DOCSLIB.ORG

GNRH2 (NM 178331) Human Tagged ORF Clone – RC211474

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
GNRH2 (NM 178331) Human Tagged ORF Clone – RC211474 OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC211474 GNRH2 (NM_178331) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: GNRH2 (NM_178331) Human Tagged ORF Clone Tag: Myc-DDK Symbol: GNRH2 Synonyms: GnRH-II; LH-RHII Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC211474 representing NM_178331 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCAGCTCCAGGCGAGGCCTCCTGCTCCTGCTGCTGCTGACTGCCCACCTTGGACCCTCAGAGGCTC AGCACTGGTCCCATGGCTGGTACCCTGGAGGAAAGCGAGCCCTCAGCTCAGCCCAGGATCCCCAGAATGC CCTTAGGCCCCCAGCAGGCAGCCCAGTCCAGACTGCCCATGGCCTCCCAAGTGATGCCCTGGCTCCCCTG GACGACAGCATGCCCTGGGAGGGCAGGACCACGGCCCAGTGGTCCCTTCACAGGAAGCGACACCTGGCAC GGACACTGCTGACCGCAGCCCGAGAGCCCCGCCCCGCCCCGCCATCCTCCAATAAAGTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC211474 representing NM_178331 Red=Cloning site Green=Tags(s) MASSRRGLLLLLLLTAHLGPSEAQHWSHGWYPGGKRALSSAQDPQNALRPPAGSPVQTAHGLPSDALAPL DDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk6473_e07.zip Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 GNRH2 (NM_178331) Human Tagged ORF Clone – RC211474 Cloning Scheme: Plasmid Map: ACCN: NM_178331 ORF Size: 339 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 GNRH2 (NM_178331) Human Tagged ORF Clone – RC211474 OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_178331.2 RefSeq Size: 402 bp RefSeq ORF: 342 bp Locus ID: 2797 UniProt ID: O43555 Protein Families: Druggable Genome, Secreted Protein Protein Pathways: GnRH signaling pathway MW: 9.8 kDa Gene Summary: This gene is a member of the gonadotropin-releasing hormone (GnRH) gene family. Proteins encoded by members of this gene family are proteolytically cleaved to form neuropeptides which, in part, regulate reproductive functions by stimulating the production and release of the gonadotropins follicle-stimulating hormone (FSH) and luteinizing hormone (LH). The human GNRH2 gene is predicted to encode a preproprotein from which a mature neuropeptide of 10 amino acids is cleaved. However, while the human genome retains the sequence for a functional GNRH2 decapeptide, translation of the human GNRH2 gene has not yet been demonstrated and the GNRH2 gene of chimpanzees, gorilla, and Sumatran orangutan have a premature stop at codon eight of the decapeptide sequence which suggests GNRH2 was a pseudogene in the hominid lineage. The GNRH2 gene is also believed to be a pseudogene in many other mammalian species such as mouse and cow. The receptor for this gene (GNRHR2) is predicted to be a pseudogene in human as well as many other mammalian species. The closely related GNRH1 and GNRHR1 genes are functional in human and other mammals and are generally functional in vertebrates. [provided by RefSeq, Mar 2019] Product images: Western blot validation of overexpression lysate (Cat# [LY419904]) using anti-DDK antibody (Cat# [TA50011-100]). Left: Cell lysates from un- transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with [RC214336] using transfection reagent MegaTran 2.0 (Cat# [TT210002]). This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.
