Operator's Manual

Operator’s Manual

Model 120000 Model 200000 Power Built 825/850/875/900 Series Power Built 1350/1450 Series Intek I/C 825/850/875/900 Series Intek I/C 1350/1450 Series I/C 825/850/875 Series I/C 1450 Series

Model 150000 Model 210000 Power Built 1100/1125 Series Power Built 1500/1575 Series Intek I/C 1500/1575 Series

ECopyright Briggs & Stratton Corporation Form No. 277040-3/07 BRIGGSandSTRATTON.com Milwaukee, Wisconsin 53201 U.S.A. Printed in U.S.A. Thank You for purchasing this quality-built Briggs & Stratton engine. We’re pleased that you’ve placed your confidence in the Briggs & Stratton brand. When operated and maintained according to the instructions in this manual, your Briggs & Stratton product will provide many years of dependable service.

This manual contains safety information to make you aware of the hazards and risks associated with engines and how to avoid them. It also contains instructions for the proper use and care of the engine. Because Briggs & Stratton Corporation does not necessarily know what equipment this engine will power, it is important that you read and understand these instructions and the instructions for the equipment this engine powers.

Where to Find Us You never have to look far to find Briggs & Stratton Support and service for your engine. Consult your Yellow Pages™ under “Engines-Gasoline”, “Gasoline-Engines”, “Lawn Mowers” or similar categories. There are over 30,000 Briggs & Stratton authorized service dealers worldwide who provide quality service. You can also contact Briggs & Stratton Customer Service by phone at (800) 233-3723. Additional information can be found on the Internet at www.BRIGGSandSTRATTON.com.

For replacement parts or technical assistance, record below the engine model, type, and code numbers along with the date of purchase. These numbers are located on your engine (see the “Features” page).

Date of purchase: MM/DD/YYYY

Engine model: Model:Type: Code:

