Biddingo.com User’s Guide for Buyers Posting Bids (RFP’s, RFQ’s, RFI’s) is Easy Table of Contents
Posting a Bid ...... 3-23 Step 1 — Bid Type Selection ...... 4 Step 2 — Category Selection ...... 5 Step 3 — Bid Notice & Advertisement ...... 6 Step 4 — Attach Bid Document(s) ...... 11 Step 5 — Select Companies to Invite (Optional) ...... 16 Final Step – Verify Your Bid Info ...... 23
Adding an Announcement ...... 24-28
Posting Bid Results ...... 29-31
Awarding the Contract ...... 32-34
How to Find Suppliers...... 35-42 Vendor Registration ...... 35 Sourcing by Biddingo ...... 39
How to Track Suppliers ...... 43-50 Document Takers ...... 43 Add Document Takers ...... 48
Communication Tools ...... 51-54 Ask a Question ...... 51 Request for Bid Documents ...... 53
Setup Department/User ...... 55-57
Bid Activity Report ...... 58-63
Appendix - Biddingo.com Categories ...... 64-69 Posting a Bid
Posting a Bid
To start, log in at www.Biddingo.com
Enter User ID (email address) and Password
To post a new bid, click on Create Public Bid
For assistance, please call Biddingo.com at 416-756-0955 3 Posting a Bid — Step 1. Bid Type Selection
Step 1 — Bid Type Selection
You have the option to advertise a bid in one of three ways:
A Open to ALL suppliers — The “Open Bid” option will email your RFP’s, RFQ’s, RFI’s to all Biddingo.com suppliers registered within the selected business category.
B Open to all suppliers AND directly notify suppliers of my choice — By far the most popular option. The bid opportunity will be published and advertised to all suppliers registered within the selected business category, while allowing you to invite specific suppliers that are on your bidder’s list.
C By invitation only — The “Closed Invitation” allows you to notify specific suppliers that a bid opportunity has been posted on Biddingo.com. No other suppliers can view or access the bid opportunity. This option could be used for a pre-qualified group of suppliers.
For assistance, please call Biddingo.com at 416-756-0955 4 Posting a Bid — Step 2. Category Selection
Step 2 — Category Selection
This is where you categorize the bid. See a detailed list of bid categories and their descriptions at the page 6-11. You can select multiple categories. For example, security cameras would fall under “Business Services/Supplies - Security” as well as “Electronics/ Appliances - Audio/Visual Electronics.”
Select the category(ies) that best describe the goods or services required in the contract.
* Please use discretion when selecting a major category (in the green rows), as this will select all of its sub-categories. Using security cameras as an example, selecting the main category, “Business Services/Supplies” would notify vendors in many irrelevant sub-categories, such as Janitorial, Recycling and Pest Control. Once you’ve finished selecting the category(ies), click Next
For assistance, please call Biddingo.com at 416-756-0955 5 Posting a Bid — Step 3. Bid Notice & Advertisement
Step 3 — Bid Notice & Advertisement
Step 3.1. Bid Notice Information This section is where you enter information about the bid, including the Bid Number, Bid Description, Closing Date and Time, and the location. All required fields are marked with *.
Closing Time – detailed to the seconds
Under the “Publish” category, we recommend keeping both Document Takers and Bid Results checked, in order to minimize the vendor contacts to your purchasing department. Document Takers — if checked, the companies who have been invited or downloaded the documents can see each other. If you do NOT want to show the document takers list, leave this box unchecked. Bid Results — If checked the companies you have identified by bid submission received / bid price will be available for everyone to see. If you do NOT want to show the bidders, leave this box unchecked. Mandatory Feedback — If checked, the company must indicate a response of “Interested or “Not Interested” before they can access the bid document(s).This feature will assist you with planning in terms of preparing for the number of bid submissions.
For assistance, please call Biddingo.com at 416-756-0955 6 Posting a Bid — Step 3. Bid Notice & Advertisement
Step 3 — Bid Notice & Advertisement (Cont’d)
Accept questions from suppliers online through Biddingo — This feature allows you to manage the supplier questions online. It will reduce the manual intensive process involved in tracking the email and telephone inquiries. Through this process you can respond to individual inquiry or as a group in the form of an amendment. If you click yes, the users populate and lets you select the recipient(s) of the questions from suppliers. A tab below the user list allows you to input the deadline you wish to receive questions.
Press the “Shift” or “Ctrl“ key to select multiple Contacts.
Click New Contact to add another question recipient that is not listed.
For assistance, please call Biddingo.com at 416-756-0955 7 Posting a Bid — Step 3. Bid Notice & Advertisement
Step 3 — Bid Notice & Advertisement (Cont’d) Step 3.2 Requirements
Non Disclosure Agreement (NDA) Use this feature to safeguard your “confidential” documents from suppliers. If you select this feature, suppliers must agree to your online NDA terms and/ or the terms of your official NDA form before they can get further details of the bid or even download the document(s). If suppliers are required to complete the NDA form, they must fully execute it before they can download the bid documents identified herein as “NDA Required”. Once the NDA forms are verified as completed, you are required to log into Biddingo and select the companies that have submitted them. The system will unlock the documents and send an email notice informing them the documents are now available for download.
Notice of Intent (NOI) Setup whether or not NOI is mandatory or recommended, NOI date and time.
Check “Yes” to add NDA, NOI and Site Meetings Requirements.
Add multiply Site Meetings. Site Meetings The Site Meeting has been slightly modified to allow users to select various dates and locations. Also, you have the option to flag each meeting as mandatory or recommended. All site meetings are displayed when suppliers open the bid. Address Book — Use the address book option to set up the various locations for the site meetings. You only are required to set up the locations once. Thereafter, the list will automatically populate so that you can select the applicable location(s).
Address Book — List of locations
You can create new or update address
For assistance, please call Biddingo.com at 416-756-0955 8 Posting a Bid — Step 3. Bid Notice & Advertisement
Step 3 — Bid Notice & Advertisement (Cont’d) Step 3.3 Bid Advertisement The advertisement should be a synopsis of the RFP, RFI, or RFQ details. It should include: %LG1XPEHUDQG'HVFULSWLRQ 'HWDLOVRIWKH%LG2SSRUWXQLW\ WKHPRUHLQIRUPDWLRQLQFOXGHGWKHEHWWHULWLV for vendors) &RQWDFW,QIRUPDWLRQIRUWKHSRVWLQJDJHQF\ &ORVLQJGHWDLOVDQG 3URFHGXUHVIRU2EWDLQLQJ'RFXPHQWV LH 3LFNXSELGGRFXPHQWVIURP your organization; or download documents by clicking the “Download Document” tab on the bid notification.)
HTML editor is now available to allow users to edit their advertisement easier. You can copy and paste bid information from your file into the editor field. (Default font: Arial 10pt)
Click Savd and Preview to view the format and to verify the bid details.
For assistance, please call Biddingo.com at 416-756-0955 9 Posting a Bid — Step 3. Bid Notice & Advertisement
Step 3 — Bid Notice & Advertisement (Cont’d) Bid Notice Preview
In preview mode, click Modify to go back to edit mode to make modifications or corrections. If all information is correct, click Next Step.
