Chromosomal Instability and Phosphoinositide Pathway Gene Signatures in Glioblastoma Multiforme
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Analyses of Allele-Specific Gene Expression in Highly Divergent
ARTICLES Analyses of allele-specific gene expression in highly divergent mouse crosses identifies pervasive allelic imbalance James J Crowley1,10, Vasyl Zhabotynsky1,10, Wei Sun1,2,10, Shunping Huang3, Isa Kemal Pakatci3, Yunjung Kim1, Jeremy R Wang3, Andrew P Morgan1,4,5, John D Calaway1,4,5, David L Aylor1,9, Zaining Yun1, Timothy A Bell1,4,5, Ryan J Buus1,4,5, Mark E Calaway1,4,5, John P Didion1,4,5, Terry J Gooch1,4,5, Stephanie D Hansen1,4,5, Nashiya N Robinson1,4,5, Ginger D Shaw1,4,5, Jason S Spence1, Corey R Quackenbush1, Cordelia J Barrick1, Randal J Nonneman1, Kyungsu Kim2, James Xenakis2, Yuying Xie1, William Valdar1,4, Alan B Lenarcic1, Wei Wang3,9, Catherine E Welsh3, Chen-Ping Fu3, Zhaojun Zhang3, James Holt3, Zhishan Guo3, David W Threadgill6, Lisa M Tarantino7, Darla R Miller1,4,5, Fei Zou2,11, Leonard McMillan3,11, Patrick F Sullivan1,5,7,8,11 & Fernando Pardo-Manuel de Villena1,4,5,11 Complex human traits are influenced by variation in regulatory DNA through mechanisms that are not fully understood. Because regulatory elements are conserved between humans and mice, a thorough annotation of cis regulatory variants in mice could aid in further characterizing these mechanisms. Here we provide a detailed portrait of mouse gene expression across multiple tissues in a three-way diallel. Greater than 80% of mouse genes have cis regulatory variation. Effects from these variants influence complex traits and usually extend to the human ortholog. Further, we estimate that at least one in every thousand SNPs creates a cis regulatory effect. -
Association Analyses of Known Genetic Variants with Gene
ASSOCIATION ANALYSES OF KNOWN GENETIC VARIANTS WITH GENE EXPRESSION IN BRAIN by Viktoriya Strumba A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy (Bioinformatics) in The University of Michigan 2009 Doctoral Committee: Professor Margit Burmeister, Chair Professor Huda Akil Professor Brian D. Athey Assistant Professor Zhaohui S. Qin Research Statistician Thomas Blackwell To Sam and Valentina Dmitriy and Elizabeth ii ACKNOWLEDGEMENTS I would like to thank my advisor Professor Margit Burmeister, who tirelessly guided me though seemingly impassable corridors of graduate work. Throughout my thesis writing period she provided sound advice, encouragement and inspiration. Leading by example, her enthusiasm and dedication have been instrumental in my path to becoming a better scientist. I also would like to thank my co-advisor Tom Blackwell. His careful prodding always kept me on my toes and looking for answers, which taught me the depth of careful statistical analysis. His diligence and dedication have been irreplaceable in most difficult of projects. I also would like to thank my other committee members: Huda Akil, Brian Athey and Steve Qin as well as David States. You did not make it easy for me, but I thank you for believing and not giving up. Huda’s eloquence in every subject matter she explained have been particularly inspiring, while both Huda’s and Brian’s valuable advice made the completion of this dissertation possible. I would also like to thank all the members of the Burmeister lab, both past and present: Sandra Villafuerte, Kristine Ito, Cindy Schoen, Karen Majczenko, Ellen Schmidt, Randi Burns, Gang Su, Nan Xiang and Ana Progovac. -
The Role of PI3P Phosphatases in the Regulation of Autophagy