Briggs & Stratton Corporation P.O. Box 702 Milwaukee, WI, 53201-0702

Briggs & Stratton is a trademark of Copyright E 2006 Briggs & Stratton Corporation, Briggs & Stratton Corporation Milwaukee, WI, USA. All rights reserved. Printed in U.S.A. Milwaukee, WI, USA. Safety Features Operation Maintenance Trouble shooting Specifications Warranties 1 ...... Table of Contents ...... Engine WarrantyEmissions Control System Warranty Statement 19 18 Power Ratings 17 Maintenance Chart 10 Inspect Muffler And Spark ArresterHow To Change The Gear Reduction Oil 11 14 Oil RecommendationCheck/Add OilAdd FuelHow To Start The EngineHow To Service The Air Filter 6 6 8 7 13 Symbols And WarningsFuel RecommendationsHow To Stop The EngineCarburetor AdjustmentValve ClearanceSpark 2 PlugHow To Change The OilHow To Replace The Fuel FilterClean Air Cooling SystemStorage (over 30 7 days) 9 11 11 12 14 11 15 15 Warranties 18 TroubleshootingSpecifications 16 17 Maintenance 10 FeaturesOperation 5 6 Safety 2 Safety aadsmo a eue orpeettetp of type the represent to used be hazard. addition, may In injury. symbol the of hazard indicate severity a to potential symbol the alert and the likelihood with used or is WARNING, CAUTION) (DANGER, personal word in signal result A can injury. that hazards about information h aeyaetsymbol alert safety The Warnings And Symbols Safety 2 acr it eet,o te erdcieharm. reproductive other cause or to defects, California birth of cancer, State the to contains known product chemicals this from exhaust engine The eiu nuy(nldn aayi) ree death. even or paralysis), (including damage, injury property serious in in result engines could these applications of such Use events. competitive for in intended use vehicles or products aircraft go-karts, Terrain fun/recreational All bikes, 3-wheel motor (ATVs), on Vehicles engines these authorize of or use approve the not does Stratton & Briggs niewl edmgdbyn earadwl not warranty. will under and covered repair the be beyond oil, damaged without be engine will the engine start you Stratton If & oil. Briggs without from shipped is engine This ndmg oteproduct. the to damage in that situation a indicates symbol, injury. avoided, injury. avoided, CAUTION CAUTION WARNING DANGER injury. avoided, ol euti et rserious or death in result could ilrsl ndaho serious or death in result will ih euti io rmoderate or minor in result might , niae aadwih fnot if which, hazard a indicates niae aadwih fnot if which, hazard a indicates CAUTION hnused when not if which, hazard a indicates WARNING WARNING sue oietf safety identify to used is without ol result could h alert the YBL ASSOCIATED SYMBOLS Shock Parts Moving Fumes Toxic Surface Hot Kickback Explosion Fire Objects Thrown Protection Eye Wear IHTI PRODUCT THIS WITH www.BRIGGSandSTRATTON.com Fast Slow Manual Read Stop Choke Off On Shutoff Fuel Fuel Oil Safety 3 WARNING WARNING WARNING WARNING Engines give off carbonodorless, monoxide, colorless, an poison gas. Breathing carbon monoxide can cause nausea, fainting or death. Rotating parts can contacthands, or feet, entangle hair, clothing, or accessories. Traumatic amputation or severe laceration can result. Starting engine creates sparking. Sparking can ignite nearbygases. flammable Explosion and fire could result. Rapid retraction of starterwill cord pull (kickback) hand andfaster arm than toward you engine can letBroken go. bones, fractures, bruisessprains or could result. Start and run engine outdoors. Do not start or runeven engine if in doors enclosed or area, windows are open. When starting engine, pull theslowly starter until cord resistance is felt,Remove then all pull external rapidly. equipment/engine loads before starting engine. Direct-coupled equipment components such as, but not limited to, blades,sprockets, impellers, etc., pulleys, must be securely attached. If there is natural ornot LP start gas engine. leakage in area,Do do not use pressurized startingvapors fluids are because flammable. Operate equipment with guards inKeep place. hands and feet awayTie from up rotating long parts. hair and removeDo jewelry. not wear loose-fitting clothing,drawstrings dangling or items that couldcaught. become • • • • • • • • • • • engine cool at least 2 WARNING Gasoline and its vaporsextremely are flammable and explosive. Fire or explosion canburns cause or severe death. Turn engine off and let minutes before removing the gas cap. Fill fuel tank outdoors orarea. in well-ventilated Do not overfill fuel tank.approximately Fill tank 1-1/2 to inches below topto of allow neck for fuel expansion. Keep gasoline away from sparks,flames, open pilot lights, heat, andsources. other ignition Check fuel lines, tank, cap,frequently and for fittings cracks or leaks.necessary. Replace if If fuel spills, wait untilstarting it engine. evaporates before Ensure that spark plug, muffler,air fuel cleaner cap are and in placeDo and not secured. crank engine withIf spark engine plug floods, removed. set chokeposition, to place OPEN/RUN throttle in FASTengine and starts. crank until Do not tip engine orcauses equipment gasoline at to angle spill. which Do not choke carburetor to stop engine. Transport with fuel tank EMPTYshut-off or valve with OFF. fuel Store away from furnaces, stoves,heaters water or other appliances thatlight have or pilot other ignition sourceignite because gasoline they vapors. can When Adding Fuel • • • • • • When Starting Engine • • • When Operating Equipment • • When Transporting Equipment • When Storing Gasoline OrFuel Equipment In With Tank • Safety 4 • • • aesmlrlw.Fdrllw pl on land. apply federal laws Federal laws. similar may have states Other Code). California Resources the Public of 4442 (Section this California requires of state The land. unimproved brush-covered grass-covered, forest-covered, on equipment spark using a before order arrester working in maintain and Install area. cylinder area and muffler from debris accumulated Remove cool to touching. fins before and cylinder engine muffler, Allow rs,buh t.cncthfire. catch can etc. brush, leaves, grass, as such debris, Combustible on occur contact. can burns thermal Severe hot. extremely become muffler, especially parts, Engine heat. produce engines Running WARNING • • spark: for testing When • • • • • repairs: or adjustments performing Before ontcekfrsakwt pr plug spark with removed. spark for check not Do tester. plug spark approved Use operation. later during may shatter flywheel or the hammer because a object with hard flywheel the strike not speed. Do engine increase or to links parts spring, other governor with tamper not Do tools. correct only Use start.) electric with engines (only terminal negative at battery Disconnect plug. spark it the keep from and away wire plug spark the Disconnect rlaceration. or amputation, traumatic in entanglement, result can start-up Unintentional shock. electric or in fire result can sparking Unintentional www.BRIGGSandSTRATTON.com WARNING Features 5 Q J P L O N A I L H O M G K I F E J A D C B R O Spark Plug Air Cleaner (flat or oval) Choke Control Lever Fuel Shut-off Valve Rewind Handle Finger Guard Throttle Control Lever ON/OFF Switch (rewind start models) Fuel Tank and Cap Extended Dipstick (if equipped) Short Dipstick (if equipped) Oil Drain Plug Oil Fill Cap Engine Identification (located onModel cover) Type Code Muffler Muffler Guard (if equipped) Spark Arrester (if equipped) Safety Key (electric start models) ON/OFF Switch (electric start models) Gear Reduction Unit (if equipped) B C I. F. P. J. L. E. A. B. C. D. H. K. N. R. G. O. Q. M. Features Operation 10W-30 40 above use 40 purpose all for good is .Rmv h isik()adwp ihaclean a with wipe and (B) dipstick the Remove 1. 2) (Figure Dipstick Short cap. fill oil the tighten overflowing. and of Replace point to 3. Fill slowly. oil Pour (A). cap 2. fill oil the Remove 1. 1) (Figure cap fill oil with Models • • oil the checking or adding Before Oil Check/Add 30 SAE • • Recommendation Oil liter). (0.8 ounces engines: 28 series 210000 and 200000 Model liter). (0.6 ounces engines: 20 series 150000 and 120000 Model Capacity Oil Operation ytei 5W-30 Synthetic 5W-30 consumption. oil less with starting as improved temperatures as all well at protection best the provides nraeolcnupina 80 may at but consumption starting, oil weather increase cold improves oil This of conditions. grade temperature varying for better is srcmeddfrwne s,adwrsbs in best works conditions. and cold use, winter for recommended is 6 iue1 i ilCap Fill Oil 1: Figure ° la h i ilae faydebris. any of area fill oil the Clean level. engine Place chart. following the from viscosity a Choose additives. special use not Do hc i ee rqetya ihrtemperatures. higher at frequently level oil Check cloth. ilcuehr starting. hard cause will F 40 40 0to100 ° ° n eo (5 below and F n ihr(5 higher and F ° -1 o38 to (--18 F - 0t 120 to --20 A ° n below) and C ° ° n higher) and C ° -3 o40 to (--30 F ° C) F(27 ° ° ,uebelow use F, )o higher. or C) ° C) .Rpaeadtgtntedipstick. the tighten and Replace of 4. point to Fill slowly. oil pour oil, add To 3. .Isr h isikbut dipstick the Insert 2. iue2 hr Dipstick Short 2: Figure h erRdcinOl nteMaintenance the Section. in Change Oil” To Reduction “How Gear See oil The engine. with the filled operating be to must prior case reduction reduction gear gear a the with unit, equipped is engine this If overflowing. (C). mark FULL at be should C B B CAUTION www.BRIGGSandSTRATTON.com onot do C ce n i level Oil in. screw B Operation 7 B C A engine cool at least 2 WARNING B Gasoline and its vaporsextremely are flammable and explosive. Fire or explosion canburns cause or severe death. Turn engine off and let minutes before removing the gas cap. Fill fuel tank outdoors or inKeep well-ventilated gasoline area. away from sparks,pilot open lights, flames, heat, and other ignitionIf sources. fuel spills, wait untilstarting