) location of the property may be obtained by You may examine the file kept by the court. Castilleja lacrosse Sacred Heart Prep lacrosse ORDER TO SHOW CAUSE FOR CHANGE OF sending a written request to the beneficiary If you are a person interested in the estate, Margot Gibbons Julien Hernandez NAME SUPERIOR COURT OF THE STATE OF within 10 days of the date of first publication you may file with the court a Request for Sacred Heart Prep swimming Menlo baseball CALIFORNIA FOR THE COUNTY OF SANTA of this Notice of Sale. NOTICE TO POTENTIAL Special Notice (form DE-154) of the filing of an CLARA BIDDERS: If you are considering bidding on inventory and appraisal of estate assets or of Kaia Li Jack Loftus Case No.: 19CV344361 this property lien, you should understand that any petition or account as provided in Probate Sacred Heart Prep swimming Sacred Heart Prep volleyball TO ALL INTERESTED PERSONS: there are risks involved in bidding at a trustee Code section 1250. A Request for Special Petitioner: MARGARET KREBS CARTER filed a auction. You will be bidding on a lien, not on Notice form is available from the court clerk. Kyra Pretre Justin Nam petition with this court for a decree changing the property itself. Placing the highest bid Attorney for Petitioner: Menlo track and field Menlo baseball names as follows: at a trustee auction does not automatically David J. Lee Charlotte Tomkinson Henry Saul* entitle you to free and clear ownership of the 983 University Ave., Suite 104C A.) MARGARET KREBS CARTER, B.) MARGARET Menlo track and field Palo Alto track and field KREBS-CARTER, C.) MARGARET K. CARTER to property. You should also be aware that the Los Gatos, CA 95032 MARGARET ADELE KREBS. lien being auctioned off may be a junior lien. (408) 356-3000 *Previous winner THE COURT ORDERS that all persons If you are the highest bidder at the auction, (PAW PAW Apr. 12, 19, 26, 2019) Watch video interviews of the Athletes of the Week, go to PASportsOnline.com Page 50 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com Sports Volleyball 17 Gold team, com- Employment CLUB VOLLEYBALL prised almost entirely of local high school juniors, won the American Division title at the Colorado Cross- ENGINEERING. VARIOUS LEVELS OF EXPERIENCE roads Qualifier in Denver to earn Machine Zone, Inc. has the following positions available in Indianapolis bound a bid into the Junior Nationals this A dozen players working together meet their goal summer. Palo Alto, CA: Build Engineer (BEII2): Design and develop Their roster includes six players software application products with a variety of special by Rick Eymer Academy opened the playoffs named to an all-league team in the requirements for multiple software system environments. ou have to be a quick learner with a 25-21, 13-25, 15-9 deci- fall, including Sacred Heart Prep’s Sr. Software Engineer (SSE10): Develop software tools, and have the ability to get sion over Arete 15 Nay Telis and Reagan Smith, Menlo-Atherton’s integrations, and data pipelines utilizing C++, Java, and Y along with people you’d followed that with an even more Natalie Grover, Woodside’s Ele- modern service frameworks. Submit resume by mail to: normally try to beat from the other dramatic victory over OP2 15-1 of na Campbell and Molly Buddie, Machine Zone, Inc., Attn: Global Mobility, 1100 Page Mill Rd., side of the net. Oklahoma, 17-25, 25-23, 15-13. Gunn’s Odeya Russo and Presenta- That’s what a group of 12 fresh- Eventual champion Attack 15 tion’s Andie Valenzuela. Palo Alto, CA 94304. Must reference job title and job code. man girls’ volleyball players, rep- Black ended Academy’s win streak. Just as important are the other six resenting seven local high schools, The team was right back at prac- players, who all contributed to their To place an ad or get a quote, call 650.223.6582 did over the weekend. They set tice the next day in Palo Alto. high school teams: M-A’s Mariah or email [email protected]. aside any school loyalities to merge Former Palo Alto coach Daniele Grover and Bella Shermis, Palo together as a team, of the team and Desiderio heads the