Load more

Recommended publications
  • Supplementary Materials
    Supplementary materials Supplementary Table S1: MGNC compound library Ingredien Molecule Caco- Mol ID MW AlogP OB (%) BBB DL FASA- HL t Name Name 2 shengdi MOL012254 campesterol 400.8 7.63 37.58 1.34 0.98 0.7 0.21 20.2 shengdi MOL000519 coniferin 314.4 3.16 31.11 0.42 -0.2 0.3 0.27 74.6 beta- shengdi MOL000359 414.8 8.08 36.91 1.32 0.99 0.8 0.23 20.2 sitosterol pachymic shengdi MOL000289 528.9 6.54 33.63 0.1 -0.6 0.8 0 9.27 acid Poricoic acid shengdi MOL000291 484.7 5.64 30.52 -0.08 -0.9 0.8 0 8.67 B Chrysanthem shengdi MOL004492 585 8.24 38.72 0.51 -1 0.6 0.3 17.5 axanthin 20- shengdi MOL011455 Hexadecano 418.6 1.91 32.7 -0.24 -0.4 0.7 0.29 104 ylingenol huanglian MOL001454 berberine 336.4 3.45 36.86 1.24 0.57 0.8 0.19 6.57 huanglian MOL013352 Obacunone 454.6 2.68 43.29 0.01 -0.4 0.8 0.31 -13 huanglian MOL002894 berberrubine 322.4 3.2 35.74 1.07 0.17 0.7 0.24 6.46 huanglian MOL002897 epiberberine 336.4 3.45 43.09 1.17 0.4 0.8 0.19 6.1 huanglian MOL002903 (R)-Canadine 339.4 3.4 55.37 1.04 0.57 0.8 0.2 6.41 huanglian MOL002904 Berlambine 351.4 2.49 36.68 0.97 0.17 0.8 0.28 7.33 Corchorosid huanglian MOL002907 404.6 1.34 105 -0.91 -1.3 0.8 0.29 6.68 e A_qt Magnogrand huanglian MOL000622 266.4 1.18 63.71 0.02 -0.2 0.2 0.3 3.17 iolide huanglian MOL000762 Palmidin A 510.5 4.52 35.36 -0.38 -1.5 0.7 0.39 33.2 huanglian MOL000785 palmatine 352.4 3.65 64.6 1.33 0.37 0.7 0.13 2.25 huanglian MOL000098 quercetin 302.3 1.5 46.43 0.05 -0.8 0.3 0.38 14.4 huanglian MOL001458 coptisine 320.3 3.25 30.67 1.21 0.32 0.9 0.26 9.33 huanglian MOL002668 Worenine
    [Show full text]
  • Food Deprivation Explains Effects of Mouthbrooding on Ovaries and Steroid Hormones, but Not Brain Neuropeptide and Receptor Mrnas, in an African Cichlid fish
    Hormones and Behavior 62 (2012) 18–26 Contents lists available at SciVerse ScienceDirect Hormones and Behavior journal homepage: www.elsevier.com/locate/yhbeh Food deprivation explains effects of mouthbrooding on ovaries and steroid hormones, but not brain neuropeptide and receptor mRNAs, in an African cichlid fish Brian P. Grone ⁎,1, Russ E. Carpenter, Malinda Lee, Karen P. Maruska, Russell D. Fernald Biology Department, Stanford University, Stanford, CA 94305‐5020, USA article info abstract Article history: Feeding behavior and reproduction are coordinately regulated by the brain via neurotransmitters, circulating Received 19 December 2011 hormones, and neuropeptides. Reduced feeding allows animals to engage in other behaviors important for Revised 10 April 2012 fitness, including mating and parental care. Some fishes cease feeding for weeks at a time in order to provide Accepted 15 April 2012 care to their young by brooding them inside the male or female parent's mouth. Maternal mouthbrooding is Available online 26 April 2012 known to impact circulating hormones and subsequent reproductive cycles, but neither the full effects of food deprivation nor the neural mechanisms are known. Here we ask what effects mouthbrooding has on Keywords: Feeding several physiological processes including gonad and body mass, brain neuropeptide and receptor gene ex- Reproduction pression, and circulating steroid hormones in a mouthbrooding cichlid species, Astatotilapia burtoni.We Parental care ask whether any observed changes can be explained by food deprivation, and show that during mouthbrood- Teleost ing, ovary size and circulating levels of androgens and estrogens match those seen during food deprivation. Cichlid Levels of gonadotropin-releasing hormone 1 (GnRH1) mRNA in the brain were low in food-deprived females Testosterone compared to controls and in mouthbrooding females compared to gravid females.
