DOCSLIB.ORG

A Simple Competing Endogenous RNA Network Identifies Novel Mrna, Mirna, and Lncrna Markers in Human Cholangiocarcinoma

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
A Simple Competing Endogenous RNA Network Identifies Novel Mrna, Mirna, and Lncrna Markers in Human Cholangiocarcinoma Hindawi BioMed Research International Volume 2019, Article ID 3526407, 13 pages https://doi.org/10.1155/2019/3526407 Research Article A Simple Competing Endogenous RNA Network Identifies Novel mRNA, miRNA, and lncRNA Markers in Human Cholangiocarcinoma Cheng Zhang and Chunlin Ge Department of Pancreatic and Biliary Surgery, e First Hospital of China Medical University, Shenyang, Liaoning , China Correspondence should be addressed to Chunlin Ge; [email protected] Received 10 December 2018; Revised 22 February 2019; Accepted 23 February 2019; Published 24 March 2019 Academic Editor: Udayan Apte Copyright © 2019 Cheng Zhang and Chunlin Ge. Tis is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Background. Cholangiocarcinoma (CCA) is the second most common malignant primary liver tumor and has shown an alarming increase in incidence over the last two decades. However, the mechanisms behind tumorigenesis and progression remain insufcient. Te present study aimed to uncover the underlying regulatory mechanism on CCA and fnd novel biomarkers for the disease prognosis. Method. Te RNA-sequencing (RNA-seq) datasets of lncRNAs, miRNAs, and mRNAs in CCA as well as relevant clinical information were obtained from the Cancer Genome Atlas (TCGA) database. Afer pretreatment, diferentially expressed RNAs (DERNAs) were identifed and further interrogated for their correlations with clinical information. Prognostic RNAs were selected using univariate Cox regression. Ten, a ceRNA network was constructed based on these RNAs. Results. We identifed a total of fve prognostic DEmiRNAs, 63 DElncRNAs, and 90 DEmRNAs between CCA and matched normal tissues. Integrating the relationship between the diferent types of RNAs, an lncRNA-miRNA-mRNA network was established and included 28 molecules and 47 interactions. Screened prognostic RNAs involved in the ceRNA network included 3 miRNAs (hsa-mir-1295b, hsa-mir-33b, and hsa-mir-6715a), 7 lncRNAs (ENSG00000271133, ENSG00000233834, ENSG00000276791, ENSG00000241155, COL18A1-AS1, ENSG00000274737, and ENSG00000235052), and 18 mRNAs (ANO9, FUT4, MLLT3, ABCA3, FSCN2, GRID2IP,NCK2, MACC1, SLC35E4, ST14, SH2D3A, MOB3B, ACTL10, RAB36, ATP1B3, MST1R, SEMA6A, and SEL1L3). Conclusions. Our study identifed novel prognostic makers and predicted a previously unknown ceRNA regulatory network in CCA and may provide novel insight into a further understanding of lncRNA-mediated ceRNA regulatory mechanisms in CCA. 1. Introduction increased by 39% [5]. Te increased incidence and mortality have both contributed to the rising interest in this cancer. Cholangiocarcinoma (CCA) is an epithelial cell malignancy In 2011, Leonardo Salmena and colleagues frst proposed arising from diferent locations within the biliary tree. the famous competitive endogenous RNA (ceRNA) hypoth- According to its anatomical location, CCA is classifed into esis, positing that RNAs can engage in crosstalk with one intrahepatic (iCCA), perihilar (pCCA), and distal (dCCA) another