For assistance, please call Biddingo.com at 416-756-0955 10 Posting a Bid — Step 4. Attach Bid Document(s)
We highly recommend that you upload the bid document(s) when you post the bid. However, if you would like to upload the document(s) at a later time, please call us at 416-756-0955. Step 4 — Attach Bid Document(s)
Option 1. Free Electronic Distribution of Bid Documents 99% of the posting agencies utilize this option. It is the default option. You can post multiple docs, multiple formats.
1. Under Document, click Browse to locate the bid documents on your computer, and double-click the required file. 2. Under Description, enter the Bid Document name. 3. Enter the number of pages. 4. Click Upload Bid Document(s).
Allows you to setup and browse multiple documents and upload them all at once as compared to setting up the documents and uploading it one at a time.
Option Criteria: Your purchasing department wants to distribute either the complete bid documents or segments of the bid document for downloading or viewing purposes. The bid documents are downloaded free to all paid subscribers, document fees (one time purchase option) apply for suppliers that do not wish to subscribe to Biddingo.com. Overview: Purchasing departments prepare the electronic documents in any format, (excel, pdf, word), they upload the bid documents on www.Biddingo. com. Registered suppliers receive the bid notification from Biddingo.com the same day the bid opportunity is posted. The bid documents are available to download to all subscribers on Biddingo.com at no cost. The supplier is listed as a document taker, addenda is easily issued, no hassle, no fees for subscribers. If a supplier is not a paid subscriber to Biddingo.com, they have the choice to purchase the document on a time basis.
The benefits of this option are: 3URYLGHVSXUFKDVLQJGHSDUWPHQWHOHFWURQLFGLVWULEXWLRQRIELGGRFXPHQWVWR all registered suppliers. %LGGLQJRFRPDOORZVSRVWLQJDJHQFLHVWKHRSSRUWXQLW\WRLQYLWHVXSSOLHUV utilizing their email address, to bid on the bid opportunity. This feature allows buyers to notify potential bidders of the opportunity whether the supplier is registered on Biddingo.com or not. Step # 4. 6XSSOLHUVKDYHSXUFKDVHRSWLRQVRQHWLPHRUVXEVFULEHWRZZZ%LGGLQJR com bid notification service. 7KLVRSWLRQSURYLGHVDQHIILFLHQWDQGFRVWHIIHFWLYHPHWKRGRIILQGLQJQHZ bidders during the bid process. Not just local suppliers. %LGGLQJRFRPDOORZVSXUFKDVLQJDJHQFLHVWREHFRPSOLDQWWR´7KH Agreement on Internal Trade”.
For assistance, please call Biddingo.com at 416-756-0955 11 Posting a Bid — Step 4. Attach Bid Document(s)
Step 4 — Attach Bid Document(s) (Cont’d)
Option 2. Electronic Copy with Document Fee Charge. Email or Pick-up Bid Packages Option 2, is very similar to option 1, however the main difference is that the posting organization can decide to receive revenue for their bid documents. 1. Enter the Package Price you would like to charge vendors. 2. Under Document, click Browse to locate the bid documents on your computer, and double-click the required file. 3. Under Description, enter the Bid Document name (eg. RFP 123 Bid Documents, or RFP 123 Spreadsheet, or Terms and Conditions). Include an explanation that the document can be purchased and emailed to vendors. 4. Enter the number of pages. 5. Click Upload Bid Document(s). Message to Suppliers – Shows you a sample breakdown of document fees as seen by suppliers.
Option Criteria: Your purchasing department wants to Charge suppliers for bid documents (i.e. bid packages that your organization would like to recover some revenue). The bid package gets emailed directly to the supplier after payment is processed. Overview: Purchasing departments set a bid package price, suppliers receive the bid notification from Biddingo.com. The tender advertisement details the fees that are charged by the posting agency, this option is for their convenience, suppliers can order and pay for bid packages by credit card, once the payment is processed, an email is issued to the supplier that includes the entire bid package. The supplier is listed as a document taker, addenda is easily issued, the monies processed by the supplier is forwarded to the posting agency at month end. The “Electronic Copy with Document Fee Charge Option” provides purchasing departments added flexibility when posting their RFP, RFI, or RFQ on Biddingo.com.
For assistance, please call Biddingo.com at 416-756-0955 12 Posting a Bid — Step 4. Attach Bid Document(s)
Step 4 — Attach Bid Document(s) (Cont’d)
The benefits of this option are: 3URYLGHVSXUFKDVLQJGHSDUWPHQWDGGHGELGGLVWULEXWLRQDQGUHYHQXH generating opportunity(s). 3URYLGHVVXSSOLHUVZLWKRSWLRQVLQVWHDGRIKDYLQJWRJRWRWKHSRVWLQJ agency’s purchasing department to purchase the bid package it can be purchased online. 7KLVRSWLRQSURYLGHVDQHIILFLHQWDQGFRVWHIIHFWLYHPHWKRGRIILQGLQJQHZ bidders during the bid process. Not just local suppliers. :HFROOHFWWKHELGGRFXPHQWIHHVDQGIRUZDUGWKHSD\PHQWWRWKHSRVWLQJ agency after the bid opportunity closes.
Here are the steps: For assistance, please call Biddingo.com at 416-756-0955 13 Posting a Bid — Step 4. Attach Bid Document(s) Step 4 — Attach Bid Document(s) (Cont’d) Option 3. Charge and Courier Bid Packages This option is for hard copy distribution i.e. Blueprints, printed material, printed bid documents, not easily converted to electronic format. This provides for revenue generating while distributing bid documents on www.Biddingo.com. 1. Enter the Package Price. 2. Under Description, explain that the documents can be purchased by the vendor online, and once payment is processed, the printed bid documents will be couriered or will be ready for pickup, depending on your internal purchasing procedures. 3. Enter the dollar amount that you are charging for shipping. Some organizations will not courier the bid package, and the vendor is responsible to pick up the bid package. 4. Click Attach Bid Package. Option Criteria: Your purchasing department wants to Charge suppliers for bid documents ( i.e. blue prints, cd’s, printed bid package) and arrange for pickup or have the bid packages picked up by courier. Overview: Purchasing departments set a bid package price, suppliers receive the bid notification from Biddingo.com. The tender advertisement describes the fees to the supplier explaining the fee is charged by the posting agency, that this is an option for their convenience, suppliers can order and pay for bid packages by credit card, once the payment is processed, an email is issued to the designated person(s) within the posting agency stating that the supplier has purchased the bid package. Depending on the posting agency they can order a courier (the courier fee is built into the bid package price) or the supplier can send their own courier, within 24 hours of the purchase (obviously given time to the posting agency to put the bid purchased package together). The supplier is listed as a document taker, addenda is easily issued, the monies processed by the supplier is forwarded to the posting agency at month end. The “Charge and Courier Bid Package Option” provides purchasing departments with added flexibility when posting their RFP, RFI, or RFQ on Biddingo.com. This option is available to all bid publishing agencies posting on www.Biddingo.com. For assistance, please call Biddingo.com at 416-756-0955 14 Posting a Bid — Step 4. Attach Bid Document(s) Step 4 — Attach Bid Document(s) (Cont’d) The benefits of this option are: 3URYLGHVSXUFKDVLQJGHSDUWPHQWDGGHGELGGLVWULEXWLRQRSSRUWXQLW\ 3URYLGHVVXSSOLHUVZLWKRSWLRQVSLFNXSELGGRFXPHQWVIURPRULJLQDWLQJ organization, or purchase the bid document online. 