    [Show full text]
  • (12) Patent Application Publication (10) Pub. No.: US 2003/0106074 A1 Serafini (43) Pub
    US 2003O106074A1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2003/0106074 A1 Serafini (43) Pub. Date: Jun. 5, 2003 (54) COLLECTIONS OF TRANSGENIC ANIMAL Publication Classification LINES (LIVING LIBRARY) (51) Int. Cl." ...................... A01K 67/033; AO1K 67/027 (76) Inventor: Tito Andrew Serafini, San Mateo, CA (52) U.S. Cl. ................................................... 800/8: 800/14 (US) (57) ABSTRACT Correspondence Address: The invention provides collections of transgenic animals and PENNIE AND EDMONDS vectors for producing transgenic animals, which transgenic 1155 AVENUE OF THE AMERICAS animals and vectors have a transgene comprising Sequences NEW YORK, NY 100362711 encoding a detectable or Selectable marker, the expression of which marker is under the control of regulatory Sequences (21) Appl. No.: 10/077,025 from an endogenous gene Such that when the transgene is present in the genome of the transgenic animal, the detect (22) Filed: Feb. 14, 2002 able or Selectable marker has the same expression pattern as the endogenous gene. Such transgenic animals can then be Related U.S. Application Data used to detect, isolate and/or Select pure populations of cells having a particular functional characteristic. The isolated (63) Continuation-in-part of application No. 09/783,487, cells have uses in gene discovery, target identification and filed on Feb. 14, 2001. validation, genomic and proteomic analysis, etc. Patent Application Publication Jun. 5, 2003. Sheet 1 of 13 US 2003/0106074 A1 sixxx; : ?,graecaeaeaeaeae ·:>`()~(ºrº?anaeru: !!¿*(:,!!!!!(!!!!!..”):straes) - k wis **** ************ FIG . 1 A FIG. 1B Patent Application Publication Jun. 5, 2003. Sheet 2 of 13 US 2003/0106074 A1 clone2 *********** ******$$x***** *******.
    [Show full text]
  • The DNA Sequence and Comparative Analysis of Human Chromosome 20
    articles The DNA sequence and comparative analysis of human chromosome 20 P. Deloukas, L. H. Matthews, J. Ashurst, J. Burton, J. G. R. Gilbert, M. Jones, G. Stavrides, J. P. Almeida, A. K. Babbage, C. L. Bagguley, J. Bailey, K. F. Barlow, K. N. Bates, L. M. Beard, D. M. Beare, O. P. Beasley, C. P. Bird, S. E. Blakey, A. M. Bridgeman, A. J. Brown, D. Buck, W. Burrill, A. P. Butler, C. Carder, N. P. Carter, J. C. Chapman, M. Clamp, G. Clark, L. N. Clark, S. Y. Clark, C. M. Clee, S. Clegg, V. E. Cobley, R. E. Collier, R. Connor, N. R. Corby, A. Coulson, G. J. Coville, R. Deadman, P. Dhami, M. Dunn, A. G. Ellington, J. A. Frankland, A. Fraser, L. French, P. Garner, D. V. Grafham, C. Grif®ths, M. N. D. Grif®ths, R. Gwilliam, R. E. Hall, S. Hammond, J. L. Harley, P. D. Heath, S. Ho, J. L. Holden, P. J. Howden, E. Huckle, A. R. Hunt, S. E. Hunt, K. Jekosch, C. M. Johnson, D. Johnson, M. P. Kay, A. M. Kimberley, A. King, A. Knights, G. K. Laird, S. Lawlor, M. H. Lehvaslaiho, M. Leversha, C. Lloyd, D. M. Lloyd, J. D. Lovell, V. L. Marsh, S. L. Martin, L. J. McConnachie, K. McLay, A. A. McMurray, S. Milne, D. Mistry, M. J. F. Moore, J. C. Mullikin, T. Nickerson, K. Oliver, A. Parker, R. Patel, T. A. V. Pearce, A. I. Peck, B. J. C. T. Phillimore, S. R. Prathalingam, R. W. Plumb, H. Ramsay, C. M.
    [Show full text]
  • Gnrhr2 (67-R): Sc-100301
    SANTA CRUZ BIOTECHNOLOGY, INC. GnRHR2 (67-R): sc-100301 BACKGROUND PRODUCT Gonadotropin-releasing hormone (GnRH) is released in a pulsatile manner that Each vial contains 100 µg IgG2a kappa light chain in 1.0 ml of PBS with varies with the reproductive cycle. This hypothalamic hormone is transported < 0.1% sodium azide and 0.1% gelatin. to the pituitary, where it binds to specific receptors and regulates the synthe- sis and release of luteinizing hormone (LH) and follicle-stimulating hormone APPLICATIONS (FSH). GnRHR2 (Gonadotropin-releasing hormone (type 2) receptor 2), also GnRHR2 (67-R) is recommended for detection of GnRHR2 of human origin known as GnRH II-R, is a 379 amino acid multi-pass membrane protein that by Western Blotting (starting dilution 1:200, dilution range 1:100-1:1000), is expressed in a variety of tissues, where it functions as a G protein-coupled immunoprecipitation [1-2 µg per 100-500 µg of total protein (1 ml of cell receptor for GnRH. Localized to the cell membrane, GnRHR2 mediates its own lysate)] and solid phase ELISA (starting dilution 1:30, dilution range 1:30- receptor activity via association with G proteins, thereby activating a phospha- 1:3000). tidylinositol-calcium second messenger system that regulates GnRHR2 func- tion. GnRHR2 is thought to have potent antiproliferative effects on ovarian and Suitable for use as control antibody for GnRHR2 siRNA (h): sc-108007, endometrial cancer cells, suggesting a possible role in tumor suppression. Due GnRHR2 shRNA Plasmid (h): sc-108007-SH and GnRHR2 shRNA (h) Lenti- to alternative splicing events, GnRHR2 is expressed as two isoforms.