and manipulate biological functions independently subtypes [1]. Surgical treatment is the preferred option for of protein translation [7]. lncRNAs are endogenous noncod- all subtypes [2]; however, most patients with CCA present ing RNAs longer than 200 nucleotides and constitute the with unresectable or metastatic disease. As one of the dead- largest portion of the human noncoding transcriptome [8]. liest cancers, patient prognoses remain poor afer systemic Recent studies have revealed that lncRNAs can act as ceRNAs chemotherapy [3]. More than 90% of patients die within fve to compete with mRNAs for binding to miRNAs like sponges, years,andthemajorityofpatientssurvivelessthan12months and thereby regulate the expression level of genes [9, 10]. afer diagnosis [4]. Additionally, the incidence of CCA seems Moreover, this pattern has been extensively demonstrated to to be increasing in many western countries [2], and because play important roles in carcinogenesis and in the develop- of this increase, cumulative CCA mortality rates have also ment of numerous cancers, including bladder cancer, thyroid 2 BioMed Research International Table 1: Clinicopathological characteristics of 33 CCA patients. Characteristic Subtype No. of cases overall survival (Days) Age (years) < 65 16(48.5%) 942.4 ≥65 17(51.5%) 729.2 Gender Male 14(42.4%) 695.5 Female 19(57.6%) 932.8 Pathologic stage Stage I 18(54.5%) 904.9 Stage II 8(24.2%) 686.9 Stage III 1(3.0%) 1077.0 Stage IV 6(18.2%) 768.8 Pathologic T T1 18(54.5%) 904.9 T2 10(30.3%) 669.0 T3 5(15.2%) 899.0 Pathologic N NO 25(75.8%) 920.8 N1 5(15.2%) 642.2 NX 3(9.1%) 414.7 Pathologic M M0 27(81.8%) 861.6 M1 4(12.1%) 826.0 MX 2(6.1%) 453.0 Vital status Alive 17(51.5%) 991.1 Dead 16(48.5%) 664.0 cancer, and gastric cancer [11–13]. However, compared with there is some merit to our research in terms of a deeper other malignancies, the ceRNA research in CCA remains understanding of CCA. sparse. Sun et al. discovered that KCNQ1OT1 can act as a In the present study, with the aim of identifying the poten- ceRNA to improve CCA progression by regulating the miR- tial ceRNA interactions that contribute to patient survival, 140-5p/SOX4 axis [14]. In addition, lncRNA H19, HULC, and we constructed a ceRNA regulatory network that included TUG1 have also been shown to promote CCA progression mRNAsthatweredysregulatedinCCAascomparedtonor- as ceRNAs [15, 16]. However, the essential biomarkers and mal tissues. Te expression and clinical data were acquired mechanisms for the development and progression of CCA from the Cancer Genome Atlas (TCGA), a publicly funded remain unclear. projectthataimstocatalogueanddiscovermajorcancer- With the rapid development of gene profle and next causing genomic alterations to create a comprehensive “atlas” generation sequencing technology, bioinformatics analysis of cancer genomic profles [23]. All RNAs participating in the can provide more valuable information for new research construction of the network are demonstrated to be dysreg- [17]. However, like most bioinformatics studies on CCA, ulated and prognosis-related. Because of this strict standard, Huang and Zhong’s groups have only identifed diferentially the network appears to be simple; however, compared with expressed genes (DEGs) between CCA