APOF Monoclonal Antibody (M02), Clone 1D5

Total Page：16

File Type：pdf, Size：1020Kb

APOF monoclonal antibody (M02), clone 1D5 Catalog # : H00000319-M02 規格 : [ 100 ug ] List All Specification Application Image Product Mouse monoclonal antibody raised against a full-length recombinant Western Blot (Transfected lysate) Description: APOF. Immunogen: APOF (AAH26257, 37 a.a. ~ 327 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: TSYGKQTNVLMHFPLSLESQTPSSDPLSCQFLHPKSLPGFSHMAPLPKF LVSLALRNDALEEAGCQADVWALQLQLYRQGGVNATQVLIQHLRGLQK GRSTERNVSVEALASALQLLAREQQSTGRVGRSLPTEDCENEKEQAVH enlarge NVVQLLPGVGTFYNLGTALYYATQNCLGKARERGRDGAIDLGYDLLMT Western Blot (Recombinant MAGMSGGPMGLAISAALKPALRSGVQQLIQYYQDQKDANISQPETTKEG protein) LRAISDVSDLEETTTLASFISEVVSSAPYWGWAIIKSYDLDPGAGSLEI Immunohistochemistry Host: Mouse (Formalin/PFA-fixed paraffin- embedded sections) Reactivity: Human Isotype: IgG2b Kappa Quality Control Antibody Reactive Against Recombinant Protein. Testing: enlarge Sandwich ELISA (Recombinant protein) enlarge ELISA Western Blot detection against Immunogen (57.64 KDa) . Storage Buffer: In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: MSDS: Download Datasheet: Download Applications Western Blot (Transfected lysate) Page 1 of 3 2016/5/20 Western Blot analysis of APOF expression in transfected 293T cell line by APOF monoclonal antibody (M02), clone 1D5. Lane 1: APOF transfected lysate(35.4 KDa). Lane 2: Non-transfected lysate. Protocol Download Western Blot (Recombinant protein) Protocol Download Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlarge this image Immunoperoxidase of monoclonal antibody to APOF on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] Protocol Download Sandwich ELISA (Recombinant protein) Detection limit for recombinant GST tagged APOF is 0.1 ng/ml as a capture antibody. Protocol Download ELISA Gene Information Entrez GeneID: 319 GeneBank BC026257 Accession#: Protein AAH26257 Accession#: Page 2 of 3 2016/5/20 Gene Name: APOF Gene Alias: Apo-F,DKFZp781G18150,LTIP,MGC22520 Gene apolipoprotein F Description: Omim ID: 107760 Gene Ontology: Hyperlink Gene Summary: The product of this gene is one of the minor apolipoproteins found in plasma. This protein forms complexes with lipoproteins and may be involved in transport and/or esterification of cholesterol. [provided by RefSeq Other - Designations: Related Disease Alzheimer Disease Alzheimer disease Coronary Artery Disease Genetic Predisposition to Disease Hepatitis C Hypercholesterolemia 服務條款 | 隱私權政策 | 著作及商標 | 網站地圖 ©2016 亞諾法生技股份有限公司 Abnova Corporation. 版權所有. Page 3 of 3 2016/5/20.

