The Role of Chloride Channels in Granulocyte Function

Total Page:16

File Type:pdf, Size:1020Kb

Load more

The expression of potential molecular candidates for chloride ion channels in primary human granulocytes and granulocytic cell lines By Kirsty-Anne Kirk, RN (Dip) HE, BA (Hons), MSc, PGCME, FHEA A thesis submitted in complete fulfilment of the requirements of the University of East Anglia for the degree of Doctor of Philosophy Norwich Medical School Faculty of Medicine and Health Sciences University of East Anglia Submitted July 2014 © This copy of the thesis has been supplied on condition that anyone who consults it is understood to recognise that its copyright rests with the author and that use of any information derived there from must be in accordance with current UK Copyright Law. In addition, any quotation or extract must include full attribution. DECLARATION I declare that the work submitted in this thesis was undertaken and completed by myself unless otherwise acknowledged, and has not been accepted in any previous application for a degree with any other institution. Kirsty Kirk July 2014 1 ABSTRACT INTRODUCTION AND HYPOTHESIS: The project aims to identify potential candidates for chloride (Cl-) ion channels in granulocytes, and granulocytic cell lines. It is hypothesised that Cl- ion channels, in particular hBest1, are implicated in the role of granulocytes in response to inflammation. METHODOLOGY: Two main methodologies were used; laboratory techniques and systematic review. Laboratory techniques included RT-PCR, flow cytometry and western blot analysis to characterise the expression of hANO1, hBest1 and hCLCA1 as potential chloride ion channels in granulocytes and granulocytic cell lines. Systematic review was performed to identify whether chloride ion channels are up-regulated in COPD and asthma. RESULTS: RT-PCR demonstrated hCLCA1 expression in granulocytes and eosinophils but not HL60. hBest1 and hBest3 was expressed in all 3 cell types. In granulocytes, flow cytometry demonstrated greater hCLCA1 protein expression intracellularly, compared to hBest1 protein, and greater hBest1 plasma membrane expression compared to hCLCA1 (P<0.05). There was a negative correlation between hBest1, and hCLCA1 but also a weak negative correlation between hBest1 and hANO1 (P<0.05). Granulocytes stimulated with IL-13 over 24 hours, had a greater protein expression both intracellularly and at the plasma membrane. There was increased migration of HL60s when transfected with hBest1, in response to fMLP (P<0.05). Systematic review did not support the project due to limitations. CONCLUSIONS: There is a complex relationship between hBest1, hCLCA1 and hANO1 which may contribute to the function of granulocytes. HBest1 protein expression peaked 24 hours after continuous stimulation with IL-13. This correlates with peak symptom expression in diseases such as COPD and asthma. It is suggested that hBest1 has a role in migration and activation of granulocytes, through regulation of cell shape and volume. It is concluded that hBest1 is a novel therapeutic target in the control of symptoms in chronic inflammatory lung diseases. 2 CONTENTS DECLARATION 1 ABSTRACT 2 CONTENTS 3 LIST OF FIGURES 10 LIST OF TABLES 15 ABBREVIATIONS 18 ACKNOWLEDGEMENTS 21 CHAPTER 1: INTRODUCTION 22 1.1 Inflammatory airway diseases and the role of 23 potential chloride ion channel candidates in granulocyte function within inflammatory airways 1.1.1 The role of granulocytes in inflammatory 32 airway diseases 1.1.1.1 Neutrophils 32 1.1.1.2 Eosinophils 36 1.1.1.3 Basophils 47 1.1.2 Chloride ion channels 54 1.1.3 Potential molecular candidates for chloride 73 ion channels in granulocytes 1.1.3.1 ClC 73 1.1.3.2 CFTR 74 1.1.3.3 CLCA 76 1.1.3.4 Bestrophin 82 3 1.1.3.5 TMEM16A and tweety (hTTYH3) as 84 potential candidates 1.1.3.6 CLIC 86 1.1.4 Evidence for Cl- channel candidates in 90 granulocytes 1.1.4.1 Volume gated Cl- channels 90 1.1.4.2 Voltage gated Cl- channels 93 1.1.4.3 Calcium-activated Cl- channels 96 1.1.4.4 cAMP-activated channels 97 1.1.5 Summarising remarks; Cl- channels and 99 granulocyte function 1.2 Hypothesis and rationale 100 CHAPTER 2: MATERIALS AND METHODS 103 2.1 Cell and tissue culture 104 2.1.1 Commercial cell lines 104 2.1.1.1 EoL-1 cell line 104 2.1.1.2 dEoL-1 104 2.1.1.3 HL60 cells 105 2.1.1.4 Epithelial cells 105 2.1.1.5 Trypan and kimura staining 107 2.1.2 Primary cells 108 2.1.2.1 Peripheral blood and PMN purification 108 2.1.3 Microscopy for cellular morphology 112 2.1.4 Cytokine stimulation 114 2.2 RNA expression and DNA sub-cloning 115 2.2.1 Reverse transcriptase polymerase chain 115 reactions 2.2.1.1 Preparation of mRNA 115 4 2.2.1.1.1 TRIzol® preparation of mRNA 115 2.2.1.1.2 Cell lysate preparation 116 2.2.1.1.3 Analysis of concentration and 116 purity of RNA 2.2.1.2 RT-PCR reaction 117 2.2.1.3 Analysis 124 2.2.1.3.1 Electrophoresis 124 2.2.1.3.2 