it engine. evaporates before B D let the engine cool at least 2 minutes. approximately 1-1/2 inches below topallow of for neck fuel to expansion. Be careful, do not overfill. • • • • Figure 4: Gas Cap Figure 3: Extended Dipstick stabilizer, available as a liquidliquid additive, cartridge concentrated or granular additive. High Altitude use At higher altitudes (over 5,000(89 feet), RON) 85 gasoline octane/85 can AKI bealtitude used. may Operation require at a high high-altitudeimprove carburetor performance jet and kit decrease to fuelSee consumption. an Authorized Briggs &more Stratton information. service dealer for Add Fuel (Figure 4) 1. Stop the engine. Before you remove gas cap2. (A), Remove the gas cap. Fill the fuel tank (B) to 3. Replace the gas cap before starting the engine. fuel t CAUTION suretheoilisattheFULLmark(C)onthedipstick. (D). DO NOT OVERFILL. Afterminute adding and oil, then wait recheck one the oil level. Clean, fresh, unleaded gasoline. A minimum of 87 octane/87operating AKI at (91 high RON). altitude, If seeGasoline below. with up to 10%to ethanol 15% (gasohol) MTBE or (methyl up tertiaryacceptable. butyl ether), is Use of any gasoline notrequirements consistent will with void the the engine warranty. Do not modify the enginecarburetor fuel to system run or on alternative fuels. Never mix oil with gasoline. Some fuels, called oxygenatedare or fuels reformulated blended fuels, withamounts alcohols of or these ethers. blends Excessive system can or damage cause the performance fuel problems.undesirable If operating any symptoms occur, usewith gasoline a lower percentage of alcohol or ether. To protect the fuel systema from fuel gum preservative formation, when mix adding in Stratton fuel. recommends Briggs using & FRESH START Fuel Stabilizer • • • In some local areas, fuelgasoline pumps contains may alcohols be or marked ethers.about if If the the you gasoline are you unsure purchase,provider. check with your fuel • • All gasoline is not theor same. performance If problems you after experience newused starting gasoline in has your been engine, switchor to change a fuel different brands. fuel provider Fuel Recommendations This engine is certified toemissions operate control on system gasoline. for The this(Engine engine Modifications). is EM Gasoline must meet these requirements: • 4. To add oil, pour the oil slowly into the engine oil fill 5. Fill to the FULL6. mark (C) Replace on and the tighten dipstick. the dipstick. Extended Dipstick (Figure 3) 1. Remove the dipstick2. (B) and Insert wipe and with tighten a the3. clean dipstick. cloth. Remove the dipstick and check the oil level. Make Operation .Mv h hotecnrllvr() feupe,to equipped, if (D), lever control throttle the Move 4. CHOKE the to (C) lever control choke the Move 3. the to equipped, if (A), valve shut-off fuel the Turn 2. the in Oil” “Check/Add See oil. engine the Check 1. Engine The Start To How 8 iue6 hk oto Lever Control Choke 6: Figure Valve Shut-off Fuel 5: Figure ilb aae eodrpi n ilntbe not warranty. will under and engine covered repair the beyond oil, damaged without be engine will the start without you factory If the oil. from shipped was engine This unn,adol(e CekAdOil” instructions). “Check/Add (see stopped oil has add and/or running, start not will If engine coverage. the warranty properly void not will is and level maintained oil the if damage occur Engine Always may starting. oil. before on level low oil is check engine the that operator the with GARD equipped be may engines Some h FAST the 5). (Figure position ON Section. Operation oiin(iue6). (Figure position h hotecnrllvri h ATposition FAST 7). the (Figure in lever control throttle the ® .The I GARD OIL oiin prt h niewith engine the Operate position. CAUTION CAUTION ® sitne owarn to intended is C A OIL 5. 6. iue7 hoteCnrlLever Control Throttle 7: Figure iue9 aeyKey Safety 9: Figure Switch OFF / ON 8: Figure • ontalwtesatrrp osa ak e the Let back. snap rewind. to slowly rope rope starter the system, allow starting not rewind do the to damage prevent To ntesft e F Fgr 9). (Figure (F) key push safety models, the start in electric ON On the 8). to (Figure switch position the move (B), switch ON/OFF Start Rewind ni eitnei et hnpl quickly. pull then handle felt, rope is starter resistance the until pull Slowly 10). (Figure (E) Start Rewind lwyutlrssac sfl,te ulrapidly. pull then felt, is handle resistance rope until starter slowly the pull engine, starting When pan ol result. could or sprains bruises fractures, go. bones, let Broken can you toward than arm faster and engine hand pull will cord (kickback) starter of retraction Rapid D -O nie qipdwt an with equipped engines On -- -Frl odtesatrrp handle rope starter the hold Firmly -- S F T CAUTION O P www.BRIGGSandSTRATTON.com WARNING B Operation 9 B position. B F F A -- Push in the safety key (F). Push D When starting a warm engine after a short position. For maximum performance and engineoperate life, with the throttle in FAST Electric Start the ON/OFF switch (B) tothe the engine ON starts, position. release When the(Figure ON/OFF 11). switch Figure 14: Fuel Shut-off Valve Figure 12: Throttle Control Lever Figure 11: Electric Start Figure 13: Safety Key and ON / OFF Switch NOTE: shutdown, leave the choke lever in the RUN 7. 8. Slowly move the choke control lever to the RUN position. If the engine failsinstructions to beginning start, with follow step the 3.needed, starting If see assistance the is “Troubleshooting” Chart. and then to the STOP E -- First move the throttle control -- On models equipped with a Rewind Start : OFF position (Figure 14). safety key out of reach of children. Electric Start lever (D) to the SLOWON/OFF position switch and (B) then to move the(Figure the OFF 13). position position (see Figure 12). Onan models ON/OFF equipped switch with (B), firstcontrol move lever the to throttle the SLOWtheON/OFFswitchtotheOFFposition position and then move (Figure 13). Rewind Start throttle control lever, move the throttle(D) control to lever SLOW Figure 10 4. Turn the fuel shut-off valve (A), if equipped, to the 3. Remove the safety key (F). (Figure 13). Store the 2. 1. WARNING: Do not move theequipped, choke to control, CHOKE if to stopfire the or engine. engine Backfire, damage could occur. How To Stop The Engine Maintenance 10 • warranty. your void • may parts other injury. of in use result addition, may may and well, unit, as the perform damage not may parts Other parts. for dealer service. service any Stratton See & equipment. Briggs the Authorized of life the extend performance and the improve will maintenance Regular cl present, is debris airborne hours. when 25 or every conditions n Check dusty often. In more clean conditions, dusty † In * Maintenance Procedure elc i lae atig i o qipdwt r-lae)† pre-cleaner) with equipped not (if Cartridge Cleaner Air Replace † equipped) (if Pre-Cleaner Cleaner Air Service Debris of Engine Clean Level Oil Check hc av Clearance Valve Check * System Cooling Air Clean equipped) (if Filter Fuel Replace Plug Spark Inspect/Replace equipped) (if Reduction Gear in Oil Change pre-cleaner) with equipped (if Cartridge Cleaner Air Replace equipped) (if Arrester Spark And Muffler Inspect Oil Change oke h nti odoeaigcondition. operating good in unit the section keep Maintenance to the in information the Follow are fasteners all tight. sure Make fasteners. the Check ne ev odo nhg temperatures. high use in of or hours load 8 heavy to under 5 first after oil Change s nyoiia qimn replacement equipment original only Use n hneey5 or.Cag i vr 5huswe prtn h engine the operating when hours 25 every oil Change hours. 50 every then , aneac Chart Maintenance In Hours 8 rDaily or a oeotn elc i itri ti eydirty. very is it if filter air Replace often. more ean • • • 5Hus5 or 0 or 100-400 Hours 100 Hours 50 Hours 25 hte uigoperation. later during may shatter flywheel or the hammer because a object with hard flywheel the strike not speed. Do engine increase or to links parts spring, other governor with tamper not Do tools. correct only Use rlaceration. or amputation, traumatic in entanglement, result can start-up Unintentional shock. electric or in fire result can sparking Unintentional www.BRIGGSandSTRATTON.com WARNING Hours Maintenance 11 B A CAUTION .030 in (.76 mm) The manufacturer of the equipmentengine on is which installed this specifies topengine speed will at be which operated. the DOspeed. NOT EXCEED this Figure 15: Check Spark Plug Carburetor Adjustment Never make adjustments to thecarburetor carburetor. was The set at theunder factory most to conditions. operate However, efficiently ifrequired, adjustments see are any Authorized Briggsservice & dealer Stratton for service. Valve Clearance Check valve clearance every 250“Tune-up hours. Specifications” See chart. CAUTION In some areas, local law requires using a All the components used toremain build in this place engine for must proper operation. resistor spark plug to suppressengine ignition was signals. originally If equipped this withplug, a use resistor same spark type for replacement. NOTE: Spark Plug (Figure 15) Check the spark plug everyspark 100 plug hours. if, Replace upon the inspection,burned the or electrode worn. (A) Make is sureclean. that Check the the spark gap plug withnecessary, is a reset wire to gauge .030 (B). in If (0.76 mm). Inspect Muffler And Spark Arrester Inspect the muffler and theequipped) spark every arrester 50 (if hours. Ifa muffler spark is arrester equipped screen, with removeinspection. the Replace screen the for screen ifplugged. damaged If or inspection determines thatparts replacement are required, make sureequipment to replacement use parts. only original Emissions Control Maintenance, replacement, or repair ofcontrol the devices emissions and systems mayany be non-road performed engine by repair establishmentindividual. or However, to obtain nothe charge terms repairs and under provisions ofwarranty the statement, Briggs any & service Stratton orpart emissions repair control or replacement mustfactory be authorized performed dealer. by See a theWarranty. Emissions Maintenance 12 .Rpaeadtgtntedipstick. the tighten and Replace 5. Make level. oil the check and dipstick the Remove 4. dipstick. the tighten and Insert 3. DO (D). fill oil engine the into slowly oil the Pour 2. clean a with wipe and (B) dipstick the Remove 1. 