View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Elsevier - Publisher Connector FEBS Letters 584 (2010) 1313–1318 journal homepage: www.FEBSLetters.org Review The role of PI3P phosphatases in the regulation of autophagy Isabelle Vergne a,*, Vojo Deretic a,b a Department of Molecular Genetics and Microbiology, University of New Mexico School of Medicine, Albuquerque, NM 87131, USA b Department of Cell Biology and Physiology, University of New Mexico School of Medicine, Albuquerque, NM 87131, USA article info abstract Article history: Autophagy initiation is strictly dependent on phosphatidylinositol 3-phosphate (PI3P) synthesis. Received 31 December 2009 PI3P production is under tight control of PI3Kinase, hVps34, in complex with Beclin-1. Mammalian Revised 15 February 2010 cells express several PI3P phosphatases that belong to the myotubularin family. Even though some Accepted 16 February 2010 of them have been linked to serious human diseases, their cellular function is largely unknown. Two Available online 24 February 2010 recent studies indicate that PI3P metabolism involved in autophagy initiation is further regulated by Edited by Noboru Mizushima the PI3P phosphatases Jumpy and MTMR3. Additional pools of PI3P, upstream of mTOR and on the endocytic pathway, may modulate autophagy indirectly, suggesting that other PI3P phosphatases might be involved in this process. This review sums up our knowledge on PI3P phosphatases and Keywords: Autophagy discusses the recent progress on their role in autophagy. Myotubularin Published by Elsevier B.V. on behalf of the Federation of European Biochemical Societies. PI3P Phosphatase Jumpy MTMR14 1. Introduction PI3P phosphatases were one of the likely candidates as it is known that the phosphoinositide, PI3,4,5P3 and its signaling can be down- PI3P synthesis has long been recognized as one of the key regulated by PI3,4,5P3 phosphatase, PTEN. -
Myotubularin-Related Protein (MTMR) 9 Determines the Enzymatic Activity, Substrate Specificity, and Role in Autophagy of MTMR8
Myotubularin-related protein (MTMR) 9 determines the enzymatic activity, substrate specificity, and role in autophagy of MTMR8 Jun Zoua,1, Chunfen Zhangb,1,2, Jasna Marjanovicc, Marina V. Kisselevab, Philip W. Majerusb,d,2, and Monita P. Wilsonb,2 aDepartment of Pathology and Immunology, bDivision of Hematology, Department of Internal Medicine, and dDepartment of Biochemistry and Molecular Biophysics, Washington University School of Medicine, St. Louis, MO 63110; and cDivision of Basic and Pharmaceutical Sciences, St. Louis College of Pharmacy, St. Louis, MO 63110 Contributed by Philip W. Majerus, May 1, 2012 (sent for review February 24, 2012) The myotubularins are a large family of inositol polyphosphate myotubularin proteins (16–21). One mechanism that regulates 3-phosphatases that, despite having common substrates, subsume the myotubularins is the formation of heterodimers between unique functions in cells that are disparate. The myotubularin catalytically active and inactive proteins. The interaction between family consists of 16 different proteins, 9 members of which different myotubularin proteins has a significant effect on en- possess catalytic activity, dephosphorylating phosphatidylinositol zymatic activity. For example, the association of myotubularin 3-phosphate [PtdIns(3)P] and phosphatidylinositol 3,5-bisphos- (MTM1) with MTMR12 results in a threefold increase in the 3- phate [PtdIns(3,5)P2] at the D-3 position. Seven members are in- phosphatase activity of MTM1, alters the subcellular localiza- active because they lack the conserved cysteine residue in the tion of MTM1 from the plasma membrane to the cytosol, and CX5R motif required for activity. We studied a subfamily of homol- attenuates the filopodia formation seen with MTM1 overex- ogous myotubularins, including myotubularin-related protein 6 pression (21, 22). -