and normal tissues networks containing hundreds of molecules, it may provide and constructed a protein–protein interaction (PPI) network more reliable clues for ongoing basic research. [18, 19]. An analysis of lncRNA and miRNA functions and their interactions is absent. Additionally, bioinformatics studies related to the ceRNA network in CCA are rare. At 2. Materials and Methods present, only a few articles [20–22] can be found. In contrast to all the aforementioned studies, all of the molecules that we .. Acquisition of Clinical Characteristics and RNA-Seq selected in the construction of our network were proven to Data. Te clinical and mRNA expression data of 48 be diferentially expressed and prognosis-related. In addition, CCA patients were obtained from the TCGA database we determined the relationships between RNAs from the (https://portal.gdc.cancer.gov/). Exclusion criteria were set as expression data in the CCA samples rather than in RNA follows: (i) histologic diagnosis excluding CCA; (ii) incom- interaction databases. Te method of functional enrichment plete RNA expression data for analysis; and (iii) overall analysis was also diferent. We built a GO terms network survival time less than 30 days. Ultimately, 33 patients were to further visualize the biological process and molecular included in survival analysis. Te clinical and pathological function of crucial genes. Ten, the KEGG, Reactome and characteristics of these patients are summarized in Table 1. WikiPathways were used to enrich the related mRNAs path- Ten, lncRNA, miRNA, and mRNA expression fles that ways as opposed to the sole use of KEGG, which can help included 36 CCA samples and nine adjacent normal samples to obtain a more comprehensive analytic result. Terefore, were also downloaded from the TCGA portal. BioMed Research International 3 0.0 33.09953 1620.667 TCGA–ZH–A8Y8–01 TCGA–ZH–A8Y4–01 TCGA–W5–AA2I–01 TCGA–W5–AA2Z–01 TCGA–4G–AAZO–01 TCGA–W5–AA34–01 TCGA–W5–AA2O–01 TCGA–ZH–A8Y2–01 TCGA–W5–AA2W–01 TCGA–W6–AAOS–01 TCGA–3X–AAVB–01 TCGA–W5–AA31–01 TCGA–3X–AAV9–01 TCGA–ZU–A8S4–01 TCGA–ZH–A8Y1–01 TCGA–YR–A95A–01 TCGA–ZD–A8I3–01 TCGA–W5–AA2U–01 TCGA–ZH–A8Y5–01 TCGA–3X–AAVA–01 TCGA–W5–AA2G–01 TCGA–W5–AA38–01 TCGA–WD–A7RX–01 TCGA–W5–AA2X–01 TCGA–W5–AA2T–01 TCGA–W5–AA30–01 TCGA–3X–AAVE–01 TCGA–W5–AA36–01 TCGA–4G–AAZT–01 TCGA–W5–AA2Q–01 TCGA–W5–AA33–01 TCGA–W5–AA2R–01 TCGA–ZH–A8Y6–01 TCGA–3X–AAVC–01 TCGA–W5–AA39–01 TCGA–W5–AA2H–01 TCGA–W5–AA2X–11 TCGA–W5–AA2Q–11 TCGA–ZU–A8S4–11 TCGA–W5–AA2I–11 TCGA–W5–AA34–11 TCGA–W5–AA2R–11 TCGA–W5–AA31–11 TCGA–W5–AA30–11 TCGA–W5–AA2U–11 418143.12 209071.56 2668004.5 1334002.2 0.0 0.0 hsa–mir–21 hsa–mir–148a hsa–mir–192 hsa–mir–122 hsa–mir–101–2 hsa–mir–101–1 hsa–mir–194–2 hsa–mir–194–1 hsa–let–7c hsa–mir–455 hsa–mir–99a hsa–mir–378a hsa–mir–429 hsa–mir–135b hsa–mir–92b hsa–mir–203b hsa–mir–216a hsa–mir–216b hsa–mir–34c hsa–mir–378c hsa–mir–1468 hsa–mir–511 hsa–mir–1295b hsa–mir–6715a hsa–mir–1258 hsa–mir–551b hsa–mir–618 hsa–mir–383 hsa–mir–490 hsa–mir–5589 hsa–mir–96 hsa–mir–181d hsa–mir–708 hsa–mir–505 hsa–mir–483 hsa–mir–4662a hsa–mir–486–1 hsa–mir–486–2 hsa–mir–144 hsa–mir–139 hsa–mir–885 hsa–mir–675 hsa–mir–451a hsa–mir–200b hsa–mir–200a hsa–mir–183 hsa–mir–182 Figure 1: Expressions of diferentially expressed miRNAs in diferent samples.