coaching staff Alto’s Grace Thayer, Menlo’s Kaila for the team. and was joined by Vladimir Tcher- Ting, Washington Fremont’s Kaeli Many were playing with each nichov and Kai Mashima. Monahan and More San Jose’s Kate other for the first time and turned Last month, the Academy Blackwell. Q the experience into a huge suc- cess, helping Academy Volleyball Marketplace 15-Gold team place third at the ShowMe Qualifier in Kansas City, earning a spot in the USA Division 1SFOUJDF$MFBOJOH4FSWJDFT of the Junior National Champion- ships, which run June 26 through July 6 in Indianapolis. t 3FTJEFOUJBM DPNNFSDJBMBOESFBMUPST Players included Gunn freshman t -JDFOTFE CPOEFEBOEGVMMZJOTVSFE Micaela Leong, Palo Alto freshmen t 'BNJMZPXOFECVTJOFTTGPSPWFSZFBST Thea Enache and Alison Xiong and t %FQFOEBCMFTFSWJDFBUDPNQFUJUJWFSBUFT Menlo School freshmen Jhila Fer- t 5SVTUXPSUIZstaffXJUIFYDFMMFOUSFGFSFODFT dows, Zoe Gregory, Alli McKenney t 0VSXPSLJTHVBSBOUFFE and Sharon Nejad, who helped the Knights girls basketball team win a ]XXXQSFOUJDFDMFBOJOHDPN state title last month, Menlo-Ather- ton’s Kate Hansen, Merritt Olson, Woodside’s Erin Davis, Home- To place an ad or get a quote, contact Nico Navarrete stead’s Dalia Querenet De Breville Photo courtesy of Academy volleyball at 650.223.6582 or email [email protected]. and St. Francis’ Lauren Squires. Academy Volleyball 15-Gold is headed to the Junior Nationals. Across “Normcore” — parse that carefully. Matt Jones This week’s SUDOKU 1 “Weekend Update” co-anchor Colin 5 Barry Manilow’s club 9 Cold shoulders 14 Apiece 15 “Chocolat” actress Lena 16 Records, informally 17 Lucy’s neighbor with a nasty attitude? 19 Rico, to Napoleon Dynamite 20 Lover of suffixes? 21 “___ I Believe” (2018 song by Clean Bandit) 23 ___ de vivre 24 “It sucks being a young horse,” e.g.? 27 Sweat equity concept 29 “Hotel California” band 30 Big scallion 31 In actuality 35 “La ___” (Debussy composition) 36 NPR host Shapiro 37 Color in a Patriots uniform 40 10,000 square meters 44 All-night party 45 Like a venomous snake 48 Room for negotiation 50 Studs and labrets that are a bargain? Answers on page 33. Answers on page 33. www.sudoku.name 54 Pioneer Boone, folksily 2 Promising words 43 Director Roth 55 Hand sanitizer additive 22 Work on ___ 3 Claudia once married to David Copperfield 44 Passes on a present 56 Actress Lawrence of “The Cool Kids” 25 Inc., in Australia 4 Roxette hit of 1989 45 Fester’s family 59 Bush Supreme Court appointee 26 Back muscle 5 Dot-___ bubble 46 Mariner’s set of rules 61 Completely stocked with enemies? 27 Nightmare street of film 6 Acid used in soapmaking 47 Pressed sandwiches 63 Hands, in Spanish 28 Greens ___ 7 “Shine” instrument 49 Be covetous of 64 Small spot of land 32 Have a picnic, e.g. 8 Per ___ (yearly) 51 Like some D&D characters 65 It may have rings and needles 33 Monk’s title 9 “Law & Order: ___” (spinoff that will break a 52 Awaken 66 Dating app motion 34 Mattress filler record for longevity) 53 Honeycomb components 67 Falcons’ home? 37 Unadjusted stat 10 Lego series with its own 2017 movie 57 On an even ___ 68 “Gone Girl” actress Ward 38 Actress Longoria 11 Straighten, as a hose 39 “Who ___” (Cincinnati Bengals chant) 58 Piece of mind? 12 Writing credit 40 Natural vantage point 60 Sugar suffix Down 13 Comes down in icy drops 41 Thought transference 62 Rent out 1 Humvee forerunner 18 Shakespearean king 42 Pet you water ©2019 Jonesin’ Crosswords ([email protected]) www.PaloAltoOnline.com • Palo Alto Weekly • April 12, 2019 • Page 51 OPEN HOUSE Sunday 2–4pm Prime West Menlo Park 2190 Avy Avenue Menlo Park Offered at $3,725,000 4 Beds · 3.5 Baths Home ±2,600 sf Lot ±6,000 sf 2190Avy.com Noelle Queen & Michael Dreyfus College Terrace 2015 Amherst Street Palo Alto Offered at $3,495,000 3 Beds · 2 Baths Home ±1,485 sf Lot ±11,122 sf 2015Amherst.com Noelle Queen & Michael Dreyfus The Dreyfus Group · 650.485.3476 · Lic. #01121795 Visit dreyfus.group for more listings 728 Emerson Street, Palo Alto, CA 94301 · Each Office is Independently Owned and Operated. Page 52 • April 12, 2019 • Palo Alto Weekly • www.PaloAltoOnline.com