Efficacy and Mechanistic Evaluation of Tic10, a Novel Antitumor Agent
University of Pennsylvania ScholarlyCommons Publicly Accessible Penn Dissertations 2012 Efficacy and Mechanisticv E aluation of Tic10, A Novel Antitumor Agent Joshua Edward Allen University of Pennsylvania, [email protected] Follow this and additional works at: https://repository.upenn.edu/edissertations Part of the Oncology Commons Recommended Citation Allen, Joshua Edward, "Efficacy and Mechanisticv E aluation of Tic10, A Novel Antitumor Agent" (2012). Publicly Accessible Penn Dissertations. 488. https://repository.upenn.edu/edissertations/488 This paper is posted at ScholarlyCommons. https://repository.upenn.edu/edissertations/488 For more information, please contact [email protected]. Efficacy and Mechanisticv E aluation of Tic10, A Novel Antitumor Agent Abstract TNF-related apoptosis-inducing ligand (TRAIL; Apo2L) is an endogenous protein that selectively induces apoptosis in cancer cells and is a critical effector in the immune surveillance of cancer. Recombinant TRAIL and TRAIL-agonist antibodies are in clinical trials for the treatment of solid malignancies due to the cancer-specific cytotoxicity of TRAIL. Recombinant TRAIL has a short serum half-life and both recombinant TRAIL and TRAIL receptor agonist antibodies have a limited capacity to perfuse to tissue compartments such as the brain, limiting their efficacy in certain malignancies. To overcome such limitations, we searched for small molecules capable of inducing the TRAIL gene using a high throughput luciferase reporter gene assay. We selected TRAIL-inducing compound 10 (TIC10) for further study based on its induction of TRAIL at the cell surface and its promising therapeutic index. TIC10 is a potent, stable, and orally active antitumor agent that crosses the blood-brain barrier and transcriptionally induces TRAIL and TRAIL-mediated cell death in a p53-independent manner. -
Cooperative Gene Regulation by Microrna Pairs and Their
Published online 29 May 2014 Nucleic Acids Research, 2014, Vol. 42, No. 12 7539–7552 doi: 10.1093/nar/gku465 Cooperative gene regulation by microRNA pairs and their identification using a computational workflow Ulf Schmitz1,*, Xin Lai2, Felix Winter1, Olaf Wolkenhauer1,3, Julio Vera2 and Shailendra K. Gupta1,4 Downloaded from 1Department of Systems Biology and Bioinformatics, University of Rostock, Rostock, Germany, 2Laboratory of Systems Tumor Immunology, Department of Dermatology, University Hospital Erlangen, Friedrich-Alexander-University Erlangen-Nuremberg, Germany, 3Stellenbosch Institute for Advanced Study (STIAS), Wallenberg Research Centre at Stellenbosch University, Stellenbosch, South Africa and 4Department of Bioinformatics, CSIR-Indian Institute of Toxicology Research, 226001 Lucknow, Uttar Pradesh, India http://nar.oxfordjournals.org/ Received December 22, 2013; Revised April 18, 2014; Accepted May 10, 2014 ABSTRACT fine-tuned through a cellular context-dependent regulation by multiple miRNAs, where miRNAs can either induce MicroRNAs (miRNAs) are an integral part of gene reg- translational repression or target mRNA degradation (4). ulation at the post-transcriptional level. Recently, it Thereby, the miRNA-target regulation machinery can real- at Universitaet Erlangen-Nuernberg, Wirtschafts- und Sozialwissenschaftliche Z on August 3, 2016 has been shown that pairs of miRNAs can repress the ize elaborate gene control functions, including noise buffer- translation of a target mRNA in a cooperative man- ing or homeostasis, and can ultimately mediate distinct tar- ner, which leads to an enhanced effectiveness and get expression patterns appropriate to the demand of differ- specificity in target repression. However, it remains ent biological processes (3,5,6). However, deregulated miR- unclear which miRNA pairs can synergize and which NAs have also been associated with the pathogenesis and genes are target of cooperative miRNA regulation. -