19) (Figure Dipstick Extended dipstick. the tighten and Replace 4. but dipstick the Insert 3. of point to Fill slowly. oil pour oil, add To 2. clean a with wipe and (B) dipstick the Remove 1. 18) (Figure Dipstick Short cap. fill oil the tighten and Replace overflowing. of point 3. to Fill slowly. oil Pour (A). 2. cap fill oil the Remove 1. 17) (Figure cap fill oil with Models • • oil adding Before plug. drain oil the tighten and Replace 3. an into oil the Drain (F). plug drain oil the Remove 2. spark the disconnect warm, still but off engine With 1. 16) (Figure Oil Remove Oil The Change To How la h i ilae faydebris. any of area fill oil the Clean level. engine Place suretheoilisattheFULLmark(C)onthedipstick. level. oil the minute recheck one then wait and oil, adding After OVERFILL. NOT cloth. (C). mark FULL at be should overflowing. cloth. 16. Figure in shown are (G) Note: receptacle. appropriate plug. spark the from away it keep and wire plug oeo h aiu ye foldanplugs drain oil of types various the of Some onot do ce n i level Oil in. screw iue1:OlFl Cap Fill Oil 17: Figure Plug Drain Oil 16: Figure iue1:Etne Dipstick Extended 19: Figure Dipstick Short 18: Figure B D C B A B F www.BRIGGSandSTRATTON.com C C B B G Maintenance 13 B G J F K G G K A B B E H C C D A C equipped) into the basesure and cartridge onto fits stud securely (J). into Make base (G). sure the knob is tight. D A D Figure 22: Oval Air Filter Figure 21: Flat Air Filter Figure 20: Flat Air Filter 4. Install the new cartridge and pre-cleaner (if 5. Install air filter cover and secure with knob. Make oil Do not WARNING CAUTION Gasoline and its vaporsextremely are flammable and explosive. Fire or explosion canburns cause or severe death. Never start or run thecleaner engine assembly with or the the air filterfire removed or as explosion a could result.will A cause dirty a air loss filter ofdust engine enters power. the If engine dirt through or the the result carburetor, will be excessivethe wear engine. or Replace damage a to damagedcleaner or or clogged air air filter immediately. cartridge. Discard the old cartridge. (A). cartridge. Discard the old cartridge. pre-cleaner, install lip (K) onbottom the of pre-cleaner the at cartridge the pleats. Figure 20, insert the(F) cover located tabs at (E) the into bottom the of slots the base (G). the pre-cleaner. • Do not use pressurized airfilter. or Pressurized solvents air to can clean damagesolvents the the will filter dissolve and the filter. Oval Air Filter (Figure 22) 1. Remove the knob2. (H) and Lift the the air cartridge filter3. (B) cover off (A). of Remove the the base pre-cleaner (G). (C), if equipped, from the 2. Open the cover3. and remove the Remove cartridge the pre-cleaner (B). (C), if equipped, from4. the Install the new cartridge. If equipped with a 5. On models equipped with air filter shown in 6. Close the cover and tighten the screw(s). Flat Air Filter (Figure 201. and Figure Loosen 21) screw(s) (D) that holds the air filter cover 6. Assemble the dry7. pre-cleaner onto the Install cartridge. the cartridge. 8. Assemble the air filter cover. The air filter system usescartridge. Some either models a flat alsopre-cleaner or include that oval an can additional be washed and reused. Pre-cleaner (Figure 20, Figure 21,1. Figure 22) Remove the air2. filter cover (A). Remove the cartridge3. (B). Separate the pre-cleaner4. (C) from the Wash the cartridge. pre-cleaner in5. liquid detergent Let and the water. pre-cleaner thoroughly air dry. How To Service The Air Filter Maintenance 14 .Scr ullnst lmsa shown. as clamps to lines fuel filter. Secure replacement equipment 5. original new Install if Replace 4. leaks. or cracks for lines fuel the Check 3. then (C), clamps on (B) tabs squeeze to pliers Use 2. equipped, if (A), filter fuel the replacing Before Filter 1. Fuel The Replace To How plug. fill oil the tighten and plug. Install level oil 6. the tighten and Install 5. the into lube gear 80W90 SAE pour slowly refill, plug To level oil 4. the and (B) plug fill oil the plug. Remove drain oil 3. the tighten and Install into oil the 2. drain and (A) plug drain oil the Remove 1. as service is unit, engine follows. reduction your gear If a models. with all equipped on feature included optional not an is is 100 that unit every reduction unit gear reduction The gear hours. the in oil the Change 23) (Figure Oil Reduction Gear The Change To How iue2:Fe Filter Fuel 24: Figure necessary. filter. fuel the of off and (D) Twist lines filter. fuel fuel the the pull from away clamps the slide or fire a cause and explosion. valve. out shut-off leak fuel can the fuel close Otherwise, or tank fuel the drain cover case gear the of shown. top as the on installed be must Important: of out runs (C). oil hole the level until oil pour the to Continue hole. fill oil (C). receptacle. appropriate an C B h i ilpu a ethl D that (D) hole vent a has plug fill oil The D B A D iue2:Ga Reduction Gear 23: Figure • • • • • at o ulsse cp oe,tanks, etc.). hoses, filters, (cap, system fuel for parts replacement equipment original use Always before evaporates engine. it starting until wait spills, fuel valve. shut-off If fuel the fuel close the or drain tank filter, fuel the replacing Before if Replace necessary. leaks. or cracks fittings for and frequently cap, tank, lines, fuel Check ignition other sources. and heat, lights, pilot open flames, sparks, from away gasoline Keep D un rdeath. severe or cause burns can explosion or Fire explosive. and flammable are extremely vapors its and Gasoline B www.BRIGGSandSTRATTON.com A WARNING C Maintenance 15 C fuel cap with a cartridge of B t A Figure 25: Clean Engine Keep linkage, springs and controlsthe (B) area clean. around Keep and behindcombustible the debris. muffler (C) free of any If a FRESH START concentrated slow drip stabilizer isneed used, to there drain is the no fuelthe for cartridge seasonal contains storage stabilizer. as long as Engine oil While the engine is still warm, change the engine oil. Lubricate cylinder and piston Remove the spark plug and(30 pour ml) approximately of 1 engine oz oilthe into spark the plug spark and plug slowlydistribute hole. pull the Replace the oil. starter rope to Clean engine Clean engine of surface debris, chaff, or grass. Storage Area Store in a clean, dryarea area. as Do a not stove, store furnace,appliance in water that the heater, uses same or a other pilotcan light create or a has spark. a device that Over time, debris can accumulatecooling in fins the and cylinder cause thedebris engine cannot to be overheat. observed This withoutof partial the disassembly engine. For thisBriggs reason, & have Stratton an Service authorized Dealerthe inspect air and cooling clean system as“Maintenance recommended Chart”. in the WARNING WARNING CAUTION Running engines produce heat. Engine parts, especially muffler, become extremely hot. Severe thermal burns cancontact. occur on Combustible debris, such asgrass, leaves, brush, etc. can catch fire. Gasoline and its vaporsextremely are flammable and explosive. Fire or explosion canburns cause or severe death. Allow muffler, engine cylinder andbefore fins touching. to cool Remove accumulated debris from mufflerand area cylinder area. Store away from furnaces, stoves,heaters water or other appliances thatlights have or pilot other ignition sourcescan because ignite they gasoline vapors. • • When Storing Gasoline OrFuel Equipment In With Tank • Do not use water tocontaminate clean the the fuel engine. system. Water Usecloth could a to brush clean or the dry engine. Fuel System Fuel can become stale whenStale stored fuel over causes 30 acid days. andfuel gum system deposits or to on form essentialstabilizer in carburetor with the parts. the Mix fuel fuel inRun the the tank engine or for storage athrough container. short the time carburetor to and circulate engine.can stabilizer Engine then and be fuel stored up toIf 24 fuel months. stabilizer is used,gasoline you prior do to not storage. need Ifrun to fuel the drain stabilizer engine the is until not it used, stops from lack of fuel. Storage (over 30 days) This is an air cooledair engine. flow Dirt and or cause debris thepoor can engine performance restrict to and over reduced heat, enginebefore resulting life. every in Daily use, or check thedirt engine or for debris accumulated that maydry restrict cloth air to flow. remove Use debris a from brush the or finger guard (A). Clean Air Cooling System (Figure 25) Troubleshooting 16 Troubleshooting niesoe excessively smokes Engine speed full at run not will Engine erratically runs EEngine start to difficult Engine start not will Engine xesv vibration Excessive g g g i or or PROBLEM t i l l y equipment or engine on parts Loose plug spark Fouled filter air Dirty filter air Dirty plug spark Fouled adjustment of out Carburetor tank fuel in Dirt fuel Stale on mark dipstick FULL above is level Oil plug spark Fouled oil Low flooded Carburetor Outoffuel oto Go edAssistance? Need www.briggsandstratton.com rcl 80 233-3723 (800) call or CAUSE ann ih rso h engine. the stop or light a warning activate either will switch pressure ri n la ultn.Fl ihfresh with Fill fuel. tank. fuel clean and Drain fuel. fresh with Fill tank. fuel Drain dipstick. on mark oil FULL bring to to level engine from oil excess Drain gap. plug spark set and Clean kg/cm (0.2-0.4 below psi drops 4-6 pressure oil the if engines, level. oil Check starts. engine the until starting the procedure follow the Then position. to RUN lever control choke the Move fuel. fresh clean Add tatnsriedealer. & service Briggs Stratton Authorized an to unit the take continues, vibration If fasteners. all Tighten immediately. engine Stop plug. worn, spark or the burned replace is the electrode If plug gap. spark plug spark set and Clean filter. air the replace or Clean filter. air replace or Clean plug. worn, spark or the burned replace is the electrode If plug gap. spark plug spark set and Clean dealer. service Stratton & Briggs Authorized Contact www.BRIGGSandSTRATTON.com CORRECTION Note: 2 nsome On ,a oil an ), Specifications . 