Copy Link

Recommended publications

The Expression of the Human Apolipoprotein Genes and Their Regulation by Ppars
CORE Metadata, citation and similar papers at core.ac.uk Provided by UEF Electronic Publications The expression of the human apolipoprotein genes and their regulation by PPARs Juuso Uski M.Sc. Thesis Biochemistry Department of Biosciences University of Kuopio June 2008 Abstract The expression of the human apolipoprotein genes and their regulation by PPARs. UNIVERSITY OF KUOPIO, the Faculty of Natural and Environmental Sciences, Curriculum of Biochemistry USKI Juuso Oskari Thesis for Master of Science degree Supervisors Prof. Carsten Carlberg, Ph.D. Merja Heinäniemi, Ph.D. June 2008 Keywords: nuclear receptors; peroxisome proliferator-activated receptor; PPAR response element; apolipoprotein; lipid metabolism; high density lipoprotein; low density lipoprotein. Lipids are any fat-soluble, naturally-occurring molecules and one of their main biological functions is energy storage. Lipoproteins carry hydrophobic lipids in the water and salt-based blood environment for processing and energy supply in liver and other organs. In this study, the genomic area around the apolipoprotein genes was scanned in silico for PPAR response elements (PPREs) using the in vitro data-based computer program. Several new putative REs were found in surroundings of multiple lipoprotein genes. The responsiveness of those apolipoprotein genes to the PPAR ligands GW501516, rosiglitazone and GW7647 in the HepG2, HEK293 and THP-1 cell lines were tested with real-time PCR. The APOA1, APOA2, APOB, APOD, APOE, APOF, APOL1, APOL3, APOL5 and APOL6 genes were found to be regulated by PPARs in direct or secondary manners. Those results provide new insights in the understanding of lipid metabolism and so many lifestyle diseases like atherosclerosis, type 2 diabetes, heart disease and stroke.
[Show full text]
The Role of High Density Lipoprotein Compositional and Functional Heterogeneity in Metabolic Disease
The role of high density lipoprotein compositional and functional heterogeneity in metabolic disease By Scott M. Gordon B.S. State University of New York College at Brockport October, 2012 A Dissertation Presented to the Faculty of The University of Cincinnati College of Medicine in partial fulfillment of the requirements for the Degree of Doctor of Philosophy from the Pathobiology and Molecular Medicine graduate program W. Sean Davidson Ph.D. (Chair) David Askew Ph.D. Professor and Thesis Chair Professor Department of Pathology Department of Pathology University of Cincinnati University of Cincinnati Francis McCormack M.D. Gangani Silva Ph.D. Professor Assistant Professor Department of Pathology Department of Pathology University of Cincinnati University of Cincinnati Jason Lu Ph.D. Assistant Professor Division of Bioinformatics Cincinnati Children’s Hospital i Abstract High density lipoproteins (HDL) are complexes of phospholipid, cholesterol and protein that circulate in the blood. Epidemiological studies have demonstrated a strong inverse correlation between plasma levels of HDL associated cholesterol (HDL-C) and the incidence of cardiovascular disease (CVD). Clinically, HDL-C is often measured and used in combination with low density lipoprotein cholesterol (LDL-C) to assess overall cardiovascular health. HDL have been shown to possess a wide variety of functional attributes which likely contribute to this protection including anti-inflammatory and anti- oxidative properties and the ability to remove excess cholesterol from peripheral tissues and deliver it to the liver for excretion, a process known as reverse cholesterol transport. This functional diversity might be explained by the complexity of HDL composition. Recent studies have taken advantage of advances in mass spectrometry technologies to characterize the proteome of total HDL finding that over 50 different proteins can associate with these particles.