Meta-Analysis of Nasopharyngeal Carcinoma
BMC Genomics BioMed Central Research article Open Access Meta-analysis of nasopharyngeal carcinoma microarray data explores mechanism of EBV-regulated neoplastic transformation Xia Chen†1,2, Shuang Liang†1, WenLing Zheng1,3, ZhiJun Liao1, Tao Shang1 and WenLi Ma*1 Address: 1Institute of Genetic Engineering, Southern Medical University, Guangzhou, PR China, 2Xiangya Pingkuang associated hospital, Pingxiang, Jiangxi, PR China and 3Southern Genomics Research Center, Guangzhou, Guangdong, PR China Email: Xia Chen - [email protected]; Shuang Liang - [email protected]; WenLing Zheng - [email protected]; ZhiJun Liao - [email protected]; Tao Shang - [email protected]; WenLi Ma* - [email protected] * Corresponding author †Equal contributors Published: 7 July 2008 Received: 16 February 2008 Accepted: 7 July 2008 BMC Genomics 2008, 9:322 doi:10.1186/1471-2164-9-322 This article is available from: http://www.biomedcentral.com/1471-2164/9/322 © 2008 Chen et al; licensee BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Abstract Background: Epstein-Barr virus (EBV) presumably plays an important role in the pathogenesis of nasopharyngeal carcinoma (NPC), but the molecular mechanism of EBV-dependent neoplastic transformation is not well understood. The combination of bioinformatics with evidences from biological experiments paved a new way to gain more insights into the molecular mechanism of cancer. Results: We profiled gene expression using a meta-analysis approach. Two sets of meta-genes were obtained. Meta-A genes were identified by finding those commonly activated/deactivated upon EBV infection/reactivation. -
INPP5A Monoclonal Antibody (M05), Clone 3D8
INPP5A monoclonal antibody (M05), clone 3D8 Catalog # : H00003632-M05 規格 : [ 100 ug ] List All Specification Application Image Product Mouse monoclonal antibody raised against a partial recombinant Western Blot (Recombinant protein) Description: INPP5A. Immunoprecipitation Immunogen: INPP5A (NP_005530, 288 a.a. ~ 387 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: YFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQG EQYMNTRCPAWCDRILMSPSAKELVLRVSVCCPSPGHRGMWSAGSGL AQPW enlarge Host: Mouse Sandwich ELISA (Recombinant Reactivity: Human protein) Isotype: IgG2a Kappa Quality Control Antibody Reactive Against Recombinant Protein. Testing: enlarge ELISA Western Blot detection against Immunogen (36.74 KDa) . Storage Buffer: In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: MSDS: Download Datasheet: Download Applications Western Blot (Recombinant protein) Protocol Download Immunoprecipitation Page 1 of 3 2016/5/21 Immunoprecipitation of INPP5A transfected lysate using anti-INPP5A monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with INPP5A MaxPab rabbit polyclonal antibody. Protocol Download Sandwich ELISA (Recombinant protein) Detection limit for recombinant GST tagged INPP5A is 0.1 ng/ml as a capture antibody. Protocol Download ELISA Gene Information Entrez GeneID: 3632 GeneBank NM_005539 Accession#: Protein NP_005530 Accession#: Gene Name: INPP5A Gene Alias: 5PTASE,DKFZp434A1721,MGC116947,MGC116949 Gene inositol polyphosphate-5-phosphatase, 40kDa Description: Omim ID: 600106 Gene Ontology: Hyperlink Gene Summary: The protein encoded by this gene is a membrane-associated type I inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase. InsP3 5- phosphatases hydrolyze Ins(1,4,5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses to various stimulation. -