Sequence confirmation 125 2.2.1.3.3 Semi-quantification of results 126 2.2.2 Sub-cloning 128 2.2.2.1 Transformations of plasmids into 128 bacteria 2.2.2.2 Purification of cDNA 129 2.2.2.3 Restriction digestion 130 2.2.2.4 Transfection of cDNA 132 2.3 Protein expression 133 2.3.1 Flow cytometry 133 2.3.1.1 Method for immunolabelling with 133 primary and secondary antibodies 2.3.1.2 Apoptosis assay 139 2.3.1.3 Analysis using flow cytometry 140 2.3.1.3.1 Beckman Coulter Epics flow 140 cytometer 2.3.1.3.2 Accuri, C6 flow cytometer 141 2.3.2 Western blot analysis 143 2.3.2.1 Samples and sample preparation 143 2.3.2.1.1 Preparation of protein lysates 143 2.3.2.1.2 Analysis of protein 144 concentration 5 2.3.2.1.3 Sample preparation for loading 147 onto Western gel 2.3.2.1.4 Loading of samples and 148 electrophoresis 2.3.2.2 Process of western blotting 149 2.3.2.2.1 Transfer of proteins onto 149 membrane and antibody labelling 2.3.2.2.2 Western blot membrane re- 153 probe 2.3.2.3 Analysis of results 154 2.4 Transmigration assay 155 2.5 Chloride and calcium flux assay 157 2.6 Statistical analysis 158 2.7 Systematic review 160 2.8 Experimental summary 161 CHAPTER 3: CHARACTERISATION OF 162 ANTIBODIES, SPECIFICTY OF RT-PCR PRIMERS AND METHODOLOGY OPTIMIZATION 3.1 Flow cytometry equipment 163 3.2 Cell lines selected as an effective model of human 166 cells 3.3 Preparation of mRNA and proteins 179 3.4 Specificity of primers for RT-PCR 182 3.5 Characterization and specificity of antibodies 185 CHAPTER 4: EXPRESSION OF POTENTIAL 192 CHLORIDE ION CHANNELS 4.1 Gene expression determination by RT-PCR 193 6 4.1.1 Results 193 4.1.1.1 hCLCA expression 194 4.1.1.2 Bestrophin expression 200 4.1.1.3 hANO expression 202 4.1.1.4 RT-PCR summary and densitometry 205 4.1.2 Discussion 213 4.1.2.1 hCLCA expression 213 4.1.2.2 Bestrophin expression 214 4.1.2.3 hANO expression 216 4.2 Protein expression determination by flow 217 cytometry 4.2.1 Summary of flow cytometry results 224 4.2.2 Results in context 231 4.3 Western blot analysis 232 CHAPTER 5: FUNCTIONAL ANALYSIS OF hBEST1 237 5.1 Cytokine stimulation 238 5.1.1 Results 238 5.1.2 Discussion 249 5.2 Transmigration assay 252 5.2.1 Transmigration results 252 5.2.2 Implications and discussion 257 5.3 Cl- and Ca2+ flux assays 263 CHAPTER 6: SYSTEMATIC REVIEW: IS THE GENE 265 AND PROTEIN EXPRESSION OF CHLORIDE ION CHANNELS UPREGULATED IN THE RESPIRATORY EPITHELIA, OR GRANULOCYTES, OF SUBJECTS WITH CHRONIC INFLAMMATORY LUNG DISEASE? 7 6.1 Rationale for systematic review 266 6.2 Objectives of systematic review 268 6.3 Methodology 269 6.3.1 Formulation of systematic review question 269 6.3.2 Inclusion/exclusion criteria 271 6.3.3 Identification of studies and search protocol 273 6.3.4 Assessing the risk of bias 276 6.3.5 Data extraction and synthesis of results 278 6.4 Results 279 6.4.1 Literature search results 279 6.4.2 Assessing the risk of bias 281 6.4.3 Characteristics of included studies 283 6.4.4 Data extraction 286 6.4.5 Summary of results 287 6.5 Discussion 289 6.5.1 Limitations of systematic review 290 6.5.2 Expression of chloride ion channels in asthma 293 6.5.2.1 Equine studies 293 6.5.2.2 Human studies 298 6.5.3 Expression of chloride ion channels in chronic 302 obstructive pulmonary disease (COPD) 6.5.4 Systematic review concluding remarks 303 CHAPTER 7: CONCLUSIONS 305 7.1 Limitations 306 7.2 Addressing the hypothesis 308 7.3 Concluding remarks and recommendations 313 REFERENCES 315 8 APPENDICES 368 Appendix 1: Letter of ethics approval for blood 369 harvest Appendix 2: Letter to laboratories for systematic 370 review Appendix 3: Inclusion/exclusion form for systematic 372 review Appendix 4: Risk of bias tool for systematic review 374 Appendix 5: Completed PRISMA checklist for 380 systematic review 9 LIST OF FIGURES Figure 1.1 Different pathophysiological 27 abnormalities observed in COPD and asthma Figure 1.2 Nucleus of neutrophils and eosinophils 33 under microscopy Figure 1.3 Summary of cytokine and chemokine 42 reactions in eosinophils Figure 1.4 Potential chloride ion channel structure 56 Figure 1.5 Five proposed chloride ion channel 58 categories Figure 1.6 Diagrammatical summary of postulated 98 chloride channel functions Figure 2.1 Protocol for preparation of peripheral 109 blood Figure 2.2 Analysis of primer pair hCLCA1 KW (mid) 122 using Primer-BLAST Figure 2.3 Process for DNA extraction from agarose 126 gel slice Figure 2.4 Protein standards used to measure 146 absorbance for calculation of unknown concentration of protein samples Figure 2.5 Acrylamide gel for western blot analysis 148 Figure 2.6 Summary of process for western blot 150 analysis 10 Figure 2.7 Transmigration assay equipment set up 156 Figure 3.1 Forward scatter and side scatter for 164 flow
Recommended publications
  • Screening and Identification of Key Biomarkers in Clear Cell Renal Cell Carcinoma Based on Bioinformatics Analysis

