Produktinformation
Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien
Weitere Information auf den folgenden Seiten! See the following pages for more information!
Lieferung & Zahlungsart
Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic TREM1 (Human) Recombinant stimulated through a variety of receptors, including G Protein (P01) protein-linked 7-transmembrane receptors (e.g., FPR1; MIM 136537), Fc receptors (see MIM 146790), CD14 Catalog Number: H00054210-P01 (MIM 158120) and Toll-like receptors (e.g., TLR4; MIM 603030), and cytokine receptors (e.g., IFNGR1; MIM Regulation Status: For research use only (RUO) 107470). Engagement of these receptors can also prime myeloid cells to respond to other stimuli. Myeloid cells Product Description: Human TREM1 full-length ORF ( express receptors belonging to the Ig superfamily, such AAH17773.1, 21 a.a. - 234 a.a.) recombinant protein as TREM1, or to the C-type lectin superfamily. with GST-tag at N-terminal. Depending on their transmembrane and cytoplasmic sequence structure, these receptors have either Sequence: activating (e.g., KIR2DS1; MIM 604952) or inhibitory ATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQII functions (e.g., KIR2DL1; MIM 604936).[supplied by RDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGL OMIM] LRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLV VTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPR References: TVTQAPPKSTADVSTPDSEINLTNVTDIIRVPVFNIVILLA 1. Development of Immunosensors for Direct Detection GGFLSKSLVFSVLFAVTLRSFVP of Three Wound Infection Biomarkers at Point of Care using Electrochemical Impedance Spectroscopy. Ciani I, Host: Wheat Germ (in vitro) Schulze H, Corrigan DK, Henihan G, Giraud G, Terry JG, Walton AJ, Pethig R, Ghazal P, Crain J, Campbell Theoretical MW (kDa): 49.28 CJ, Bachmann TT, Mount AR. Biosens Bioelectron. 2011 Nov 15. Applications: AP, Array, ELISA, WB-Re 2. Expression and function of triggering receptor (See our web site product page for detailed applications expressed on myeloid cells-1 (TREM-1) on canine information) neutrophils. Li J, Birkenheuer AJ, Marr HS, Levy MG, Protocols: See our web site at Yoder JA, Nordone SK. Dev Comp Immunol. 2011 Apr http://www.abnova.com/support/protocols.asp or product 28. [Epub ahead of print] page for detailed protocols
Preparation Method: in vitro wheat germ expression system
Purification: Glutathione Sepharose 4 Fast Flow
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Entrez GeneID: 54210
Gene Symbol: TREM1
Gene Alias: TREM-1
Gene Summary: Monocyte/macrophage- and neutrophil-mediated inflammatory responses can be
Page 1/1
Powered by TCPDF (www.tcpdf.org)