Allele-Specific Demethylation at an Imprinted Mammalian Promoter Andrew J
Published online 16 October 2007 Nucleic Acids Research, 2007, Vol. 35, No. 20 7031–7039 doi:10.1093/nar/gkm742 Allele-specific demethylation at an imprinted mammalian promoter Andrew J. Wood1,De´ borah Bourc’his2, Timothy H. Bestor3 and Rebecca J. Oakey1,* 1Department of Medical and Molecular Genetics, King’s College London, Guy’s Hospital, London, SE1 9RT, UK, 2INSERM U741, Institut Jacques Monod, 2 Place Jussieu, 75251 Paris, CEDEX 05, France and 3Department of Genetics and Development, College of Physicians and Surgeons of Columbia University, New York, NY10032, USA Received July 4, 2007; Revised August 24, 2007; Accepted September 6, 2007 ABSTRACT Mutations in members of the de novo methyltransferase gene family lead to disruptions in imprinted gene A screen for imprinted genes on mouse expression and to retrotransposon animation (3,4), Chromosome 7 recently identified Inpp5f_v2, suggesting that the two processes are controlled by a a paternally expressed retrogene lying within an common mechanism (5). Dnmt3l encodes a regulatory intron of Inpp5f. Here, we identify a novel paternally protein that stimulates de novo methylation by Dnmt3a expressed variant of the Inpp5f gene (Inpp5f_v3) that and Dnmt3b, but lacks the catalytic motifs necessary for shows a number of unusual features. Inpp5f_v3 methyltransferase activity. Male mice lacking functional initiates from a CpG-rich repeat region adjoining copies of the Dnmt3l gene are sterile due to meiotic arrest, two B1 elements, despite previous reports that which is associated with the upregulation of endogenous SINEs are generally excluded from imprinted pro- retrotransposons (3). Females carrying null mutations in moters. Accordingly, we find that the Inpp5f_v3 the Dnmt3l gene fail to establish imprinted methylation promoter acquires methylation around the time of marks during oogenesis, but show no obvious effects on implantation, when many repeat families undergo de retrotransposon activity (6). -
DNAJB1-PRKACA in HEK293T Cells Induces LINC00473 Overexpression That Depends on PKA Signaling Stephanie S
bioRxiv preprint doi: https://doi.org/10.1101/2021.08.11.455931; this version posted August 11, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. DNAJB1-PRKACA in HEK293T cells induces LINC00473 overexpression that depends on PKA signaling Stephanie S. Kim1*, Ina Kycia1*, Michael Karski1#, Rosanna K. Ma2#, Evan A. Bordt3, Julian Kwan4, Anju Karki1, Elle Winter1, Ranan G. Aktas1, Yuxuan Wu5, Andrew Emili4, Daniel E. Bauer5, Praveen Sethupathy2, Khashayar Vakili1 1. Department of Surgery, Boston Children’s Hospital, Boston, MA, USA 2. Department of Biomedical Sciences, College of Veterinary Medicine, Cornell University, Ithaca, NY, USA 3. Department of Pediatrics, Lurie Center for Autism, Massachusetts General Hospital, Harvard Medical School, Boston, MA, USA 4. Center for Networks Systems Biology, Department of Biochemistry, Boston University School of Medicine, 71 E Concord St, Boston MA 02118 5. Division of Hematology/Oncology, Boston Children’s Hospital, Department of Pediatric Oncology, Dana-Farber Cancer Institute, Harvard Stem Cell Institute, Broad Institute, Department of Pediatrics, Harvard Medical School, Boston, MA, USA (*,# -contributed equally to the manuscript) Corresponding Author: Khashayar Vakili, MD Department of Surgery Boston Children’s Hospital 300 Longwood Avenue Boston, MA 02115 Tel: 617-355-8544 [email protected] bioRxiv preprint doi: https://doi.org/10.1101/2021.08.11.455931; this version posted August 11, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. ABSTRACT Fibrolamellar carcinoma (FLC) is a primary liver cancer that most commonly arises in adolescents and young adults in a background of normal liver tissue and has an poor prognosis due to lack of effective chemotherapeutic agents. -