7KLVRSWLRQSURYLGHVDQHIILFLHQWDQGFRVWHIIHFWLYHPHWKRGRIILQGLQJQHZ bidders during the bid process. Not just local suppliers. :HFROOHFWWKHELGGRFXPHQWIHHVDQGIRUZDUGWKHSD\PHQWWRWKHSRVWLQJ agency after the bid opportunity closes. Here are the steps: For assistance, please call Biddingo.com at 416-756-0955 15 Posting a Bid — Step 5. Select Companies to Invite Step 5 — Select Companies to Invite (Optional) Invitation Option Select which companies you want to receive the invitation. Biddingo offers 3 options to locate and invite your suppliers: Option 1. Select suppliers from my eVendor Management Database. Locate registered suppliers based on commodity code(s) or company name. 1 Option 2. Notify suppliers from my previous bid(s). Use this option to invite the suppliers from my previous bid invitations. 2 Option 3. Search Biddingo.com’s database for suppliers. If you know which suppliers you want to invite, use this option. 3 For assistance, please call Biddingo.com at 416-756-0955 16 Posting a Bid — Step 5. Select Companies to Invite Step 5 — Select Companies to Invite (Optional) (Cont’d) Option 1. Select suppliers from my eVendor Management Database Use this option to locate registered suppliers based on commodity code(s) or search criteria. Search Criteria Company Name – search with the full business name or partial words. Email Address – type the full email address or the domain name. Location – locate suppliers within various geographic areas. Click the commodity code to view suppliers registered under it. Move mouse over the company name to see the list of users, and select the contact(s). Click this button to add the selected company(ies) to the invitaton list add invite more. If you can’t find the company you want to invite, click Search Biddingo.com Database. Click List of Invitees or Yes, I’m Finished Searching for Suppliers to go to the next stage to verify and select my contacts. For assistance, please call Biddingo.com at 416-756-0955 17 Posting a Bid — Step 5. Select Companies to Invite Step 5 — Select Companies to Invite (Optional) (Cont’d) Option 2. Notify suppliers from my previous bid(s) Use this option to invite the suppliers from my previous bid invitations. You can search previous bids by Bid Number and/or Bid Name and/or Business Category(ies). On the list of search results, select the bid by checking the radio button beside it. To view bid information, click the bid name. Click View Invited List to see list of invitees from the selected bid. All invitees/document takers from the previous bid are displayed on the list. Uncheck the box for each company you want to delete from the invitation list. For assistance, please call Biddingo.com at 416-756-0955 18 Posting a Bid — Step 5. Select Companies to Invite Step 5 — Select Companies to Invite (Optional) (Cont’d) Option 3. Search Biddingo database for suppliers Click Search by Location to expand or collapse Search by Location Option. You can search by Country/Province and/or Telephone Area Code and/or first 3 digits Zip/Postal Code. Use the search field to find your supplier. You can search by “Company Name”, or combine with “Search by Location” option. List of companies will display based on the search criteria. Move mouse over the company name to view all contact persons. Select the contacts or companies that you want to invite, then click Add the selected Company(ies) to the Invitation List and Invite More. If you can’t find the company you want to invite in Biddingo.com database, click Create New Company. Click List of Invitees or Go to Next Page, Select Contacts to go to the next stage to verify and select the contacts. For assistance, please call Biddingo.com at 416-756-0955 19 Posting a Bid — Step 5. Select Companies to Invite Step 5 — Select Companies to Invite (Optional) (Cont’d) Create a New Company If you can’t find the company you want to invite by searching Biddingo.com database, you can create a new company. On Create a New Company page, type the company name, and click Verify to search the Biddingo.com database for companies previously registered with the same name. Type the email or company name, and click Verify to search the Biddingo.com database for the same company name or same email. a). No company found. If there are no companies found in the Biddingo.com database matching the company name or email you entered. “No companies found” message will be displaye. You can continue to enter the new company’s information. For assistance, please call Biddingo.com at 416-756-0955 20 Posting a Bid — Step 5. Select Companies to Invite Step 5 — Select Companies to Invite (Optional) (Cont’d) b). The Similar Suppliers are found. If there are some existing companies in the Biddingo.com database matching the new company name or email you entered, you are lead to “list of similar suppliers” page. 6HOHFWDFRPSDQ\\RXZDQWWRLQYLWHGDQGFOLFNInvite Selected Company. ,I\RXFDQQRWILQGWKHFRPSDQ\WKDW\RXZDQWWRLQYLWHFOLFNGo Back and Update to re-create a new company. Check the radio button beside the company you want to invite, and click Invite Selected Company to add it to the invitee list. For assistance, please call Biddingo.com at 416-756-0955 21 Posting a Bid — Step 5. Select Companies to Invite Step 5 — Select Companies to Invite (Optional) (Cont’d) Invitee(s) Confirmation You can verify the list of companies you’ve selected, and select your contact person(s), update company info, or add new contact. &OLFNAdd New Contact to enter and save the contact information for someone you’re unable to locate from the Biddingo.com database. 8VHUpdate to make changes to contact’s current information in the database. Any changes made to the account results in an email being sent to the contact to verify the information, at which point he or she confirms or decline the changes. &OLFNDelete this company to delete the company from the invited list. &OLFNInvite More to use the search options and add more companies. &OLFNI’m Finished Selecting my Invitees and proceed the verification stage for the bid creation steps. For assistance, please call Biddingo.com at 416-756-0955 22 Posting a Bid — Final Step. Verify Your Bid Info Final Step – Verify Your Bid Info Email Notice – You can now setup recipients (another person from your organization) to the confirmation of bid posting email. Verify your bid information. Click on Modify link on each section to edit the information. Once you’ve verified all information, click Submit for Approval. Once you submit your bid for approval, the following will happen: ,WLVSODFHGLQWKHTXHXHRIELGVWREHUHYLHZHGE\%LGGLQJR·V4XDOLW\ Control (QC) Department. 7KH4&WHDPZLOOUHYLHZLWDQGPDNHWKHQHFHVVDU\IRUPDWWLQJFKDQJHV (spacing, etc.), and recommend adding/deleting categories. 2QFHWKHELGLVDSSURYHG\RXZLOOUHFHLYHDFRQILUPDWLRQHPDLODOHUWOHWWLQJ you that the bid is published on Biddingo and is accessible to suppliers. Rejecting your Bid ,IWKHUHDUHDQ\FKDQJHVUHTXLUHGWRWKHDGYHUWLVHPHQW25HUURUVVXFKDV incorrect bid number and track changes in the document, then the QC will return the bid to you. For assistance, please call Biddingo.com at 416-756-0955 23 Adding an Announcement Adding an Announcement Announcement feature offers flexible supplier notification options Public Sector Organizations (PSOs) now have the ability to send notifications to suppliers without classifying them as “Addenda/Amendments” or “Awards”. The new “Announcement” feature addresses the limitations of the amendment/award modules by allowing buyers to send “Special Notices” to suppliers during the bidding phase and/or the pre-award phase. In cases where buyers want to post notifications regarding the “short list” of companies or questions obtained from the finalist interviews, the announcement feature is ideal. It also provides the buyer with the option to notify their supplier target, i.e. document takers or bidders, and include attachments. Click Bid Scope to go to “Bid Scope” page, and then click Announcement in the top right box. To issue a 2nd announcement, click Announcement. Click Add New Announcement on “Announcement” page. For assistance, please call Biddingo.com at 416-756-0955 24 Adding an Announcement Adding an Announcement (Cont’d) Step 1. Announcement Basic Information a). Create an Addendum / Amendment Addendum / Amendment — This feature allows the buyers to notify suppliers about changes in the bid (RFP, RFQ, Tender, RFI, etc.). Addendum/ amendment is used to provide clarifications to inquiries from suppliers, extend the closing date, and suspend or cancel the bid. Under Type of Announcement, select “Addendum/Amendment” option. Enter all the related information for the amendment, select amendment status. Click Next Step. Note Publish Date gives you the option of notifying vendors immediately or at a later date. You can create an amendment notice and save it in the database, and have it released on the date specified. No. is the numbering sequence of the amendment being issued. For example, Amendment 1, Amendment 2, etc. Title is a brief description of the nature of the amendment. For example, if the contract has been extended, you might want to include a short description as follows: “The closing date has been extended until the proposed date.” Status allows you to classify the current condition of the contract. For example, “Revised Date” allows you to revise the closing date, site meeting date (1 or multiple). Questions deadline, NOI date at the same time or one of them. For assistance, please call Biddingo.com at 416-756-0955 25 Adding an Announcement Adding an Announcement (Cont’d) b). Create a Special Notice Special Notice — This feature allows buyers to send special notifications to potential bidders. The special notice feature is NOT used to notify suppliers about changes directly affecting the bid but is used to provide general information such as short listed companies. Under Type of Announcement, select “Special Notice” option. Enter all the related information for the announcement. Click Next Step. Note Publish Date gives you the option of notifying vendors immediately or at a later date. You can create a special notice and save it in the database, and have it released on the date specified. No. is the numbering sequence of the special notice being issued. For example, Special Notice 1, Special Notice 2, etc. Title is a brief description of the nature of the special notice. For example, if the contract has been awarded, you might want to include a short description as follows: “The bid is awarded.” Target allows you to select who can receive special notice email. Choose either Document Takers or Bidders. For assistance, please call Biddingo.com at 416-756-0955 26 Adding an Announcement Adding an Announcement (Cont’d) Step 2. Announcement Details Copy and paste the Announcement details from your local file to the HTML editor provided. Click Next Step to continue. Step 3. Adding Document(s) You now have the option of attaching a document. If you do not wish to add a document, click Publish Preview to skip this step. It is highly recommended that you attach a document if there are any significant changes to the bid document itself. Note: A document can be added in any of the following formats (pdf, Word, Excel, etc.) Click “Browse”, select the file and click “Open”. Type a brief description of the document. For example, “Amendment 1 Document”. Enter the total number of pages. Click Upload Bid Document(s) Your document has now been uploaded! Click Publish Preview For assistance, please call Biddingo.com at 416-756-0955 27 Adding an Announcement Adding an A nnouncement (Cont’d) Announcement Preview When you click Submit for Approval, Biddingo’s Quality Control Staff is alerted with an email requesting an approval. Once the announcement is approved, the system notifies the companies that have downloaded the bid document(s). You will be notified via email of all the successfully delivered and failed emails. You may now submit the announcement for approval, or publish later. For assistance, please call Biddingo.com at 416-756-0955 28 Posting Bid Results Posting Bid Results Once the bid is closed, you can post the bid submission prices. Click Doc. Takers on the list of published bids page, the list of document takers will appear. Click Bids Received to select bidders. Bids Received Use the Bids Received feature to display the bidders and bid prices. If a company that submitted a bid response is not shown on the document takers list, you must add it manually for it to be displayed on the bidders list. For assistance, please call Biddingo.com at 416-756-0955 29 Posting Bid Results Posting Bid Results (Cont’d) You have the option of entering the bid results manually OR uploading the file with the results. Option1. Select the bidders who have submitted their bid responses. Option 2. Upload the bid results file. Recommended for buyers who post their advertisement ONLY. Display – gives you the option whether or not you want to reveal the Bidders, Bid Amount and/or Total required. Enter the dollar ($) amount for each bidder in the appropriate fields and click Save. Bid Price — Enter the prices and the applicable Units of Measure (UOM). Ranking — Enter the number for each supplier. Ranking the suppliers is based on lowest to highest bid prices (1 being the lowest). For assistance, please call Biddingo.com at 416-756-0955 30 Posting Bid Results Posting Bid Results (Cont’d) You can view list of bidders and bid submission price under “Bid Results” Tab. Note: The bid results as displayed are unofficial, and remain under review until awarded by the Bid Owner. Click Email Bid Results to send out email. Email Bid Results The Email Bid Results feature allows buyers to send an email notice to the document takers OR the bidders informing them that the results are available on Biddingo.com. For assistance, please call Biddingo.com at 416-756-0955 31 Awarding the contract Awarding the Contract Once you post the bid submission prices, you can send the award notice to notify all the bidders. It only takes two easy steps to create a new award notice. Step1. Award Notice Basic Info To award the contract, click “Award This Contract” button on the Bid Results page. Choose the recipients you want to notify of the award notice. If you do not want to send an email, select ‘No Email’. Select the awardee(s) and click “Next Step“. For assistance, please call Biddingo.com at 416-756-0955 32 Awarding the contract Awarding the Contract (Cont’d) Step 2. Attach award notice letter(s) Click “Browse” to locate the documents on your computer, and double-click the required file. Under “Letter Description”, enter the brief information. Click “Submit Attachment” button. The letter will be displayed under Letter(s) attached section below. Click “Publish Preview” button to go to the preview page. Award Notice Preview Verify all the information. Click “Edit” to update. You may now submit the award notice for approval, or publish it later. For assistance, please call Biddingo.com at 416-756-0955 33 Awarding the contract Awarding the Contract (Cont’d) After you click “Submit for Approval”, Biddingo’s Quality Control Staff is alerted with an email requesting an approval. Once the award notice is approved, the system notifies the bidders. You will be notified via email of all the successfully delivered and failed emails. (Awarded) and an icon will appear beside the Bid Price for the selected vendor. You have successfully awarded the contract. If you are awarding the contract at a later date, log into the Biddingo system and find your contract. &OLFN“Bid Results” &OLFN“Award This Contract” for the desired vendor For assistance, please call Biddingo.com at 416-756-0955 34 How to Find Suppliers — Create Vendor Application Form How to Find Suppliers Create Vendor Application Form You can create or update your own online vendor application form. Suppliers interested in bidding on your business will complete it in hopes of receiving formal solicitations for goods & services. Step 1 — Basic Information Upload your organization logo Input your company information Upload Vendor Application Instructions For assistance, please call Biddingo.com at 416-756-0955 35 How to Find Suppliers — Create