Load more

Recommended publications
  • PARSANA-DISSERTATION-2020.Pdf
    DECIPHERING TRANSCRIPTIONAL PATTERNS OF GENE REGULATION: A COMPUTATIONAL APPROACH by Princy Parsana A dissertation submitted to The Johns Hopkins University in conformity with the requirements for the degree of Doctor of Philosophy Baltimore, Maryland July, 2020 © 2020 Princy Parsana All rights reserved Abstract With rapid advancements in sequencing technology, we now have the ability to sequence the entire human genome, and to quantify expression of tens of thousands of genes from hundreds of individuals. This provides an extraordinary opportunity to learn phenotype relevant genomic patterns that can improve our understanding of molecular and cellular processes underlying a trait. The high dimensional nature of genomic data presents a range of computational and statistical challenges. This dissertation presents a compilation of projects that were driven by the motivation to efficiently capture gene regulatory patterns in the human transcriptome, while addressing statistical and computational challenges that accompany this data. We attempt to address two major difficulties in this domain: a) artifacts and noise in transcriptomic data, andb) limited statistical power. First, we present our work on investigating the effect of artifactual variation in gene expression data and its impact on trans-eQTL discovery. Here we performed an in-depth analysis of diverse pre-recorded covariates and latent confounders to understand their contribution to heterogeneity in gene expression measurements. Next, we discovered 673 trans-eQTLs across 16 human tissues using v6 data from the Genotype Tissue Expression (GTEx) project. Finally, we characterized two trait-associated trans-eQTLs; one in Skeletal Muscle and another in Thyroid. Second, we present a principal component based residualization method to correct gene expression measurements prior to reconstruction of co-expression networks.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Supplementary Table 3 Complete List of RNA-Sequencing Analysis of Gene Expression Changed by ≥ Tenfold Between Xenograft and Cells Cultured in 10%O2
    Supplementary Table 3 Complete list of RNA-Sequencing analysis of gene expression changed by ≥ tenfold between xenograft and cells cultured in 10%O2 Expr Log2 Ratio Symbol Entrez Gene Name (culture/xenograft) -7.182 PGM5 phosphoglucomutase 5 -6.883 GPBAR1 G protein-coupled bile acid receptor 1 -6.683 CPVL carboxypeptidase, vitellogenic like -6.398 MTMR9LP myotubularin related protein 9-like, pseudogene -6.131 SCN7A sodium voltage-gated channel alpha subunit 7 -6.115 POPDC2 popeye domain containing 2 -6.014 LGI1 leucine rich glioma inactivated 1 -5.86 SCN1A sodium voltage-gated channel alpha subunit 1 -5.713 C6 complement C6 -5.365 ANGPTL1 angiopoietin like 1 -5.327 TNN tenascin N -5.228 DHRS2 dehydrogenase/reductase 2 leucine rich repeat and fibronectin type III domain -5.115 LRFN2 containing 2 -5.076 FOXO6 forkhead box O6 -5.035 ETNPPL ethanolamine-phosphate phospho-lyase -4.993 MYO15A myosin XVA -4.972 IGF1 insulin like growth factor 1 -4.956 DLG2 discs large MAGUK scaffold protein 2 -4.86 SCML4 sex comb on midleg like 4 (Drosophila) Src homology 2 domain containing transforming -4.816 SHD protein D -4.764 PLP1 proteolipid protein 1 -4.764 TSPAN32 tetraspanin 32 -4.713 N4BP3 NEDD4 binding protein 3 -4.705 MYOC myocilin -4.646 CLEC3B C-type lectin domain family 3 member B -4.646 C7 complement C7 -4.62 TGM2 transglutaminase 2 -4.562 COL9A1 collagen type IX alpha 1 chain -4.55 SOSTDC1 sclerostin domain containing 1 -4.55 OGN osteoglycin -4.505 DAPL1 death associated protein like 1 -4.491 C10orf105 chromosome 10 open reading frame 105 -4.491
    [Show full text]
  • High-Throughput Discovery of Novel Developmental Phenotypes