17 ° C) above ° F (5.6 n ° Common Service Parts Common Service C). It will operate satisfactorily at an angle up to 15 C). It will operate satisfactorily at an angle ° (uses standard electric drill to quickly remove oil from engine) standard electric (uses F (25 Flat air filter cartridgeFlat air filter Flat pre-cleanerOval air filter cartridgeOval pre-cleanerOilFuel filterGas additive5043 491588 or Resistor spark plug 697029 plugLong life platinum spark 493537 or 5064 Spark plug wrenchSpark tester 273356 Oil pump kit 5066 491055 5041 694485 100005 89838 or 5023 19368 5056 ° We recommend that you use an authorized Briggs & Stratton recommend We Engine power will decrease 3-1/2% for each 1,000 feet (300 Engine Service Part Part Number Valve clearance with Valve valve springs installed and piston 1/4 in Refer to the equipment operator’s manual for safe allowable operating limits on slopes. 77 Service Dealer for all maintenance and service of the engine and Service Dealer for all maintenance and service parts. engine parts. Use only genuine Briggs & Stratton meters) above sea level and 1% for each 10 (6 mm) past top dead center (check when engine is cold). See (6 mm) past top dead center (check when engine Repair Manual P/N 272147. † n * Power & Torque Rating Procedure), and rating Power & Torque corrected in performance has been obtained and accordance with SAE J1995 (Revision 2002-05). values are derived at 3060 RPM; horsepower Torque values are derived at 3600 RPM. Actual gross engine among other by, power will be lower and is affected things, ambient operating conditions and both the wide array Given engine-to-engine variability. of products on which engines are placed and the variety of environmental issues applicable to operating the equipment, the gas engine will not develop the rated gross power when used in a given piece of power equipment (actual “on-site” or net is due to a variety of factors power). This difference including, but not limited to, accessories (air cleaner, fuel pump, exhaust, charging, cooling, carburetor, etc.), application limitations, ambient operating altitude), and conditions (temperature, humidity, to manufacturing and Due engine-to-engine variability. capacity limitations, Briggs & Stratton may substitute an engine of higher rated power for this Series engine. .004 − .006 in (.10 − .15 mm) .004 − .006 in (.10 − .15 mm) .004 − .006 in (.10 − .15 mm) in (.23 − .28 mm) .009 − .011 200000 / 210000 120000 / 150000 200000 210000 120000 150000 Engine Specifications Tune-up Specifications * Tune-up † † † † Exhaust: Exhaust: Spark Plug Gap:Armature Air Gap:Intake .030 in (.76 mm) − .30 mm) .008 − .012 in (.20 Spark Plug Gap:Armature Air Gap:Intake .030 in (.76 mm) − .36 mm) .010 − .014 in (.25 Displacement:Bore 18.64 cu in (305 cc) StrokeDisplacement:Bore 3.120 in (79.23 mm) 2.438 in (61.67 mm) 20.85 cu in (342 cc) Stroke 3.300 in (83.81 mm) 2.438 in (61.67 mm) Displacement:Bore (206 cc) 12.48 cu in StrokeDisplacement:Bore 2.672 in (68 mm) mm) 2.204 in (56 15.22 cu in (249 cc) Stroke 2.970 in (75.44 mm) mm) 2.200 in (56 Model: Model: Model: Model: Model: Model: Engine Power Rating Information The gross power rating for individual gas engine models is labeled in accordance with SAE (Society of Automotive Engineers) code J1940 (Small Engine This is a single cylinder, overhead valve (OHV) This is a single cylinder, air-cooled engine. It is a low emissions engine. In the state of California, OHV Model 120000 and 150000 engines are certified by the California Air Resources Board to meet emissions standards for 125 hours. OHV Model 200000 and 210000 engines are certified by the California Air Resources Board to meet emissions standards for 250 hours. Such owner or certification does not grant the purchaser, operator of this engine any additional warranties with respect to the performance or operational life of this engine. This engine is warranted solely according to the product and emissions warranties stated elsewhere in this manual. General Information Specifications Warranties 18 Leakingcarburetors,clogged fuelpipes,stickingvalves,orotherdamage, 3 Equipmentcontrolsorinstallationsthatpreventstarting, cause 2 1 of: because required Nor mounted. be may engine the which only,workmanship replacemen not and rela engine covers warranty This because ofimpropermaintenance,isnotcoveredbywarranty. plug cleaninggrit,orotherabrasivematerialthathasenteredtheengine appears tobeprematurewear. Suchwear, whencausedbydirt,dust,spark mowers, areveryoftenusedindustyordirtyconditions,whichcancausewhat the careitreceives.Someapplications,suchastillers,pumpsandrotary The lifeofanenginedependsupontheconditionsunderwhichitoperates,and Improper maintenance: has exhaustedthelifeofapartoranengine. replacement toperformwell.Warranty willnotcoverrepairwhennormaluse Engines, likeallmechanicaldevices,needperiodicpartsserviceand Normal wear: of thecausesenginefailurethatwarrantydoesnotcover. which mightoccurbetweenthecustomerandDealer, listedbelowaresome fully reimbursedforthoseitemsthataredefective.To avoidmisunderstanding Distributor ortheFactorydecidesthatclaimisjustified,customerwillbe submit allsupportingfactstohisDistributorortheFactoryforreview. Ifthe be madetodeterminewhetherthewarrantyapplies.AskServiceDealer If acustomerdiffers withthedecisionofServiceDealer, aninvestigationwill or theenginehasbeenalteredmodified. Similarly, warrantyis maintenance, shipping,handling,warehousingorimproperinstallation. apply ifenginedamageoccurredbecauseofmisuse,lackroutine warranty servicemaynotbeappropriate.Forexample,would Most warrantyrepairsarehandledroutinely, butsometimesrequestsfor inconvenienced. AnyAuthorizedServiceDealermayperformwarrantyrepairs. Briggs &Strattonwelcomeswarrantyrepairandapologizestoyouforbeing period. of theinitialpurchasedateattimewarrantyserviceisrequested,manufacturingproductwillbeusedtod No warrantyregistrationisnecessarytoobtainonBriggs&StrattonProducts.Saveyourproofofpurchasereceipt.If of thiswarranty. income producingorrentalpurposes.Onceanenginehasexperiencedcommercialuse,itshallthereafterbeconsideredasacomm above. “Consumeruse”meanspersonalresidentialhouseholdusebyaretailconsumer. “Commercialuse”meansallotheruses,inc The warrantyperiodbeginsonthedateofpurchasebyfirstretailconsumerorcommercialenduser, andcontinuesforthep may alsohaveotherrightswhichvaryfromstatetoandcountrycountry. consequential damages,sotheabovelimitationandexclusionmaynotapplytoyou.Thiswarrantygivesyouspecificlegalright limitations onhowlonganimpliedwarrantylasts,andsomestatesorcountriesdonotallowtheexclusionlimitationofinc incidental orconsequentialdamagesareexcludedtotheextentexclusionispermittedbylaw. are limitedtooneyearfrompurchase,ortheextentpermittedbylawanyandallimpliedwarrantiesexcluded.Liability There isnootherexpresswarranty, impliedwarranties,including thoseofmerchantabilityandfitnessforaparticularpurpose Dealer in our dealer locator map at www.briggsandstratton.com, Authori nearest the find service, is effective warranty forandissubjecttothetimeperiodsconditionsstatedbelow. For both. Transportation chargesonproductsubmittedforrepairorreplacementunderthiswarrantymustbebornebypurchaser. Thi Briggs &StrattonCorporationwillrepairorreplace,freeofcharge,anypart(s)theenginethatisdefectiveinmaterialo gasoline andBriggs&StrattonFuelStabilizer, Part No.5041.) caused byusingcontaminatedorstale fuel.(Useclean,fresh,lead-free equipment manufacturer.) unsatisfactory engineperformance,orshortenlife.(Contact parts. Problems causedbypartsthatarenotoriginalBriggs&Stratton void iftheserialnumberofenginehasbeenremoved eoeeFe prtdEgns1ya 90 90 days days 2 years 1 year All Other Briggs & Stratton Engines Kerosene Fuel Operated Engines rn rdc yeCnue s Commercial Use Consumer Use ** Extended Life Series Vanguard Product Type / Brand BRIGGS &STRATTON ENGINEOWNERWARRANTYPOLICY Engines usedonHome racing oroncommercialrentaltracksarenotwarranted. does notapplytoenginesonequipmentusedforprimepowerinplaceofautility. e eetv aeilad or and/ material defective ted 2yas2 years 2 years t or refund of the equipment to equipment the of refund or t does the warranty extend to repairs to extend warranty the does , I/C Standby Generatorapplicationsarewarrantedunderconsumeruseonly. ne C / , Intek I ABOUT YOURWARRANTYABOUT WARRANTY TERMS ** LIMITED WARRANTY , Intek Pro Effective 12/06 or bycalling (800) 233-3723, or as listed in the ‘Yellow Pages Damageorweartopartscausedbydirt,which enteredtheenginebecause 6 Repairoradjustmentofassociatedpartsassembliessuchasclutches, 5 Partswhicharescoredorbrokenbecauseanenginewasoperatedwith 4 similar category.similar or Mowers,” “Lawn Engines,” “Gasoline or Gasoline” “Engines, under Service Dealer is listed in the “Yellow the in Pages listed is Dealer Service Co Stratton & Briggs by authorized th only available Warranty is service Engineorenginecomponentfailure,i.e.,combustionchamber, valves, 11 Routinetune-uporadjustmentoftheengine. 10 Abentorbrokencrankshaft,causedbystrikingasolidobjectwiththe 9 Engineorequipmentparts brokenbyexcessivevibrationcauseda 8 Partsdamagedbyover-speeding,oroverheatingcausedgrass,debris, 7