Vendor Application Form Create Vendor Application Form (Cont’d) Step 2 — Select Sections Customize your Vendor Application by adding only those sections that you would like your vendors to complete . In the Available Sections list, click on the check boxes of those sections that you want to add to your customized Selected Sections list. Click on the “Add...” button to move the sections to the Selected Sections list. To remove sections from the Selected Sections list, click Check All or select specific sections and click on the “Remove” button to move them back to the Available Sections list. Once the appropriate sections have been added to the Selected Sections list, they can be further customized by clicking on the check boxes and using the Move Up and Move Down buttons to change the position of the sections. Create “Custom Section” For assistance, please call Biddingo.com at 416-756-0955 36 How to Find Suppliers — Create Vendor Application Form Create Vendor Application Form (Cont’d) Step 3 — Group Sections You can choose display all sections in one page or multiple pages. Step 4 — Select Mandatory Section & Field Check all the fields that are required by suppliers to respond. Select the checkbox beside section title means this whole section as mandatory *. For assistance, please call Biddingo.com at 416-756-0955 37 How to Find Suppliers — Create Vendor Application Form Create Vendor Application Form (Cont’d) Step 5 — Preview your Vendor Application Form Click the Preview button at any time to view your customized application. Click go back to exit the preview and return to the application customization. Once the application is customized to fit your needs, and you like the way it looks, click “Save Vendor Application” to create the final version of your Vendor Application. “Preview” page gives you what your vendor application form would like after publish. For assistance, please call Biddingo.com at 416-756-0955 38 How to Find Suppliers — Sourcing By Biddingo Sourcing By Biddingo 1. Search suppliers by commodity code a). Click one of the main commodity code to view child commodity codes. b). Search Commodity code by keyword or Class Code. To view the list of suppliers under each category, check the checkboxes beside the category, and then click the “View Suppliers” button. For assistance, please call Biddingo.com at 416-756-0955 39 How to Find Suppliers — Sourcing By Biddingo Sourcing By Biddingo (Cont’d) The “list of Suppliers” page shows all the suppliers under each selected categories. You can see the company name, vendor status, and last update date. &OLFN[V] to view the vendor application form. &OLFN[C] or the company name to view the supplier contact information. &OLFN[status] to view Vendor Evaluation History and current status. List of suppliers Click [V] to view each vendor’s application form. For assistance, please call Biddingo.com at 416-756-0955 40 How to Find Suppliers — Sourcing By Biddingo Sourcing By Biddingo (Cont’d) 2. Search suppliers by keyword You can also find suppliers by using our search function. Click “View Suppliers” to go to the search supplier page. Search supplier by keyword. Check “Apply My Power Search Criteria” Option to narrow your search results. Browser My Supplier Alphabetically. A. My Supplier – you can only use this option if you have used Biddingo.com previously, and have built up your organization’s database of suppliers. Use this option to search through your online database of registered companies. B. All Supplier – search Biddingo’s database for the vendors you’re looking for. For assistance, please call Biddingo.com at 416-756-0955 41 How to Find Suppliers — Sourcing By Biddingo Sourcing By Biddingo (Cont’d) Vendor Evaluation List of suppliers Click [Status] to create or update vendor evaluation Click “Create New Evaluation” link to create a new evaluation For assistance, please call Biddingo.com at 416-756-0955 42 How to Track Suppliers — Document Takers List How to Track Suppliers Document Takers List To view a list of document takers for an existing bid, log into www. Biddingo.com and locate the bid on the “List of Published Bids” listing. Click on the “Document Takers” link. “Document Takers List” gives you the overview of the bid activities. Click the column title to sort by ascending or descending order. To view the activity details for each supplier, click the company name. There are several great tools you can use. 7RIRUZDUGGRFXPHQWWDNHUVOLVWWRRWKHU person, click “Email This List”. 7RH[SRUWWR0LFURVRIW2IILFH([FHODQGVDYH as spreadsheet, click “Export to Excel”. “Requirements (NDA, NOI, Site Meeting)” Use this feature to identify the site meeting attendees, suppliers who have completed the Notice of Intent (NOI) and the Non-Disclosure Agreement (NDA). For assistance, please call Biddingo.com at 416-756-0955 43 How to Track Suppliers — Document Takers List Document Takers List (Cont’d) Requirements (NDA, NOI, Site Meeting) NDA — Only suppliers who have completed and submitted the NDA form will have access to the bid documents, and can participate in the bidding process. Future bid information will only be sent to the companies identified through this NDA process. NOI — Only suppliers who have completed and submitted the Notice of Intent document will have access to the bid documents, and can participate in the bidding process. Site Meetings — If the site meeting is flagged as Mandatory, then only those companies can access the bid document and can participate in the bidding process. This feature can also be used to identify the companies who attended voluntary/recommended site meetings. Click the checkbox to select the companies that have met the requirements outlined. Then click “Save and Return to the Document Taker’s List” button to save. The checked marks are displayed beside selected companies under “Requirements” Columns. For assistance, please call Biddingo.com at 416-756-0955 44 How to Track Suppliers — Document Taker Summary Report Document Taker Summary Report “Document Taker Summary Report” gives a breakdown of the original invitees and the methods in which the document(s) were distributed. Invitees — List all the invitees for the invitation bid. Doc. Takers — List the suppliers who have downloaded the bid documents online or purchased document by pick-up. Interested Vendors — List the suppliers who have viewed the bid scope or downloaded documents. For assistance, please call Biddingo.com at 416-756-0955 45 How to Track Suppliers — Document Taker Detailed Report Document Taker Detailed Report “Document Taker Detailed Report” Provides a list of all the companies’ information and the activities related to the bid. Click the icon to show/hide activities for each bidder. For assistance, please call Biddingo.com at 416-756-0955 46 How to Track Suppliers — Document Takers Biddingo Report “Biddingo Report” provides a summary of the suppliers notified of the bid via email and fax. In the case of an invitation, the Purchasing Department provides a list of suppliers; Biddingo’s Customer Service Representatives contact the invitees and records the call activities. Browse of this bid indicates the number of suppliers that have viewed the bid scope. Click “No. of daily emails sent” link to view the list of suppliers that emails sent to. Click “No. of Browse this bid” link to view the list of suppliers have viewed the bid scope. For assistance, please call Biddingo.com at 416-756-0955 47 How to Track Suppliers — Adding Document Takers Adding Document Takers To add document takers, search through all supplier by company Name or/ and location. This allows you to search through all of the suppliers registered in Biddingo’s database. If you are unsuccessful in locating a supplier in the all supplier databases, you can add a supplier by creating a new company. To access the Document Takers list, click Doc. Takers. The list of the Document Takers will display on the screen. Click New Document Taker. Use the search criteria section to locate the suppliers you want to add. From the list of search results, select the invitees by checking the checkbox beside the company or user. If the contact person doesn’t display under the company, select the company, and you can add new contact person at the later stage. If you can’t find the company that you want to invite, you can create a new company by clicking Create New Company. For assistance, please call Biddingo.com at 416-756-0955 48 How to Track Suppliers — Adding Document Takers Adding Document Takers (Cont’d) New Document Taker — Confirmation The Biddingo System Document Taker’s list includes companies that were originally invited through the system or have downloaded the bid package. You can locate and add more companies to the invitation/document taker’s list: 6HOHFWWKH“Invitee” check box to add the invitee to the list. The system sends an email notice to the supplier regarding the bid invitation. 