    [Show full text]
  • Views of the NIDA, NINDS Or the National Summed Across the Three Auditory Forebrain Lobule Sec- Institutes of Health
    Xie et al. BMC Biology 2010, 8:28 http://www.biomedcentral.com/1741-7007/8/28 RESEARCH ARTICLE Open Access The zebra finch neuropeptidome: prediction, detection and expression Fang Xie1, Sarah E London2,6, Bruce R Southey1,3, Suresh P Annangudi1,6, Andinet Amare1, Sandra L Rodriguez-Zas2,3,5, David F Clayton2,4,5,6, Jonathan V Sweedler1,2,5,6* Abstract Background: Among songbirds, the zebra finch (Taeniopygia guttata) is an excellent model system for investigating the neural mechanisms underlying complex behaviours such as vocal communication, learning and social interactions. Neuropeptides and peptide hormones are cell-to-cell signalling molecules known to mediate similar behaviours in other animals. However, in the zebra finch, this information is limited. With the newly-released zebra finch genome as a foundation, we combined bioinformatics, mass-spectrometry (MS)-enabled peptidomics and molecular techniques to identify the complete suite of neuropeptide prohormones and final peptide products and their distributions. Results: Complementary bioinformatic resources were integrated to survey the zebra finch genome, identifying 70 putative prohormones. Ninety peptides derived from 24 predicted prohormones were characterized using several MS platforms; tandem MS confirmed a majority of the sequences. Most of the peptides described here were not known in the zebra finch or other avian species, although homologous prohormones exist in the chicken genome. Among the zebra finch peptides discovered were several unique vasoactive intestinal and adenylate cyclase activating polypeptide 1 peptides created by cleavage at sites previously unreported in mammalian prohormones. MS-based profiling of brain areas required for singing detected 13 peptides within one brain nucleus, HVC; in situ hybridization detected 13 of the 15 prohormone genes examined within at least one major song control nucleus.
    [Show full text]
  • Kisspeptin and Gonadotropin-Releasing Hormone Signaling in Skeletal Muscle
    KISSPEPTIN AND GONADOTROPIN-RELEASING HORMONE SIGNALING IN SKELETAL MUSCLE A Thesis Presented to the Faculty of the Graduate School of Cornell University In Partial Fulfillment of the Requirements for the Degree of Master of Science by Lauren Mary Varvatos August 2019 © 2019 Lauren Mary Varvatos ABSTRACT Chronic inflammation contributes to skeletal muscle atrophy and impaired regenerative capacity. Previous research has identified skeletal muscle inflammatory susceptibility (MuIS), or the ability to manage and respond to inflammation, as a predictor of failed skeletal muscle regeneration and regrowth following surgery. This inflammatory susceptibility is associated with human aging and likely contributes to the adverse structural, metabolic, and functional tissue remodeling that occurs in aged adults. The etiology for heightened inflammation in skeletal muscle is unclear, particularly in healthy young adults. Research that elucidates the mechanisms by which inflammation impairs skeletal muscle regeneration is necessary for identifying potential therapeutic targets. Previous research from our laboratory identified kisspeptin-1 (KISS1) as a highly differentially expressed gene (DEgene) associated with lower inflammatory susceptibility (MuIS-) in human skeletal muscle. When the MuIS- group was compared to a group with an improved hypertrophic response to resistance training, gonadotropin-releasing hormone (GnRH) signaling emerged as a top canonical pathway. In the present study, we aimed to investigate the potential relationship between KISS1/GnRH signaling and inflammation in skeletal muscle and elucidate the relevant signaling pathways. The presence of the GnRH receptor (GnRHr) was assessed in the skeletal muscle of mice genetically modified to constitutively express β-galactosidase at the GnRHr promoter (RG) and wild type (WT) mice using a β-galactosidase gene detection assay.
