GNRH2 (NM 178331) Human Tagged ORF Clone – RC211474

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC211474

GNRH2 (NM_178331) Human Tagged ORF Clone Product data:

Product Type: Expression Plasmids Product Name: GNRH2 (NM_178331) Human Tagged ORF Clone Tag: Myc-DDK Symbol: GNRH2 Synonyms: GnRH-II; LH-RHII Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC211474 representing NM_178331 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC

ATGGCCAGCTCCAGGCGAGGCCTCCTGCTCCTGCTGCTGCTGACTGCCCACCTTGGACCCTCAGAGGCTC AGCACTGGTCCCATGGCTGGTACCCTGGAGGAAAGCGAGCCCTCAGCTCAGCCCAGGATCCCCAGAATGC CCTTAGGCCCCCAGCAGGCAGCCCAGTCCAGACTGCCCATGGCCTCCCAAGTGATGCCCTGGCTCCCCTG GACGACAGCATGCCCTGGGAGGGCAGGACCACGGCCCAGTGGTCCCTTCACAGGAAGCGACACCTGGCAC GGACACTGCTGACCGCAGCCCGAGAGCCCCGCCCCGCCCCGCCATCCTCCAATAAAGTG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC211474 representing NM_178331 Red=Cloning site Green=Tags(s)

MASSRRGLLLLLLLTAHLGPSEAQHWSHGWYPGGKRALSSAQDPQNALRPPAGSPVQTAHGLPSDALAPL DDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV

myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk6473_e07.zip Restriction Sites: SgfI-MluI

This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 GNRH2 (NM_178331) Human Tagged ORF Clone – RC211474

Cloning Scheme:

Plasmid Map:

ACCN: NM_178331 ORF Size: 339 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info

This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 GNRH2 (NM_178331) Human Tagged ORF Clone – RC211474

OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_178331.2 RefSeq Size: 402 bp RefSeq ORF: 342 bp Locus ID: 2797 UniProt ID: O43555

Protein Families: Druggable Genome, Secreted Protein Protein Pathways: GnRH signaling pathway MW: 9.8 kDa Gene Summary: This gene is a member of the gonadotropin-releasing hormone (GnRH) gene family. Proteins encoded by members of this gene family are proteolytically cleaved to form neuropeptides which, in part, regulate reproductive functions by stimulating the production and release of the gonadotropins follicle-stimulating hormone (FSH) and luteinizing hormone (LH). The human GNRH2 gene is predicted to encode a preproprotein from which a mature neuropeptide of 10 amino acids is cleaved. However, while the human genome retains the sequence for a functional GNRH2 decapeptide, translation of the human GNRH2 gene has not yet been demonstrated and the GNRH2 gene of chimpanzees, gorilla, and Sumatran orangutan have a premature stop at codon eight of the decapeptide sequence which suggests GNRH2 was a pseudogene in the hominid lineage. The GNRH2 gene is also believed to be a pseudogene in many other mammalian species such as mouse and cow. The receptor for this gene (GNRHR2) is predicted to be a pseudogene in human as well as many other mammalian species. The closely related GNRH1 and GNRHR1 genes are functional in human and other mammals and are generally functional in vertebrates. [provided by RefSeq, Mar 2019]

Product images:

Western blot validation of overexpression lysate (Cat# [LY419904]) using anti-DDK antibody (Cat# [TA50011-100]). Left: Cell lysates from un- transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with [RC214336] using transfection reagent MegaTran 2.0 (Cat# [TT210002]).