[Show full text]
Supplementary Materials
Supplementary materials Supplementary Table S1: MGNC compound library Ingredien Molecule Caco- Mol ID MW AlogP OB (%) BBB DL FASA- HL t Name Name 2 shengdi MOL012254 campesterol 400.8 7.63 37.58 1.34 0.98 0.7 0.21 20.2 shengdi MOL000519 coniferin 314.4 3.16 31.11 0.42 -0.2 0.3 0.27 74.6 beta- shengdi MOL000359 414.8 8.08 36.91 1.32 0.99 0.8 0.23 20.2 sitosterol pachymic shengdi MOL000289 528.9 6.54 33.63 0.1 -0.6 0.8 0 9.27 acid Poricoic acid shengdi MOL000291 484.7 5.64 30.52 -0.08 -0.9 0.8 0 8.67 B Chrysanthem shengdi MOL004492 585 8.24 38.72 0.51 -1 0.6 0.3 17.5 axanthin 20- shengdi MOL011455 Hexadecano 418.6 1.91 32.7 -0.24 -0.4 0.7 0.29 104 ylingenol huanglian MOL001454 berberine 336.4 3.45 36.86 1.24 0.57 0.8 0.19 6.57 huanglian MOL013352 Obacunone 454.6 2.68 43.29 0.01 -0.4 0.8 0.31 -13 huanglian MOL002894 berberrubine 322.4 3.2 35.74 1.07 0.17 0.7 0.24 6.46 huanglian MOL002897 epiberberine 336.4 3.45 43.09 1.17 0.4 0.8 0.19 6.1 huanglian MOL002903 (R)-Canadine 339.4 3.4 55.37 1.04 0.57 0.8 0.2 6.41 huanglian MOL002904 Berlambine 351.4 2.49 36.68 0.97 0.17 0.8 0.28 7.33 Corchorosid huanglian MOL002907 404.6 1.34 105 -0.91 -1.3 0.8 0.29 6.68 e A_qt Magnogrand huanglian MOL000622 266.4 1.18 63.71 0.02 -0.2 0.2 0.3 3.17 iolide huanglian MOL000762 Palmidin A 510.5 4.52 35.36 -0.38 -1.5 0.7 0.39 33.2 huanglian MOL000785 palmatine 352.4 3.65 64.6 1.33 0.37 0.7 0.13 2.25 huanglian MOL000098 quercetin 302.3 1.5 46.43 0.05 -0.8 0.3 0.38 14.4 huanglian MOL001458 coptisine 320.3 3.25 30.67 1.21 0.32 0.9 0.26 9.33 huanglian MOL002668 Worenine
[Show full text]
Identification and Prioritization Genes
Original Article 2015, Vol: 3, Issue: 1, Pages: 18-23 Bioinformatics useful tool in study of genes associated with diseases Research in Molecular Medicine DOI: 10.7508/rmm.2015.01.004 Identifying and prioritizing genes related to Familial hypercholesterolemia QTLs using gene ontology and protein interaction networks Ali Kazemi-Pour 1, Bahram Goliaei 2*, Hamid Pezeshk 3, Behjat Kalantari khandani 4 1 PhD student of Institute of Biochemistry and Biophysics, University of Tehran, Tehran, Iran. 2 Professor of Institute of Biochemistry and Biophysics, University of Tehran, Tehran, Iran. 3 Professor of statistics, Science College, University of Tehran, Tehran, Iran. 4 Assistant Professor of Internal Medicine, Kerman University of Medical Sciences, Kerman, Iran. Received: 17 Aug 2014 Abstract Revised : 4 Sep 2014 Background: Gene identification represents the first step to a better understanding of the physiological role of the underlying protein and disease Accepted: 10 Sep 2014 pathways, which in turn serves as a starting point for developing therapeutic interventions. Familial hypercholesterolemia is a hereditary metabolic disorder Corresponding Authors: Bahram Goliaei characterized by high low-density lipoprotein cholesterol levels. Institute of Biochemistry and Hypercholesterolemia is a quantitative trait that is controlled by interactions Biophysics, University of Tehran, among several quantitative trait loci. Many biological data is presented in the Tehran, Iran. context of biological networks and evaluation of biological networks is considered Phone: +98-2161113356 E-mail: [email protected] as the essential key to understanding complex biological systems. Materials and Methods: In this research, we used combination of information about quantitative trait loci of hypercholesterolemia with information of gene ontology and protein–protein interaction network for identification of genes associated with hypercholesterolemia.