re-oil theOil-Foam air cleanerelementorcartridge.(Atrecommendedintervals,cleanand of improperaircleanermaintenance,re-assembly, oruseofanon-original & Stratton. transmissions, remotecontrols,etc.,whicharenotmanufacturedbyBriggs properly maintained.ReadOperating&MaintenanceInstructions. not shutdownrunningengine.Enginedamagemayoccurifoillevelis when necessaryandchangeatrecommendedintervals.)OILGARDmay lubricating oil(checkleveldailyorafterevery8hoursofoperation.Refill insufficient orcontaminatedlubricatingoil,anincorrectgradeof gasolines, etc. use ofalternatefuelssuchas,liquifiedpetroleum,naturalgas,altered valve seats,guides,orburnedstartermotorwindings,causedbythe cutter bladeofarotarylawnmower, orexcessivev-belttightness. crankshaft, over-speedingorotherabuseinoperation. unbalanced impellers,improperattachmentofequipmenttoengine loose enginemounting,cutterblades,unbalancedbladesor recommended intervals.)ReadOperating&MaintenanceInstructions. ventilation. (Cleanfinsonthecylinder, cylinderheadandflywheelat caused byoperatingtheengineina or dirt,whichplugsclogsthecoolingfins,flywheelarea,damage cartridge.) ReadOperating&MaintenanceInstructions. er 1 year 2 years