6HOHFWWKH“Doc. Pickup” check box for a company that obtained the document from your Purchasing Department If you locate a company and the contact information does not match that you have on file: &OLFNUpdate to make changes to contact’s current information in the database. Any changes made to the account results in an email being sent to the contact to verify the information, at which point he or she confirms or decline the changes. &OLFNAdd New Contact to enter and save the contact information for someone you’re unable to locate from the Biddingo.com database. Verify the list of manual added document taker(s) and update the status. Resend Invitation – lets you resend an invitation to an added invitee. Once you click on Resend Invitation, a system generated email is sent to the invited company. Update Company Info – Lets you update company’s information. Update document(s) pick up status for current document takers. For assistance, please call Biddingo.com at 416-756-0955 49 How to Track Suppliers — Adding Document Takers Adding Document Takers (Cont’d) Creating a new Supplier’s Profile If you were unsuccessful in locating a supplier in Biddingo.com supplier database, you can add a supplier to the Document Takers list by creating a new company. Click Create New Company to create a new supplier. Always do the search first before creating a new supplier, to ensure there is no duplicated data generated. For assistance, please call Biddingo.com at 416-756-0955 50 Communications Tools — Ask a Question Communications Tools NEW! Ask a Question Suppliers can ask questions through online Vendor Registration landing page. For assistance, please call Biddingo.com at 416-756-0955 51 Communications Tools — Ask a Question NEW! Ask a Question (Cont’d) Answer the question If there are any questions that suppliers posted, you can access them on “My Biddingo” page. Log to Biddingo.com with your user Id and password, and click on the ”My Biddingo” link. You can see “Questions & Answers“ section on “My Summary” page. To answer the question, click on each question. Type our answers in “Responses” field. Check “Publish to public” if you want it publishes online and accesses by everyone. Check “Send email” option if you want to send a email to this supplier. For assistance, please call Biddingo.com at 416-756-0955 52 Communications Tools — Request for Bid Documents Request for Bid Documents The “Request to Send Document” feature allows public sector organizations the opportunity to request bid documents from other buying organizations. To request bid documents, click on the “Request to Send Document” link. The “Request” email will highlight the Bid description, bid number, the brief description of your request, and be sent to the posting buyer directly. The bid owner will review your request, and if accepted, the bid document(s) will be emailed to you. Biddingo.com advocates the sharing of bid documents to all public sector agencies, however some organizations do not wish to provide their bid documents to other buyers. Please note if there is no “Request to Send Document” link, there is no bid document(s) attached to the bid opportunity. Please review the tender advertisement for the contact person. Type the email subject and message, and then click “Send Email to Request Document(s)”. The email will be sent to the posting buyer directly. For assistance, please call Biddingo.com at 416-756-0955 53 Communications Tools — Request for Bid Documents Request for Bid Documents (Cont’d) After receiving the “Request for Bid Documents” email, the bid owner login Biddingo.com, and can see the new request on “My Summary” page under “My Biddingo”. Click on the new request link to see the request details. Click on the “Accept And Send Document” link, and the email with bid documents attached will be sent to the requester. For assistance, please call Biddingo.com at 416-756-0955 54 Setup Department/User Setup Department/User “Setup Department/User” Feature allows you to update your organization information, as well as update, create or delete user profile or departments. Department Access Use the department feature to segregate and restrict access to bids posted by a department. Click Setup Department/User to access your organization department list. 7RDGGQHZGHSDUWPHQWFOLFNNew Dept. (Purchasing, Engineering, Plant and Maintenance, etc.) (QWHUWKH'HSDUWPHQW1DPH'HVFULSWLRQDQGFOLFNSave. The new department will be added under your organization. For assistance, please call Biddingo.com at 416-756-0955 55 Setup Department/User Setup Department/User (Cont’d) Setup User On Department List page, click Setup User. Click Create New User to add a new user. List of Users under each Department Enter the applicable information and click Save. For assistance, please call Biddingo.com at 416-756-0955 56 Setup Department/User Setup Department/User (Cont’d) Assign User Role Click Assign Role Select the User Role from the list (Admin/ Read Only). Create a New User Role Type User Role Name, description and select Access Privilege. Select the applicable functions and click Save. For assistance, please call Biddingo.com at 416-756-0955 57 Bid Activity Report Bid Activity Report “Bid Activity Report” is a powerful tool for you to manage your bids and track bid activities. Summary A For assistance, please call Biddingo.com at 416-756-0955 58 Bid Activity Report Bid Activity Report (Cont’d) Summary B For assistance, please call Biddingo.com at 416-756-0955 59 Bid Activity Report Bid Activity Report (Cont’d) Bid Detail Activity Addendum Detail Activity For assistance, please call Biddingo.com at 416-756-0955 60 Bid Activity Report Bid Activity Report (Cont’d) Award Detail Activity Document Detail Activity For assistance, please call Biddingo.com at 416-756-0955 61 Bid Activity Report Bid Activity Report (Cont’d) Document Sales Summary Buyer Activity Report For assistance, please call Biddingo.com at 416-756-0955 62 Bid Activity Report Bid Activity Report (Cont’d) Vendor Registration For assistance, please call Biddingo.com at 416-756-0955 63 Appendix - Biddingo.com categories. Biddingo.com Categories (Refer to Step 2 on page 5) Category Description Agricultural/ Forestry/ Mining Agricultural Equipment Irrigation systems, harvesters, bailers, farming equipment, etc. tractors, aquaculture equipment Agricultural Products/ Services Assisting in the growing of crops and livestock, seeds, pesticides for crops, limestone, fertilizers, soil, water troughs, baling wire, aquaculture services, animal husbandry, animal feed Forestry Products/ Services Reforestation - Mass Tree Planting, Surveying, Spraying of trees, Tree Pruning/Removal Services (Stump), Grinding and Chipping, etc. lumber, tree consultation, tree treatment, aerial photography, mapping/ cartography, GPS, Firewood, vegetation management, Arborist, etc Mining Products/ Services/ Consulting Gold recovery, aluminum, copper, iron ore, drilling, etc. geo-chronological