[Show full text]
Identification of Key Genes Affecting Porcine Fat Deposition Based on Co
Xing et al. Journal of Animal Science and Biotechnology (2021) 12:100 https://doi.org/10.1186/s40104-021-00616-9 RESEARCH Open Access Identification of key genes affecting porcine fat deposition based on co- expression network analysis of weighted genes Kai Xing1†, Huatao Liu2†, Fengxia Zhang2, Yibing Liu2, Yong Shi2, Xiangdong Ding2* and Chuduan Wang2* Abstract Background: Fat deposition is an important economic consideration in pig production. The amount of fat deposition in pigs seriously affects production efficiency, quality, and reproductive performance, while also affecting consumers’ choice of pork. Weighted gene co-expression network analysis (WGCNA) is effective in pig genetic studies. Therefore, this study aimed to identify modules that co-express genes associated with fat deposition in pigs (Songliao black and Landrace breeds) with extreme levels of backfat (high and low) and to identify the core genes in each of these modules. Results: We used RNA sequences generated in different pig tissues to construct a gene expression matrix consisting of 12,862 genes from 36 samples. Eleven co-expression modules were identified using WGCNA and the number of genes in these modules ranged from 39 to 3,363. Four co-expression modules were significantly correlated with backfat thickness. A total of 16 genes (RAD9A, IGF2R, SCAP, TCAP, SMYD1, PFKM, DGAT1, GPS2, IGF1, MAPK8, FABP, FABP5, LEPR, UCP3, APOF, and FASN) were associated with fat deposition. Conclusions: RAD9A, TCAP, SMYD1, PFKM, GPS2, and APOF were the key genes in the four modules based on the degree of gene connectivity. Combining these results with those from differential gene analysis, SMYD1 and PFKM were proposed as strong candidate genes for body size traits.
[Show full text]
Biostatistics Mining Associated Method Identifies AKR1B10
www.nature.com/scientificreports OPEN Biostatistics mining associated method identifes AKR1B10 enhancing hepatocellular Received: 26 February 2018 Accepted: 25 June 2018 carcinoma cell growth and Published: xx xx xxxx degenerated by miR-383-5p Junqing Wang 1,2,3, Yunyun Zhou4, Xiaochun Fei5, Xuehua Chen2,3 & Yongjun Chen1 Previous studies have reported that the aberrantly expressed AKR1B10 is associated with many cancer development, however the functional roles of AKR1B10 and its regulatory mechanisms in hepatocellular carcinoma (HCC) have been limited studied. In this project, we identifed AKR1B10 functional as an oncogene in HCC through tumor/normal human tissue comparison from both GEO microarray and TCGA RNAseq dataset. Further experimental validations from three HCC cell lines (SMMC-7721, HePG2 and HeP3B) also suggested the ontogenetic functions of AKR1B10 in HCC tumor growth. By knocking down AKR1B10 through shRNA in HCC HeP3B cells, we showed it signifcantly induced cell cycle arrest and inhibited cell growth. Interestingly, integrative analysis of TCGA RNAseq data and miRNA-seq data predicted that miR-383-5p, a novel post-transcriptional tumor suppressor, is negatively associated with AKR1B10 expression. To further investigate the role of miR-383-5p in regulating AKR1B10 in HCC, we performed Dual-luciferase reporter assay experiments. Results showed that miR-383-5p is an upstream modulator targeting AKR1B10 in the post-transcriptional stage. Thus, we report AKR1B10 modulated regulated by miR-383-5p, promotes HCC tumor progress, and could be potentially a therapeutic target for precision medicine in HCC. World widely, hepatocellular carcinoma (HCC) presents a high incidence rate among human malignancies, rank- ing a ffh of morbidity and second of malignancy-related mortality1,2.