    [Show full text]
  • Addiction-Related Genes in Gambling Disorders: New Insights from Parallel Human and Pre-Clinical Models
    Molecular Psychiatry (2015) 20, 1002–1010 © 2015 Macmillan Publishers Limited All rights reserved 1359-4184/15 www.nature.com/mp ORIGINAL ARTICLE Addiction-related genes in gambling disorders: new insights from parallel human and pre-clinical models DSS Lobo1,2, L Aleksandrova2,3, J Knight1,2, DM Casey4, N el-Guebaly5, JN Nobrega2,6 and JL Kennedy1,2 Neurobiological research supports the characterization of disordered gambling (DG) as a behavioral addiction. Recently, an animal model of gambling behavior was developed (rat gambling task, rGT), expanding the available tools to investigate DG neurobiology. We investigated whether rGT performance and associated risk gene expression in the rat’s brain could provide cross-translational understanding of the neuromolecular mechanisms of addiction in DG. We genotyped tagSNPs (single-nucleotide polymorphisms) in 38 addiction-related genes in 400 DG and 345 non-DG subjects. Genes with Po0.1 in the human association analyses were selected to be investigated in the animal arm to determine whether their mRNA expression in rats was associated with the rat’s performance on the rGT. In humans, DG was significantly associated with tagSNPs in DRD3 (rs167771) and CAMK2D (rs3815072). Our results suggest that age and gender might moderate the association between CAMK2D and DG. Moderation effects could not be investigated due to sample power. In the animal arm, only the association between rGT performance and Drd3 expression remained significant after Bonferroni correction for 59 brain regions. As male rats were used, gender effects could not be investigated. Our results corroborate previous findings reporting the involvement of DRD3 receptor in addictions.
    [Show full text]
  • Anti-GNRH2 / Progonadoliberin 2 Antibody (ARG58877)
    Product datasheet [email protected] ARG58877 Package: 100 μl anti-GNRH2 / Progonadoliberin 2 antibody Store at: -20°C Summary Product Description Rabbit Polyclonal antibody recognizes GNRH2 / Progonadoliberin 2 Tested Reactivity Hu, Ms, Rat Tested Application IHC-P Host Rabbit Clonality Polyclonal Isotype IgG Target Name GNRH2 / Progonadoliberin 2 Antigen Species Human Immunogen Recombinant fusion protein corresponding to aa. 24-120 of Human GNRH2 / Progonadoliberin 2 (NP_001492.1). Conjugation Un-conjugated Alternate Names Gonadotropin-releasing hormone II; Progonadoliberin II; Gonadoliberin II; Progonadoliberin-2; GnRH II; GnRH-associated peptide II; Luliberin II; GnRH-II; Luteinizing hormone-releasing hormone II; LH-RHII; LH- RH II Application Instructions Application table Application Dilution IHC-P 1:50 - 1:100 Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. Calculated Mw 13 kDa Observed Size 20 kDa Properties Form Liquid Purification Affinity purified. Buffer PBS (pH 7.3), 0.02% Sodium azide and 50% Glycerol. Preservative 0.02% Sodium azide Stabilizer 50% Glycerol Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. Note For laboratory research only, not for drug, diagnostic or other use. www.arigobio.com 1/2 Bioinformation Gene Symbol GNRH2 Gene Full Name gonadotropin-releasing hormone 2 Background This gene encodes a secreted peptide hormone and member of the gonadotropin-releasing hormone (GnRH) family of proteins.