element orthe foam Engines usedincompetitive Somestatesorcountriesdonotallow rporation. Yourrporation. Authorized nearest www.BRIGGSandSTRATTON.com rough service dealers which have been have which dealers service rough

This warranty confined area eriod oftimestatedinthetable pre-cleaner, andreplacethe ™ ercial useengineforpurposes luding useforcommercial, ” of your telephone directory telephone your of ” etermine thewarranty youdonotprovideproof without sufficient r workmanshipor idental or zed Service s andyou s warranty ™ for ’. , Warranties 19 r or replace as necessary” shall ng diagnostic labor which leads to soon as a problem exists. The d be completed in a reasonable overage. It is in addition to the B&S engine warranty Repair or replacement of anyno Warranted charge Part to will the be owner,the performed includi determination at that a Warranteddiagnostic Part work is is defective, performed if atDealer. the an For emissions Authorized B&S warranty Service serviceAuthorized contact B&S your Service nearest Dealer asunder listed “Engines, in Gasoline,” the “Gasoline “Yellow Engines,”or Pages” “Lawn similar Mowers,” category. Warranty claims shall be filedof in the accordance B&S with Engine the Warrantyexcluded provisions Policy. for Warranty failures coverage of shall WarrantedB&S be Parts parts which or are because not ofmaintenance original abuse, as neglect set or forth improper inB&S the is B&S not Engine liable Warranty tothe Policy. cover use failures of of add-on, Warranted non-original, Parts or caused modified by parts. Any Warranted Part which isrequired not maintenance scheduled or for which replacement isinspection as scheduled to only the for effect regular ofbe “repai warranted as to defectsWarranted for Part the which warranty is period. scheduledmaintenance Any for shall replacement be as warranted required asof to time defects up only to for thereplacement the first part period scheduled that replacement is for equivalentmay that in be part. performance used Any and in durability theThe performance owner of is any responsible maintenance formaintenance, or the as repairs. performance defined of in all theInstructions. required B&S Operating and Maintenance Coverage hereunder shall extend tocomponents the caused failure by of the any failureunder engine of warranty. any Warranted Part still below. If any covered partrepaired on or your replaced engine by is B&S. defective, theOwner’s part Warranty will Responsibilities be As the small off-road engineperformance owner, of you the are required responsible maintenanceMaintenance for listed Instructions. the in B&S your recommends Operating thatreceipts and you covering retain maintenance all on your yourB&S small cannot off-road deny engine, warranty but solelyfailure for to the ensure lack the of performance receipts ofAs or all the for scheduled small your maintenance. off-road enginethat owner, B&S you may should deny however youengine be warranty or aware coverage a if part your hasmaintenance small failed or off-road due unapproved to modifications. abuse, neglect,You improper are responsible for presentingAuthorized your B&S small Service off-road Dealer engine as undisputed to warranty an repairs shoul amount of time, not to exceedIf 30 you days. have any questionsresponsibilities, regarding you your should warranty contact rights a(414) and B&S 259-5262. Service Representative at The emissions warranty is anormal defects engine warranty. performance. Defects The are warrantyemissions judged is test. on not related to an in-use 3. No Charge 4. Claims and Coverage Exclusions 5. Maintenance 6. Consequential Coverage rol Defects Warranty Provisions gency (U.S. EPA) Emissions Control System alifornia Air Resources Board (CARB) and the ve to your Emissions Control Defects Warranty C on, time sensitive valves and luding diagnosis, parts and labor. ts, B&S will repair your small Briggs & Stratton Emissions Cont Warranty Statement (Owner’s Defect Warranty Rights and Obligations) United States Environmental Protection A Briggs & Stratton Corporation (B&S), the C Exhaust manifold Air injection system or pulse valve Catalytic converter Magneto ignition system Spark plug(s) Intake manifold Purge and vent line Air cleaner Carburetor and internal parts Fuel pump Fuel line, fuel line fittings,Fuel clamps tank, cap and tether Carbon canister Cold start enrichment system (soft choke) switches Connectors and assemblies Vacuum, temperature, positi • • • • • • • • • • • • • • • • Miscellaneous Items Used in Above Systems d. Catalyst System c. Ignition System b. Air Induction System Coverage under this warranty extendsbelow only (the to emissions the control parts systemsparts listed parts) were to present the on extent the these enginea. purchased. Fuel Metering System e. B&S warrants to the initialthat owner the and Warranted Parts each shall subsequentand be purchaser workmanship free which from caused defects thefor in failure a materials of period the of Warranted tworetail Parts years purchaser. from the date the engine is delivered to a for non-regulated engines found in1. the Operating and Maintenance Warranted Instructions. Parts The following are specific provisions relati Briggs & Stratton Emissions Control Defects WarrantySmall Coverage off-road engines are warrantedparts relative defects to for emissions a control period of two years, subject to provisions set forth California, United States and CanadaWarranty Emissions Statement Control Defects The California Air Resources Boardpleased (CARB), to U.S. explain EPA the and Emissionssmall B&S Control off-road are System engine Warranty (SORE). on Inengines your California, model new year small 2006 off-road andequipped later to must meet be the designed, State’sElsewhere built stringent in and anti-smog the standards. United States,certified new for non-road, model spark-ignition year engines 1997set and forth later by must the meet U.S.system similar EPA. on standards B&S your must engine warrant forthere the the has emissions periods been control of no time abuse,small listed neglect off-road below, or engine. provided improper maintenance of your Your emissions control system includesair parts cleaner, such ignition as system, the fuelAlso carburetor, line, included muffler may and be catalytic connectorsassemblies. converter. and other emissions related Where a warrantable condition exis off-road engine at no cost to you inc Emissions Control System Warranty Statement 2. Length of Coverage Warranties 20 Label Emissions Engine Your On Information and Index Period Air Durability Emissions Relevant For Look aeoyA=10 hours 1000 = A Category hours 500 = B Category hours 250 displacement. = more C or Category cc 225 of engines For hours 500 = A Category hours 250 = B Category hours 125 = displacement. C cc Category 225 than less engines For our information. emissions on engine consumer The the & labels. to Briggs emissions available Index. information Air this the makes and Stratton Period Durability information Emissions display Board the must Resources regarding Standard Air Emissions California 2 the Tier meet (CARB) to certified are that Engines to shown been has requirements. engine emissions the Federal which the meet for indicates hours label operating Compliance of Emissions number the on to referred engi Period certified 2 United emissions Phase the 2 For meet Phase standards. (USEPA) to Agency certified Protection be Environmental will States engines Stratton & Briggs Certain years. 12 the to Therefore, year. per hours mower Period 25 lawn to walk-behind actual 20 typical of used a hours is example, 500 For for time. compliant running emissions engine be to certified is Engine Extended: actual of hours 250 for time. compliant running emissions engine be to certified is Engine Intermediate: actual of hours 125 for time. compliant running emissions engine be to certified is Engine Moderate: are categories following used: The Instructions. the emissions Maintenance with be & accordance to Operating in certified maintenance is proper engine assuming the compliant, which for time running actual The our information. emissions on engine consumer The the & labels. to Briggs emissions available Index. information Air this the makes and Stratton Period Durability information Emissions display Board the must Resources regarding Standard Air Emissions California 2 the Tier meet (CARB) to certified are that Engines rgs&Srto nie r aeUdrOeO oeO h olwn aet:Dsg -4,7 OhrPtnsPending) Patents (Other D-247,177 Design Patents: Following The Of More Or One Under Made Are Engines Stratton & Briggs 6,542,074 6,557,833 6,584,964 6,595,176 6,595,897 6,603,227 6,617,725 6,615,787 6,622,683 6,647,942 6,691,683 msin uaiiyPeriod Durability Emissions fa niewt an with engine an of 6,347,614 6,349,688 6,356,003 6,369,532 6,382,166 6,456,515 6,460,502 6,472,790 6,494,175 6,495,267 6,520,141 6,202,616 6,213,083 6,230,678 6,237,555 6,239,709 6,242,828 6,260,529 6,263,852 6,284,123 6,311,663 6,325,036 intermediate ecie h ubro or of hours of number the describes e,teEisosCompliance Emissions the nes, 6,014,808 6,040,767 6,064,027 6,077,063 6,082,323 6,347,614 6,105,548 6,116,212 6,135,426 6,142,257 6,145,487 ae ilidct certification indicate will label certification indicate will label aigwudeut o10 to equate would rating msin Durability Emissions 5,809,958 5,813,384 5,819,513 5,823,153 5,843,345 5,852,951 5,887,678 5,894,715 5,904,124 5,992,367 6,012,420 5,497,679 5,605,130 5,606,851 5,606,948 5,619,845 5,628,352 5,642,701 5,645,025 5,732,555 5,765,713 5,803,035 5,265,700 5,269,713 5,271,363 5,301,643 5,320,795 5,497,679 5,501,203 5,503,125 5,445,014 5,546,901 5,548,955 5,150,674 5,186,142 5,188,069 5,191,864 5,197,422 5,197,425 5,197,426 5,228,487 5,234,038 5,235,943 5,243,878 4,895,119 4,971,219 4,977,877 4,977,879 4,996,956 5,009,208 5,040,644 5,058,544 5,070,829 5,086,890 5,138,996 www.BRIGGSandSTRATTON.com 4,430,984 4,453,507 4,512,499 4,520,288 4,522,080 4,630,498 4,633,556 4,719,682 4,720,638 4,819,593 4,875,448 308,871 D 308,872 D 309,457 D 356,951 D 361,771 D 372,871 D 309,457 D 375,963 D 368,187 D 457,891 D 476,629 D