analyses, surveying, explosives, blasting, etc Automotive/ Industrial Automotive Services Repairs and maintenance of automobiles , storage of autos, towing, trucking services, leasing, rentals, car washes/cleaning, stabilization system, wheel balancing, etc Aviation Supplies/ Services Planes, helicopters, etc., aircraft parts, aerospace engineering, pilots Heavy Equipment/ Vehicles Dump trucks, bull-dozers, cranes, asphalt rollers, etc. tractors Office trailers, skid loader, earthmovers, heavy duty vehicles, excavators, caterpillar, graders, trains etc. Industrial Vehicles/ Equipment Fire trucks, Ambulances, Transport Trucks, Garbage Trucks, Buses (school and commercial), Utility Trucks, Ride-on Lawn Mowers, decontamination trailers, streetcars, ice-resurfacers, office trailers, trains etc Passenger Vehicles Cars, Sports utility vehicles, pick-up trucks, mini vans, police cars, etc. hybrids Recreational Vehicles and Services ATV’s, snowmobiles, RV’s (motor homes, trailers) boats, jet-skis, boat motors, skidoos, motorcycles, bikes, rescue boats, mobile office trailers, rafts etc Tools/ Supplies/ Parts Automotive/aircraft parts/tools/lifts, etc., machine shop tools, anti-freeze, parts, car wash drive through system, pick-up caps, hoists etc Business Services/ Supplies Clothing and Textiles Uniforms, jackets, shoes, linen, laundry services, bedding clothing, mannequins/manikins, footwear, bags, etc Hospitality/ Conference/ Special Events/ Conference and banquet facilities/services, Hotels, Travel Services, Travel Services Fireworks, tents, and equipment rental, exhibitions, party favors, etc Janitorial/ Cleaning Services / Custodial Products/Services, Window Cleaning, Cleaning Supplies and Equipment and Supplies Sanitary Paper Products/Dispensers, Floor Scrubbers, Graffiti Removal. Road sweeping/Cleaning, pressure washing, hand sanitizers, etc Marketing/ Promotional/ Advertising Services Marketing Research, Surveys, Media, Novelty Items, branding, recognition gifts, promotional proposal., call centers, pro shop services, vendor of record process, customer satisfaction survey, etc. For assistance, please call Biddingo.com at 416-756-0955 64 Appendix - Biddingo.com categories. Nursery and Plants Plant services and supplies, seeds Pest Control/Animal Services / Supplies Exterminating/control/relocate and veterinary Services, animal husbandry, coyote collars, caribou capture, Pest Management Services Printing Services/ Graphics/ Imaging/ Printing, design, publishing, film, cameras, printing equipment, Desktop design / Equipment videographer, ID System, license plate, website design, photography services, etc. Real Estate Services Leasing of office space, Property Management, Realtor Consultant, Broker Services, affordable housing etc. Recycling Goods and Waste Removal / Recycling of goods, garbage bins, removal/haulage of hazardous waste. Management Services disposal services, shredding, waste management, bio solid, shredding services, etc Safety Equipment/ Services / Supplies First Aid training/supplies, Safety gears-boots, belts, helmet, Health and safety inspections (Fire Sprinkler systems), lifeline systems, fall arrest, fire extinguishers services and supply, Asbestos Management Plan, emergency standby services, search and rescue, breathing apparatus, etc. Sale of Surplus Goods Sale of Surplus Goods Security Services / Supplies Access control systems, security guards, guard dogs, home alarms, locksmiths, Private investigation services, tracing services, armored services, guns, security software, barcode scanners, parking meters equipment, ID Systems, radar, CCTV, confidential shredding of documents, etc firearms, ammunitions, magazines, holsters Shipping/ Courier, Transportation Services/ Courier, Mailing, Storage/lockers, Moving, Summer Camp Bussing Service, Storage Services Patient Transport, trucking services, taxi, car rental, Shelving, Offsite Media Storage System, etc Signage/ Billboards Road signs, billboards, store and business front signs (electronic and non- electronic), license plates, wayfinding, etc. Computers Computer Hardware Hardware, peripherals and accessories, servers, GPS receivers, refurbished computers, chargers, system storage, I/O Storage, Interactive Response System etc Computer Services Network cabling, repairs/ maintenance of computers, Input and data processing, etc., automated call centre, network assessments, internet services, local network services, digital data network, website developer/ designer, etc Computer Software Computer Software (Licenses, Connexus software, Microsoft software, Phoenics 3.4 etc.), data logger, security software (i.e. anti-virus/spyware) library information system, records management, interactive response system etc IT Consulting Software architects, consulting for computer systems, solutions, infrastructure, Design/Management, informatics professional services, IT security, email marketing services WAN, VoiP etc Construction Bridges/ Elevated Highways/ Tunnels/ Tunnels, Maintenance Of Bridges, Subways, Railroads, Etc. Subways/ Railroads For assistance, please call Biddingo.com at 416-756-0955 65 Appendix - Biddingo.com categories. Building Projects/ Renovation/ Building Construction, Concrete Work, Sidewalks, Steel, Aluminum, Metal Demolition Projects Fabrication, Mortar Renovation, Stone Cladding, Flooring Supplies And Services, Carpentry And Wood Services, Demolition Civil Works, Earth Moving, Site Preparation, Masonry Works, Underground Storage, Fences, Pallet Racking, Millwork, Waterproofing, Parking Lots, Modular Homes, etc Construction Hardware Doors, Windows, Hand-Held Tools, Lumber, Drywall, Handles, Knobs, Fence Materials, Hammers, Nails, Screws, Wires, Locks, Water Meter, etc Construction Materials/ Equipment Concrete Saw, Heavy Duty Drill, Concrete Mixers, Catch-Basins, Aggregates, Granular Materials, Welding Machine, Poles, Sheet Metal, Scaffolding, Traffic Glass Beads etc. Construction/ Project Manager Construction Management And Consulting And General Contracting, Contract Management Electrical Supplies/ Services Electrical Engineering, Services And Supplies, Maintenance./Repairs Of Generators, Lighting Fixtures, Fabricated Steel Crossarms (Poles), Pedestrian lights etc. Heating/Plumbing/ Mechanical Supplies/ Mechanical Engineering, Plumbing Fixtures, Pipe, Valves And Fittings, Services Pumps And Tanks, Water Coolers, Water Heaters, Leak Detection, HVAC, Refrigerant, Hydronics, Unit Heaters, Zone Systems, Evaporative Coolers, Portable Spot Coolers, Ductless Split Systems, Duct Cleaning, Instrumentation And Related Accessories, Refrigeration Systems, Elevators Landscaping/ Grounds Maintenance/ Supplies Landscaping/Grounds Maintenance/Supplies: Fertilizer, Seeds, Sods, Tree Planting, Lawn Mowing, Pond Planters, Bark Mulch, Soil Control, Aquarium/Aquatic Materials, real/artificial turf, vegetation management etc Painting Supplies/ Services Painting Services, Paint, Brushes, Paint Thinner, Road Painting, traffic glass beads, etc Parks/ Recreational Facilities Playgrounds Structures/Equipment, Parks And Recreational Facilities, Pools, Skate Park Systems, Arenas, Graveyards, Golf Courses, Etc. Upgrades And Maintenance, bleachers, playground equipment, etc Roads/ Sewer/ Watermain Roads/Sewer/Watermain Projects-Excavating, Ditch, Culvert, Streetscaping, Traffic Lights, Road Painting, Visors, Polycarb, Asphalt Overlay, Fire Hydrant, Guard Rails, Drainage Systems Roofing Supplies/ Services Roofing Projects, Shingles, Aluminum Siding Water Treatment/ Plants Water Treatment Plants, Purification, Monitoring/ Equipment/ Supplies, Inspection, Maintenance, Water Measuring Devices, Dams, Water Quality, Water Treatment Services/supplies , etc Winter Maintenance/ Supplies Snow Removal, Hauling Of Salt And Sand, Antifreeze Etc. Consulting Services Architectural Consulting/ Interior Design Planning And Designing Of Buildings/Non- Building Structures, Acoustics, Noise & Vibration Control, Interior