    [Show full text]
  • Characterization of Gnrh/Gnih Elements in the Olfacto-Retinal System and Ovary During Zebrafish Ovarian Maturation
    Molecular and Cellular Endocrinology 450 (2017) 1e13 Contents lists available at ScienceDirect Molecular and Cellular Endocrinology journal homepage: www.elsevier.com/locate/mce Characterization of Gnrh/Gnih elements in the olfacto-retinal system and ovary during zebrafish ovarian maturation Sheryll Corchuelo a, Emanuel R.M. Martinez d, Arno J. Butzge a, d, Lucas B. Doretto d, ** Juliana M.B. Ricci d, Fernanda N. Valentin a, Laura S.O. Nakaghi b, , Gustavo M. Somoza c, * Rafael H. Nobrega d, a Aquaculture Center of Sao~ Paulo State University (CAUNESP), Jaboticabal, Sao~ Paulo, Brazil b Department of Animal Morphology and Physiology, Sao~ Paulo State University (UNESP), Jaboticabal, Sao~ Paulo, Brazil c Laboratorio de Ictiofisiología y Acuicultura, Instituto de Investigaciones Biotecnologicas-Instituto Tecnologico de Chascomús (CONICET-UNSAM), Chascomús, Argentina d Reproductive and Molecular Biology Group, Department of Morphology, Institute of Bioscience of Botucatu, Sao~ Paulo State University, Botucatu, Sao~ Paulo, Brazil article info abstract Article history: Gonadotropin releasing hormone (GnRH) is one of the key players of brain-pituitary-gonad axis, exerting Received 2 December 2016 overall control over vertebrate reproduction. In zebrafish, two variants were characterized and named as Received in revised form Gnrh2 and Gnrh3. In this species, Gnrh3, the hypohysiotropic form, is expressed by neurons of the 15 March 2017 olfactory-retinal system, where it is related with food detection, intra/interspecific recognition, visual Accepted
    [Show full text]
  • Gnrh2 Maintains Reproduction in Fasting Zebrafish Through Dynamic Neuronal Projection Changes and Regulation of Gonadotropin
    www.nature.com/scientificreports OPEN Gnrh2 maintains reproduction in fasting zebrafsh through dynamic neuronal projection changes and regulation of gonadotropin synthesis, oogenesis, and reproductive behaviors Miranda Marvel1, Berta Levavi‑Sivan2, Ten‑Tsao Wong1, Nilli Zmora1 & Yonathan Zohar1* Restricted food intake, either from lack of food sources or endogenous fasting, during reproductive periods is a widespread phenomenon across the animal kingdom. Considering previous studies show the canonical upstream regulator of reproduction in vertebrates, the hypothalamic Gonadotropin‑ releasing hormone (Gnrh), is inhibited in some fasting animals, we sought to understand the neuroendocrine control of reproduction in fasted states. Here, we explore the roles of the midbrain neuropeptide, Gnrh2, in inducing reproduction via its pituitary prevalence, gonadotropin synthesis, gametogenesis, and reproductive outputs in the zebrafsh model undergoing diferent feeding regimes. We discovered a fasting‑induced four‑fold increase in length and abundance of Gnrh2 neuronal projections to the pituitary and in close proximity to gonadotropes, whereas the hypothalamic Gnrh3 neurons are reduced by six‑fold in length. Subsequently, we analyzed the functional roles of Gnrh2 by comparing reproductive parameters of a Gnrh2‑depleted model, gnrh2−/−, to wild‑type zebrafsh undergoing diferent feeding conditions. We found that Gnrh2 depletion in fasted states compromises spawning success, with associated decreases in gonadotropin production, oogenesis, fecundity,
    [Show full text]
  • Gonadotropin-Releasing Hormone Neuron Development in Vertebrates T ⁎ Cunming Duan , John Allard
    General and Comparative Endocrinology 292 (2020) 113465 Contents lists available at ScienceDirect General and Comparative Endocrinology journal homepage: www.elsevier.com/locate/ygcen Gonadotropin-releasing hormone neuron development in vertebrates T ⁎ Cunming Duan , John Allard Department of Molecular, Cellular, and Developmental Biology, University of Michigan, Ann Arbor, MI 48109, United States ARTICLE INFO ABSTRACT Keywords: Gonadotropin-releasing hormone (GnRH) neurons are master regulators of the reproductive axis in vertebrates. Gonadotropin-releasing hormone During early mammalian embryogenesis, GnRH1 neurons emerge in the nasal/olfactory placode. These neurons Fibroblast growth factor undertake a long-distance migration, moving from the nose to the preoptic area and hypothalamus. While Insulin-like growth factor significant advances have been made in understanding the functional importance of the GnRH1 neurons in Kisspeptin reproduction, where GnRH1 neurons come from and how are they specified during early development is still Embryogenesis under debate. In addition to the GnRH1 gene, most vertebrate species including humans have one or two ad- Zebrafish Medaka ditional GnRH genes. Compared to the GnRH1 neurons, much less is known about the development and reg- ulation of GnRH2 neuron and GnRH3 neurons. The objective of this article is to review what is currently known about GnRH neuron development. We will survey various cell autonomous and non-autonomous factors im- plicated in the regulation of GnRH neuron development. Finally, we will discuss emerging tools and new ap- proaches to resolve open questions pertaining to GnRH neuron development. 1. Introduction seabream, medaka, lamprey (an agnathan), and skate (a cartilaginous fish) (Bassi et al., 2016; Oka, 2009; Powell et al., 1994; Roch et al., In humans and the other vertebrates, reproduction is under the 2014).
    [Show full text]