    High-throughput discovery of novel developmental phenotypes The Harvard community has made this article openly available. Please share how this access benefits you. Your story matters Citation Dickinson, M. E., A. M. Flenniken, X. Ji, L. Teboul, M. D. Wong, J. K. White, T. F. Meehan, et al. 2016. “High-throughput discovery of novel developmental phenotypes.” Nature 537 (7621): 508-514. doi:10.1038/nature19356. http://dx.doi.org/10.1038/nature19356. Published Version doi:10.1038/nature19356 Citable link http://nrs.harvard.edu/urn-3:HUL.InstRepos:32071918 Terms of Use This article was downloaded from Harvard University’s DASH repository, and is made available under the terms and conditions applicable to Other Posted Material, as set forth at http:// nrs.harvard.edu/urn-3:HUL.InstRepos:dash.current.terms-of- use#LAA HHS Public Access Author manuscript Author ManuscriptAuthor Manuscript Author Nature. Manuscript Author Author manuscript; Manuscript Author available in PMC 2017 March 14. Published in final edited form as: Nature. 2016 September 22; 537(7621): 508–514. doi:10.1038/nature19356. High-throughput discovery of novel developmental phenotypes A full list of authors and affiliations appears at the end of the article. Abstract Approximately one third of all mammalian genes are essential for life. Phenotypes resulting from mouse knockouts of these genes have provided tremendous insight into gene function and congenital disorders. As part of the International Mouse Phenotyping Consortium effort to generate and phenotypically characterize 5000 knockout mouse lines, we have identified 410 Users may view, print, copy, and download text and data-mine the content in such documents, for the purposes of academic research, subject always to the full Conditions of use:http://www.nature.com/authors/editorial_policies/license.html#terms #Corresponding author: [email protected].
    [Show full text]
  • MUC4/MUC16/Muc20high Signature As a Marker of Poor Prognostic for Pancreatic, Colon and Stomach Cancers
    Jonckheere and Van Seuningen J Transl Med (2018) 16:259 https://doi.org/10.1186/s12967-018-1632-2 Journal of Translational Medicine RESEARCH Open Access Integrative analysis of the cancer genome atlas and cancer cell lines encyclopedia large‑scale genomic databases: MUC4/MUC16/ MUC20 signature is associated with poor survival in human carcinomas Nicolas Jonckheere* and Isabelle Van Seuningen* Abstract Background: MUC4 is a membrane-bound mucin that promotes carcinogenetic progression and is often proposed as a promising biomarker for various carcinomas. In this manuscript, we analyzed large scale genomic datasets in order to evaluate MUC4 expression, identify genes that are correlated with MUC4 and propose new signatures as a prognostic marker of epithelial cancers. Methods: Using cBioportal or SurvExpress tools, we studied MUC4 expression in large-scale genomic public datasets of human cancer (the cancer genome atlas, TCGA) and cancer cell line encyclopedia (CCLE). Results: We identifed 187 co-expressed genes for which the expression is correlated with MUC4 expression. Gene ontology analysis showed they are notably involved in cell adhesion, cell–cell junctions, glycosylation and cell signal- ing. In addition, we showed that MUC4 expression is correlated with MUC16 and MUC20, two other membrane-bound mucins. We showed that MUC4 expression is associated with a poorer overall survival in TCGA cancers with diferent localizations including pancreatic cancer, bladder cancer, colon cancer, lung adenocarcinoma, lung squamous adeno- carcinoma, skin cancer and stomach cancer. We showed that the combination of MUC4, MUC16 and MUC20 signature is associated with statistically signifcant reduced overall survival and increased hazard ratio in pancreatic, colon and stomach cancer.