[Show full text]
WO 2014/205555 Al 31 December 2014 (31.12.2014) P O P C T
(12) INTERNATIONAL APPLICATION PUBLISHED UNDER THE PATENT COOPERATION TREATY (PCT) (19) World Intellectual Property Organization International Bureau (10) International Publication Number (43) International Publication Date WO 2014/205555 Al 31 December 2014 (31.12.2014) P O P C T (51) International Patent Classification: British Columbia V5Y 2G1 (CA). WATAHIKI, Akira; A61K 31/713 (2006.01) G01N 33/48 (2006.01) 15-5 Takakura-cho, Nishinomiya, 62-0872 (JP). LIU, Hui A61K 31/7088 (2006.01) G01N 33/50 (2006.01) Hsuan; 207 - 5770 Oak Street, Vancouver, British A61P 35/00 (2006.01) CI2N 15/113 (2010.01) Columbia V6M 4M5 (CA). PAROLIA, Abhijit; 505 C12Q 1/68 (2006.01) Mumfordganj, 2 11002 Allahabad U.P. (IN). (21) International Application Number: (74) Agents: SECHLEY, Konrad et al; Gowling Lafleur PCT/CA2014/000538 Henderson LLP, 2300, 550 Burrard Street, Vancouver, British Columbia V6C 2B5 (CA). (22) International Filing Date: 27 June 2014 (27.06.2014) (81) Designated States (unless otherwise indicated, for every kind of national protection available): AE, AG, AL, AM, (25) Filing Language: English AO, AT, AU, AZ, BA, BB, BG, BH, BN, BR, BW, BY, (26) Publication Language: English BZ, CA, CH, CL, CN, CO, CR, CU, CZ, DE, DK, DM, DO, DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, (30) Priority Data: HN, HR, HU, ID, IL, IN, IR, IS, JP, KE, KG, KN, KP, KR, 61/841,225 28 June 2013 (28.06.2013) US KZ, LA, LC, LK, LR, LS, LT, LU, LY, MA, MD, ME, (71) Applicant: BRITISH COLUMBIA CANCER AGENCY MG, MK, MN, MW, MX, MY, MZ, NA, NG, NI, NO, NZ, BRANCH [CA/CA]; 675 West 10th Avenue, Vancouver, OM, PA, PE, PG, PH, PL, PT, QA, RO, RS, RU, RW, SA, British Columbia V5Z 1L3 (CA).
[Show full text]
1 Gene Networks and Pathways for Plasma Lipid Traits Via Multi-Tissue
bioRxiv preprint doi: https://doi.org/10.1101/2020.02.28.970368; this version posted December 21, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. Gene Networks and Pathways for Plasma Lipid Traits via Multi-tissue Multi-omics Systems Analysis Montgomery Blencowe+a, b, In Sook Ahn+a, Zara Saleema, Helen Luka, Ingrid Celya, Ville-Petteri Mäkinena, c, Yuqi Zhaoa*, Xia Yang a, b, d* a Department of Integrative Biology and Physiology, University of California, Los Angeles, 610 Charles E. Young Drive East, Los Angeles, CA 90095, USA b Molecular, Cellular, and Integrative Physiology Interdepartmental Program, University of California, Los Angeles, 610 Charles E. Young Drive East, Los Angeles, CA 90095, USA c South Australian Health and Medical Research Institute, Adelaide, Australia dInterdepartmental Program of Bioinformatics, University of California, Los Angeles, 610 Charles E. Young Drive East, Los Angeles, CA 90095, USA + co-first author * Correspondence should be addressed to: Xia Yang, Ph.D. Department of Integrative Biology and Physiology University of California Los Angeles Los Angeles, CA 90095 Phone: 310-206-1812 Email: [email protected] Yuqi Zhao, Ph.D. Department of Integrative Biology and Physiology University of California Los Angeles Los Angeles, CA 90095 Phone: 310-206-1812 Email: [email protected] Running Title: Systems Regulation of Plasma Lipids 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.02.28.970368; this version posted December 21, 2020.