Supplementary Table S4. FGA Co-Expressed Gene List in LUAD
Supplementary Table S4. FGA co-expressed gene list in LUAD tumors Symbol R Locus Description FGG 0.919 4q28 fibrinogen gamma chain FGL1 0.635 8p22 fibrinogen-like 1 SLC7A2 0.536 8p22 solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 DUSP4 0.521 8p12-p11 dual specificity phosphatase 4 HAL 0.51 12q22-q24.1histidine ammonia-lyase PDE4D 0.499 5q12 phosphodiesterase 4D, cAMP-specific FURIN 0.497 15q26.1 furin (paired basic amino acid cleaving enzyme) CPS1 0.49 2q35 carbamoyl-phosphate synthase 1, mitochondrial TESC 0.478 12q24.22 tescalcin INHA 0.465 2q35 inhibin, alpha S100P 0.461 4p16 S100 calcium binding protein P VPS37A 0.447 8p22 vacuolar protein sorting 37 homolog A (S. cerevisiae) SLC16A14 0.447 2q36.3 solute carrier family 16, member 14 PPARGC1A 0.443 4p15.1 peroxisome proliferator-activated receptor gamma, coactivator 1 alpha SIK1 0.435 21q22.3 salt-inducible kinase 1 IRS2 0.434 13q34 insulin receptor substrate 2 RND1 0.433 12q12 Rho family GTPase 1 HGD 0.433 3q13.33 homogentisate 1,2-dioxygenase PTP4A1 0.432 6q12 protein tyrosine phosphatase type IVA, member 1 C8orf4 0.428 8p11.2 chromosome 8 open reading frame 4 DDC 0.427 7p12.2 dopa decarboxylase (aromatic L-amino acid decarboxylase) TACC2 0.427 10q26 transforming, acidic coiled-coil containing protein 2 MUC13 0.422 3q21.2 mucin 13, cell surface associated C5 0.412 9q33-q34 complement component 5 NR4A2 0.412 2q22-q23 nuclear receptor subfamily 4, group A, member 2 EYS 0.411 6q12 eyes shut homolog (Drosophila) GPX2 0.406 14q24.1 glutathione peroxidase -
A Genomic Atlas of Human Adrenal and Gonad Development [Version 2; Referees: 4 Approved] Ignacio Del Valle1, Federica Buonocore1, Andrew J
Wellcome Open Research 2017, 2:25 Last updated: 08 NOV 2017 RESEARCH ARTICLE A genomic atlas of human adrenal and gonad development [version 2; referees: 4 approved] Ignacio del Valle1, Federica Buonocore1, Andrew J. Duncan1, Lin Lin1, Martino Barenco2, Rahul Parnaik1, Sonia Shah3,4, Mike Hubank5, Dianne Gerrelli2, John C. Achermann 1 1Genetics and Genomic Medicine, UCL Great Ormond Street Institute of Child Health, London, UK 2Developmental Biology and Cancer, UCL Great Ormond Street Institute of Child Health, London, UK 3Institute for Molecular Bioscience, University of Queensland, Brisbane, Australia 4Institute of Cardiovascular Science, University College London, London, UK 5The Centre for Molecular Pathology, Royal Marsden Hospital, Sutton, UK v2 First published: 07 Apr 2017, 2:25 (doi: 10.12688/wellcomeopenres.11253.1) Open Peer Review Latest published: 23 Oct 2017, 2:25 (doi: 10.12688/wellcomeopenres.11253.2) Referee Status: Abstract Background: In humans, the adrenal glands and gonads undergo distinct biological events between 6-10 weeks post conception (wpc), such as testis Invited Referees determination, the onset of steroidogenesis and primordial germ cell 1 2 3 4 development. However, relatively little is currently known about the genetic mechanisms underlying these processes. We therefore aimed to generate a detailed genomic atlas of adrenal and gonad development across these critical version 2 report report stages of human embryonic and fetal development. published Methods: RNA was extracted from 53 tissue samples between 6-10 wpc 23 Oct 2017 (adrenal, testis, ovary and control). Affymetrix array analysis was performed and differential gene expression was analysed using Bioconductor. A version 1 mathematical model was constructed to investigate time-series changes across published report report report report 07 Apr 2017 the dataset.