    [Show full text]
  • Noninvasive Sleep Monitoring in Large-Scale Screening of Knock-Out Mice
    bioRxiv preprint doi: https://doi.org/10.1101/517680; this version posted January 11, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-ND 4.0 International license. Noninvasive sleep monitoring in large-scale screening of knock-out mice reveals novel sleep-related genes Shreyas S. Joshi1*, Mansi Sethi1*, Martin Striz1, Neil Cole2, James M. Denegre2, Jennifer Ryan2, Michael E. Lhamon3, Anuj Agarwal3, Steve Murray2, Robert E. Braun2, David W. Fardo4, Vivek Kumar2, Kevin D. Donohue3,5, Sridhar Sunderam6, Elissa J. Chesler2, Karen L. Svenson2, Bruce F. O'Hara1,3 1Dept. of Biology, University of Kentucky, Lexington, KY 40506, USA, 2The Jackson Laboratory, Bar Harbor, ME 04609, USA, 3Signal solutions, LLC, Lexington, KY 40503, USA, 4Dept. of Biostatistics, University of Kentucky, Lexington, KY 40536, USA, 5Dept. of Electrical and Computer Engineering, University of Kentucky, Lexington, KY 40506, USA. 6Dept. of Biomedical Engineering, University of Kentucky, Lexington, KY 40506, USA. *These authors contributed equally Address for correspondence and proofs: Shreyas S. Joshi, Ph.D. Dept. of Biology University of Kentucky 675 Rose Street 101 Morgan Building Lexington, KY 40506 U.S.A. Phone: (859) 257-2805 FAX: (859) 257-1717 Email: [email protected] Running title: Sleep changes in knockout mice bioRxiv preprint doi: https://doi.org/10.1101/517680; this version posted January 11, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity.
    [Show full text]
  • UCN2 (NM 033199) Human Tagged ORF Clone – RC201333 | Origene
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC201333 UCN2 (NM_033199) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: UCN2 (NM_033199) Human Tagged ORF Clone Tag: Myc-DDK Symbol: UCN2 Synonyms: SRP; UCN-II; UCNI; UR; URP Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC201333 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACCAGGTGTGCTCTGCTGTTGCTGATGGTCCTGATGTTGGGCAGAGTCCTGGTTGTCCCAGTGACCC CTATCCCAACCTTCCAGCTCCGCCCTCAGAATTCTCCCCAGACCACTCCCCGACCTGCGGCCTCAGAGAG CCCCTCAGCTGCTCCCACATGGCCGTGGGCTGCCCAGAGCCACTGCAGCCCCACCCGCCACCCTGGCTCG CGCATTGTCCTATCGCTGGATGTCCCCATCGGCCTCTTGCAGATCTTACTGGAGCAAGCCCGGGCCAGGG CTGCCAGGGAGCAGGCCACCACCAACGCCCGCATCCTGGCCCGTGTCGGCCACTGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC201333 protein sequence Red=Cloning site Green=Tags(s) MTRCALLLLMVLMLGRVLVVPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHCSPTRHPGS RIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk6125_c07.zip Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene
    [Show full text]
  • The Box C/D Snornp Assembly Factor Bcd1 Interacts with the Histone
    The box C/D snoRNP assembly factor Bcd1 interacts with the histone chaperone Rtt106 and controls its transcription dependent activity Benoît Bragantini, Christophe Charron, Maxime Bourguet, Arnaud Paul, Decebal Tiotiu, Benjamin Rothé, Hélène Marty, Guillaume Terral, Steve Hessmann, Laurence Decourty, et al. To cite this version: Benoît Bragantini, Christophe Charron, Maxime Bourguet, Arnaud Paul, Decebal Tiotiu, et al.. The box C/D snoRNP assembly factor Bcd1 interacts with the histone chaperone Rtt106 and controls its transcription dependent activity. Nature Communications, Nature Publishing Group, 2021, 12 (1), pp.1859. 10.1038/s41467-021-22077-4. hal-03181046 HAL Id: hal-03181046 https://hal.univ-lorraine.fr/hal-03181046 Submitted on 1 Apr 2021 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Distributed under a Creative Commons Attribution| 4.0 International License ARTICLE https://doi.org/10.1038/s41467-021-22077-4 OPEN The box C/D snoRNP assembly factor Bcd1 interacts with the histone chaperone Rtt106 and controls its transcription dependent