[Show full text]
APOF Antibody (Center) Affinity Purified Rabbit Polyclonal Antibody (Pab) Catalog # Ap10107c
10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 APOF Antibody (Center) Affinity Purified Rabbit Polyclonal Antibody (Pab) Catalog # AP10107c Specification APOF Antibody (Center) - Product Information Application WB, IHC-P,E Primary Accession Q13790 Other Accession NP_001629.1 Reactivity Human Host Rabbit Clonality Polyclonal Isotype Rabbit Ig Calculated MW 35399 Antigen Region 111-138 APOF Antibody (Center) - Additional Information Gene ID 319 Other Names Apolipoprotein F, Apo-F, Lipid transfer Anti-APOF Antibody (Center) at 1:1000 inhibitor protein, LTIP, APOF dilution + human liver lysate Lysates/proteins at 20 µg per lane. Secondary Goat Target/Specificity Anti-Rabbit IgG, (H+L), Peroxidase This APOF antibody is generated from conjugated at 1/10000 dilution. Predicted rabbits immunized with a KLH conjugated band size : 35 kDa Blocking/Dilution buffer: synthetic peptide between 111-138 amino 5% NFDM/TBST. acids from the Central region of human APOF. Dilution WB~~1:1000 IHC-P~~1:10~50 Format Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. This antibody is purified through a protein A column, followed by peptide affinity purification. Storage Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. APOF antibody (Center) (Cat. #AP10107c) Precautions immunohistochemistry analysis in formalin APOF Antibody (Center) is for research use fixed and paraffin embedded human only and not for use in diagnostic or hepatocarcinoma followed by peroxidase Page 1/2 10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 therapeutic procedures.
[Show full text]
Transcriptome Analysis of Targeted Mouse Mutations Reveals the Topography of Local Changes in Gene Expression
RESEARCH ARTICLE Transcriptome Analysis of Targeted Mouse Mutations Reveals the Topography of Local Changes in Gene Expression David B. West1☯*, Eric K. Engelhard2☯, Michael Adkisson1, A. J. Nava1, Julia V. Kirov1, Andreanna Cipollone2, Brandon Willis2, Jared Rapp2, Pieter J. de Jong1, Kent C. Lloyd2 1 Children’s Hospital Oakland Research Institute (CHORI), Oakland, California, United States of America, 2 Mouse Biology Program, University of California, Davis, California, United States of America ☯ These authors contributed equally to this work. * [email protected] Abstract The unintended consequences of gene targeting in mouse models have not been thor- OPEN ACCESS oughly studied and a more systematic analysis is needed to understand the frequency and Citation: West DB, Engelhard EK, Adkisson M, Nava characteristics of off-target effects. Using RNA-seq, we evaluated targeted and neighboring AJ, Kirov JV, Cipollone A, et al. (2016) Transcriptome gene expression in tissues from 44 homozygous mutants compared with C57BL/6N control Analysis of Targeted Mouse Mutations Reveals the Topography of Local Changes in Gene Expression. mice. Two allele types were evaluated: 15 targeted trap mutations (TRAP); and 29 deletion PLoS Genet 12(2): e1005691. doi:10.1371/journal. alleles (DEL), usually a deletion between the translational start and the 3’ UTR. Both target- pgen.1005691 ing strategies insert a bacterial beta-galactosidase reporter (LacZ) and a neomycin resis- Editor: Jonathan Flint, The Wellcome Trust Centre tance selection cassette. Evaluating transcription of genes in +/- 500 kb of flanking DNA for Human Genetics, University of Oxford, UNITED around the targeted gene, we found up-regulated genes more frequently around DEL com- KINGDOM pared with TRAP alleles, however the frequency of alleles with local down-regulated genes Received: October 17, 2014 flanking DEL and TRAP targets was similar.