Models 120000 150000 200000 210000

Engine Specifications

Engine Specifications Common Service Parts Model: 120000 Service Part Part Number Displacement: 12.48 cu in (206 cc) Flat air filter cartridge 491588 or 5043 Bore 2.672 in (68 mm) Flat pre-cleaner 493537 or 5064 Stroke 2.204 in (56 mm) Oval air filter cartridge 697029 Model: 150000 Oval pre-cleaner 273356 Displacement: 15.22 cu in (249 cc) Oil 100005 Bore 2.970 in (75.44 mm) Fuel filter 694485 Stroke 2.200 in (56 mm) Gas additive 5041 Resistor spark plug 491055 Model: 200000 Long life platinum spark plug 5066 Displacement: 18.64 cu in (305 cc) Spark plug wrench 89838 or 5023 Bore 3.120 in (79.23 mm) Spark tester 19368 Stroke 2.438 in (61.67 mm) Oil pump kit 5056 Model: 210000 (uses standard electric drill to quickly remove oil from engine) Displacement: 20.85 cu in (342 cc) Bore 3.300 in (83.81 mm) Stroke 2.438 in (61.67 mm)

Tune-up Specifications Model: 120000 / 150000 Spark Plug Gap: .030 in (.76 mm) Armature Air Gap: .010 -- .014 in (.25 -- .36 mm) Intake .004 -- .006 in (.10 -- .15 mm) Exhaust: .009 -- .011 in (.23 -- .28 mm) Model: 200000 / 210000 Spark Plug Gap: .030 in (.76 mm) Armature Air Gap: .008 -- .012 in (.20 -- .30 mm) Intake .004 -- .006 in (.10 -- .15 mm) Exhaust: .004 -- .006 in (.10 -- .15 mm)

Briggs & Stratton Corporation P.O. Box 702 Milwaukee, WI 53201-0702 www.BRIGGSandSTRATTON.com