    [Show full text]
  • A CRISPR-Based Screen for Hedgehog Signaling Provides Insights Into Ciliary Function and Ciliopathies
    ARTICLES https://doi.org/10.1038/s41588-018-0054-7 A CRISPR-based screen for Hedgehog signaling provides insights into ciliary function and ciliopathies David K. Breslow 1,2,7*, Sascha Hoogendoorn 3,7, Adam R. Kopp2, David W. Morgens4, Brandon K. Vu2, Margaret C. Kennedy1, Kyuho Han4, Amy Li4, Gaelen T. Hess4, Michael C. Bassik4, James K. Chen 3,5* and Maxence V. Nachury 2,6* Primary cilia organize Hedgehog signaling and shape embryonic development, and their dysregulation is the unifying cause of ciliopathies. We conducted a functional genomic screen for Hedgehog signaling by engineering antibiotic-based selection of Hedgehog-responsive cells and applying genome-wide CRISPR-mediated gene disruption. The screen can robustly identify factors required for ciliary signaling with few false positives or false negatives. Characterization of hit genes uncovered novel components of several ciliary structures, including a protein complex that contains δ -tubulin and ε -tubulin and is required for centriole maintenance. The screen also provides an unbiased tool for classifying ciliopathies and showed that many congenital heart disorders are caused by loss of ciliary signaling. Collectively, our study enables a systematic analysis of ciliary function and of ciliopathies, and also defines a versatile platform for dissecting signaling pathways through CRISPR-based screening. he primary cilium is a surface-exposed microtubule-based approach. Indeed, most studies to date have searched for genes that compartment that serves as an organizing center for diverse either intrinsically affect cell growth or affect sensitivity to applied Tsignaling pathways1–3. Mutations affecting cilia cause ciliopa- perturbations16–23. thies, a group of developmental disorders including Joubert syn- Here, we engineered a Hh-pathway-sensitive reporter to enable drome, Meckel syndrome (MKS), nephronophthisis (NPHP), and an antibiotic-based selection platform.
    [Show full text]
  • Noelia Díaz Blanco
    Effects of environmental factors on the gonadal transcriptome of European sea bass (Dicentrarchus labrax), juvenile growth and sex ratios Noelia Díaz Blanco Ph.D. thesis 2014 Submitted in partial fulfillment of the requirements for the Ph.D. degree from the Universitat Pompeu Fabra (UPF). This work has been carried out at the Group of Biology of Reproduction (GBR), at the Department of Renewable Marine Resources of the Institute of Marine Sciences (ICM-CSIC). Thesis supervisor: Dr. Francesc Piferrer Professor d’Investigació Institut de Ciències del Mar (ICM-CSIC) i ii A mis padres A Xavi iii iv Acknowledgements This thesis has been made possible by the support of many people who in one way or another, many times unknowingly, gave me the strength to overcome this "long and winding road". First of all, I would like to thank my supervisor, Dr. Francesc Piferrer, for his patience, guidance and wise advice throughout all this Ph.D. experience. But above all, for the trust he placed on me almost seven years ago when he offered me the opportunity to be part of his team. Thanks also for teaching me how to question always everything, for sharing with me your enthusiasm for science and for giving me the opportunity of learning from you by participating in many projects, collaborations and scientific meetings. I am also thankful to my colleagues (former and present Group of Biology of Reproduction members) for your support and encouragement throughout this journey. To the “exGBRs”, thanks for helping me with my first steps into this world. Working as an undergrad with you Dr.