[Show full text]
The Effects of Apolipoprotein F Deficiency on High Density Lipoprotein Cholesterol Metabolism in Mice
The Effects of Apolipoprotein F Deficiency on High Density Lipoprotein Cholesterol Metabolism in Mice William R. Lagor1*, David W. Fields1, Sumeet A. Khetarpal1, Arthi Kumaravel1, Wen Lin1, Nathaniel Weintraub1, Kaijin Wu2, Sarah F. Hamm-Alvarez2, Denise Drazul-Schrader3, Margarita de la Llera-Moya3, George H. Rothblat3, Daniel J. Rader1 1 Division of Translational Medicine and Human Genetics, Institute for Translational Medicine and Therapeutics, Perelman School of Medicine, University of Pennsylvania, Philadelphia, Pennsylvania, United States of America, 2 Department of Pharmacology and Pharmaceutical Sciences, University of Southern California, Los Angeles, California, United States of America, 3 Division of Gastroenterology, Hepatology and Nutrition, The Children’s Hospital of Philadelphia, Philadelphia, Pennsylvania, United States of America Abstract Apolipoprotein F (apoF) is 29 kilodalton secreted sialoglycoprotein that resides on the HDL and LDL fractions of human plasma. Human ApoF is also known as Lipid Transfer Inhibitor protein (LTIP) based on its ability to inhibit cholesteryl ester transfer protein (CETP)-mediated transfer events between lipoproteins. In contrast to other apolipoproteins, ApoF is predicted to lack strong amphipathic alpha helices and its true physiological function remains unknown. We previously showed that overexpression of Apolipoprotein F in mice reduced HDL cholesterol levels by 20–25% by accelerating clearance from the circulation. In order to investigate the effect of physiological levels of ApoF expression on HDL cholesterol metabolism, we generated ApoF deficient mice. Unexpectedly, deletion of ApoF had no substantial impact on plasma lipid concentrations, HDL size, lipid or protein composition. Sex-specific differences were observed in hepatic cholesterol content as well as serum cholesterol efflux capacity. Female ApoF KO mice had increased liver cholesteryl ester content relative to wild type controls on a chow diet (KO: 3.4+/20.9 mg/dl vs.
[Show full text]
Theranostics Circulating Proteomic Panels for Diagnosis and Risk
Theranostics 2019, Vol. 9, Issue 4 1200 Ivyspring International Publisher Theranostics 2019; 9(4): 1200-1214. doi: 10.7150/thno.31991 Research Paper Circulating proteomic panels for diagnosis and risk stratification of acute-on-chronic liver failure in patients with viral hepatitis B Zeyu Sun1*, Xiaoli Liu1*, Daxian Wu1*, Hainv Gao2, Jing Jiang1, Ying Yang1, Jie Wu1, Qikang Gao3, Jie Wang1, Zhengyi Jiang1, Youping Xu3, Xiao Xu4,5,6 & Lanjuan Li1 1. State Key Laboratory for Diagnosis and Treatment of Infectious Diseases, Collaborative Innovation Center for Diagnosis and Treatment of Infectious Diseases, The First Affiliated Hospital, College of Medicine, Zhejiang University, 310003 Hangzhou, People's Republic of China 2. Department of Infectious Diseases, Zhejiang University International Hospital, 310004 Hangzhou, People’s Republic of China 3. Bio-Macromolecules Analysis Laboratory of Analysis Center of Agrobiology and Environmental Sciences, Zhejiang University, 310058 Hangzhou, People's Republic of China 4. Division of Hepatobiliary and Pancreatic Surgery, Department of Surgery, The First Affiliated Hospital, College of Medicine, Zhejiang University, 310003 Hangzhou, People's Republic of China 5. Key Laboratory of Combined Multi-Organ Transplantation, Ministry of Public Health, The First Affiliated Hospital, College of Medicine, Zhejiang University, 310003 Hangzhou, People's Republic of China 6. Key Laboratory of Organ Transplantation, The First Affiliated Hospital, College of Medicine, Zhejiang University, 310003 Hangzhou, People's Republic of China *These authors contributed equally: Zeyu Sun, Xiaoli Liu, Daxian Wu. Corresponding author: Lanjuan Li, State Key Laboratory for Diagnosis and Treatment of Infectious Diseases, The First Affiliated Hospital, School of Medicine, Zhejiang University. #79 Qingchun Road, Hangzhou, China.
[Show full text]