Spacing/Decorating, Landscape Architecture, Glazing Services, Artsy Stuff, Building Measurement, As-built floor plans services Engineering Various Engineering Disciplines: Drawings, Design Of Roads/Bridges/ Parks, Structural Analysis, Materials/Quality Testing, Directional Drilling, Aerial photography, cadastral survey, seismic upgrade, etc. For assistance, please call Biddingo.com at 416-756-0955 66 Appendix - Biddingo.com categories. Environmental/ Urban Planning Environmental Engineering, Consulting, Marine/Coral Reef Ecosystem, Biodiversity Conservation, Asbestos Management Plan, Leachate Management, Diving Services, Environmental Management Systems/Risk Assessment, Growth Management, Zoning, Transportation Planning, Land Use Planning, historic survery, etc. Financial Services Financial/Insurance Products And Services: Auditors, Investors, Brokers, Banks Atm Machines, General Insurance & Risk Management Services, Consultant Tax Recovery, Purchasing/Corporate Cards, Credit Card Services, Corporate Sponsorship, Auctioneers, Parking Meters, Leasing/ Credit Checks, Actuarial services, POS Sytems, etc Human Resources/ Communications Public/Employee Relations, Benefits/Compensation Administration, Organizational Development, Recruiting/Staffing/Training/Coaching, Job Design, Management Of Call/Contact Centres, Performance Reviews video production, Executive Search etc Legal Services Lawyers, Paralegal Services, Bailiffs, Bankruptcy Administrator, Alternative Dispute Resolution, Civil Litigation, General Corporate Advice And Contracts, Including Leases And Joint-Use Agreements, By-Laws, Etc Management Consulting Feasibility Studies, Statistical Analysis, Business Plans, Best Practices, Business Services, Management Review Etc. Educational/ Recreational Books Reading Materials - Textbooks, Novels, Reference Books, Etc Educational/ Trade Equipment And Supplies Supply And Repair Of Machinery: Taps, Dies And Endmills, Horizontal Library Services/ Supplies Librarian, Reorganization Of Books, Cataloguing Services., Supplies, Research - historic, cultural, records management, library info. system, etc. Musical Instruments/ Supplies/ Services Instruments, Sheet Music And Equipment, Digitization Cabling, Integration System, etc Primary Educational Supplies Art Supplies, Mathematical Supplies, Classroom Supplies, Language Supplies Science Equipment/ Supplies and Laboratory Microscopes, Stereolithography, Rapid Prototyper, Capillary Electrophoresis, Services Femtosecond Fiber Laser, Radio synthesis Module, Laboratory Apparatus/ Equipment, Laboratory Glassware, Sample Testing, R&D, Dry Ice, etc. Sports Equipment / Services Basketballs, Helmets, Footballs, Gym Equipment, Lockers, Mats, Nets Theatrical/ Staging Supplies/ Services Draperies, Stages, Stage Design, Props, Exhibit Set Up, Gallery And Museum, Scaffolding And Rigging Services, sculpting, etc Training/ Education/ Consulting Training Sessions, Programs, Materials, Videos, Special /Education/ Consulting, Interpretations Services, Corporate Training, Transcription Services etc Electronics/ Appliances Audio/ Visual Electronics & Services Televisions, Radios, Microfiche, Data Projectors, Stereo/Sound Systems, Wall Screens, Interactive White Boards, Scanners, Cameras, Sound Engineer, Videographers, GPS, PA Systems etc General Appliances Ranges, Refrigerators, freezers, Microwaves, Coffee Makers, toasters, blenders, slowcookers, Washers And Dryers, Etc For assistance, please call Biddingo.com at 416-756-0955 67 Appendix - Biddingo.com categories. Energy/ Fuel/ Chemical Chemical Products/ Services Industrial Chemicals (ex: benzene), Commercial Chemicals (ex: chlorine) Pool Chemicals, etc. Energy Products/ Services/ Management Hydro, Batteries, Transformers, Consulting, Maintenance Services/ Equipment For Renewable Energy, Generators, Booster pumps, Vending Miser, Energy Efficient Products (Fabricated Steel Crossarms, Energy Audit, Solar Energy, Photovoltaic etc. Fuel Products/ Services Gasoline, Oil, Grease, Diesel, Coal, Biodiesel, Ethanol, Natural Gas, Storage/Fuel Tanks, Natural Gas Boilers, Pipeline Transport Etc. Barrels, Jet Fuel, Engine Oil, Pump gas etc. Renewable Energy Wind power, water power, bio-energy, solar power Food Industry Food Products Fish, Pork, Meat, Utensils (Fork, Spoons, cups, plates, etc), Flatware, Pans, Chinaware, Grains, Meats, Fruits, Vegetables, Oils, Sweets, Snacks, Dairy products, condiments (Ketchup, sugar, salts, spices etc.), tea and coffee Food Services / Supplies/ Equipment Cafeteria Services, Vending Machines, Culinary Services, Culinary Equipment, Nutritionist / Dietitian Services, Food Concessionaire, etc Medical/ Surgical Dental Equipment/ Services Dental Services, Dentists, Dental Chairs, Dental Equipment And Supplies, Etc Medical Consulting/ Services Specialized Doctors, Development Of Wellness Programs, X-Ray Technician, Ultrasound Technician, Physiotherapy, Optical Services, Clinical Services, Sensory Rooms, Epidemiological Studies, etc Medical Equipment/ Instruments Ultrasound Units, X-Ray Machines, Hospital Beds, Etc. Medical cameras, microscopes, ventilators, prosthetics, orthotics Medical Supplies Bandages, Dressings, Syringes, Catheters, Test Kits, Diapers, Examination gloves, crutches, masks, scrubs, medicine containers/packaging, hand sanitizers etc. Pharmaceuticals/ Services Drugs And Services, Testing, R&D, Dispensing, packaging of drugs like Bristol packs, prescription/over the counter drugs Social Programs/ Services Employee Health, Rehabilitation And Employee Assistance Program (EAP) - Consultant Psychiatrist, Etc. Health & Safety Programs, Home Care, Barber Services, Social Housing, Nutritionist Services Office Supplies Furniture/ Other Specialty Wares Furniture- Desks, Chairs, Tables, Sofas, Beds, System Furniture, Hair Salon Chairs, Etc. Cubicles/room dividers, Filing cabinets, offsite media storage etc General Supplies Staplers, Hanging Folders, File Folders, Tape, Pencils, Pens, White Out, Dry Erase Markers, Toner Cartridge, Ink Whiteboards, corkboards, etc Office Equipment/ Services Photocopiers, Scanners, Printers, Fax Machines, Parts/Services (Not (excluding computers!) &RPSXWHUV ,QWHUDFWLYH:KLWH%RDUGV%DUFRGH6FDQQHUV0LFURILOP Scanners etc. Paper/ Stationery Paper Products (Fax, Printer And Photocopier Paper), Envelopes, Notepads, Message Pads, Etc For assistance, please call Biddingo.com at 416-756-0955 68 Appendix - Biddingo.com categories. Telecommunications Network Cabling/ Fibre Optics Products Routers, Cabling Supplies, Ethernet Etc. Switches. Wall plates (Jacks) , wire and Services crimpers/ strippers Tele-Consulting/ Services Consulting For Telecommunication Companies, Telephone, Internet WAN, VoiP, Broadband/Internet Protocol Networking Devices etc Telecom Equipment/ Supplies and services Phone Systems, Paging, Cellular Phones, Two-Way Radios (alternative: radio communications), Voicemail, Etc. Radios/ Walkie Talkies, GPS Receivers Satellite, Digital/Analog phones, Headsets, video conferencing Unclassified Categories Miscellaneous Bids located within this category are not classified in the existing Biddingo categories. For assistance, please call Biddingo.com at 416-756-0955 69 Biddingo.com Phone: 416-756-0955 Fax: 416-756-9294 Toll Free: 1-888-891-8314 Mailing Address: Biddingo.com 1210 Sheppard Ave. East, Suite 305 Toronto, Ontario M2K 1E3 If you’re interested in obtaining more information about advertising your bid opportunities on the Biddingo system, simply call us at 416-756-0955 or send an email to one of the contacts below: Buyer Support Team: BCM/ CCMS/ e-Prequal Inquiries: James Polera | 416.756.0955 x 223 | [email protected] e-Bidding Inquiries: Teresita Barcena | 416.756.0955 x 252 | [email protected] e-Tendering Inquiries: Clarita Flores | 416.756.0955 x 227 | [email protected] Manager: Lani Domaloy | 416.756.0955 x 239 | [email protected] For assistance, please call Biddingo.com at 416-756-0955 70