    [Show full text]
  • The Complexity of the Epigenome in Cancer and Recent Clinical Advances
    Published OnlineFirst August 17, 2012; DOI: 10.1158/1078-0432.CCR-12-2037 Clinical Cancer Molecular Pathways Research Molecular Pathways: The Complexity of the Epigenome in Cancer and Recent Clinical Advances Mariarosaria Conte1 and Lucia Altucci1,2 Abstract Human cancer is causally linked to genomic and epigenomic deregulations. Epigenetic abnormalities occurring within signaling pathways regulating proliferation, migration, growth, differentiation, tran- scription, and death signals may be critical in the progression of malignancies. Consequently, iden- tification of epigenetic marks and their bioimplications in tumors represents a crucial step toward defining new therapeutic strategies both in cancer treatment and prevention. Alterations of writers, readers, and erasers in cancer may affect, for example, the methylation and acetylation state of huge areas of chromatin, suggesting that epi-based treatments may require "distinct" therapeutic strategies com- pared with "canonical" targeted treatments. Whereas anticancer treatments targeting histone deacetylase and DNA methylation have entered the clinic, additional chromatin modification enzymes have not yet been pharmacologically targeted for clinical use in patients. Thus, a greater insight into alterations occurring on chromatin modifiers and their impact in tumorigenesis represents a crucial advance- ment in exploiting epigenetic targeting in cancer prevention and treatment. Here, the interplay of the best known epi-mutations and how their targeting might be optimized are addressed. Clin Cancer Res; 18 (20); 1–9. Ó2012 AACR. Background strategies both in cancer treatment and prevention (2). A number of epigenetic deregulations, such as DNA Alterations of writers, readers, and erasers in cancer may methylation, histone modifications, and microRNA-based affect the status of chromatin in vast areas of the epigenome, modulation, have been progressively reported as causally thus suggesting that epi-based treatments may require "dis- involved in tumorigenesis and progression.
    [Show full text]
  • Fine-Scale Survey of X Chromosome Copy Number Variants and Indels Underlying Intellectual Disability
    ARTICLE Fine-Scale Survey of X Chromosome Copy Number Variants and Indels Underlying Intellectual Disability Annabel C. Whibley,1 Vincent Plagnol,1,2 Patrick S. Tarpey,3 Fatima Abidi,4 Tod Fullston,5,6 Maja K. Choma,1 Catherine A. Boucher,1 Lorraine Shepherd,1 Lionel Willatt,7 Georgina Parkin,7 Raffaella Smith,3 P. Andrew Futreal,3 Marie Shaw,8 Jackie Boyle,9 Andrea Licata,4 Cindy Skinner,4 Roger E. Stevenson,4 Gillian Turner,9 Michael Field,9 Anna Hackett,9 Charles E. Schwartz,4 Jozef Gecz,5,6,8 Michael R. Stratton,3 and F. Lucy Raymond1,* Copy number variants and indels in 251 families with evidence of X-linked intellectual disability (XLID) were investigated by array comparative genomic hybridization on a high-density oligonucleotide X chromosome array platform. We identified pathogenic copy number variants in 10% of families, with mutations ranging from 2 kb to 11 Mb in size. The challenge of assessing causality was facilitated by prior knowledge of XLID-associated genes and the ability to test for cosegregation of variants with disease through extended pedigrees. Fine-scale analysis of rare variants in XLID families leads us to propose four additional genes, PTCHD1, WDR13, FAAH2, and GSPT2,as candidates for XLID causation and the identification of further deletions and duplications affecting X chromosome genes but without apparent disease consequences. Breakpoints of pathogenic variants were characterized to provide insight into the underlying mutational mechanisms and indicated a predominance of mitotic rather than meiotic events. By effectively bridging the gap between karyotype-level investigations and X chromosome exon resequencing, this study informs discussion of alternative mutational mechanisms, such as non- coding variants and non-X-linked disease, which might explain the shortfall of mutation yield in the well-characterized International Genetics of Learning Disability (IGOLD) cohort, where currently disease remains unexplained in two-thirds of families.
    [Show full text]