    Screening and Identification of Key Biomarkers in Clear Cell Renal Cell Carcinoma Based on Bioinformatics Analysis

    bioRxiv preprint doi: https://doi.org/10.1101/2020.12.21.423889; this version posted December 23, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Screening and identification of key biomarkers in clear cell renal cell carcinoma based on bioinformatics analysis Basavaraj Vastrad1, Chanabasayya Vastrad*2 , Iranna Kotturshetti 1. Department of Biochemistry, Basaveshwar College of Pharmacy, Gadag, Karnataka 582103, India. 2. Biostatistics and Bioinformatics, Chanabasava Nilaya, Bharthinagar, Dharwad 580001, Karanataka, India. 3. Department of Ayurveda, Rajiv Gandhi Education Society`s Ayurvedic Medical College, Ron, Karnataka 562209, India. * Chanabasayya Vastrad [email protected] Ph: +919480073398 Chanabasava Nilaya, Bharthinagar, Dharwad 580001 , Karanataka, India bioRxiv preprint doi: https://doi.org/10.1101/2020.12.21.423889; this version posted December 23, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract Clear cell renal cell carcinoma (ccRCC) is one of the most common types of malignancy of the urinary system. The pathogenesis and effective diagnosis of ccRCC have become popular topics for research in the previous decade. In the current study, an integrated bioinformatics analysis was performed to identify core genes associated in ccRCC. An expression dataset (GSE105261) was downloaded from the Gene Expression Omnibus database, and included 26 ccRCC and 9 normal kideny samples. Assessment of the microarray dataset led to the recognition of differentially expressed genes (DEGs), which was subsequently used for pathway and gene ontology (GO) enrichment analysis.
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
  • Bi-Allelic Novel Variants in CLIC5 Identified in a Cameroonian

    Bi-Allelic Novel Variants in CLIC5 Identified in a Cameroonian

    G C A T T A C G G C A T genes Article Bi-Allelic Novel Variants in CLIC5 Identified in a Cameroonian Multiplex Family with Non-Syndromic Hearing Impairment Edmond Wonkam-Tingang 1, Isabelle Schrauwen 2 , Kevin K. Esoh 1 , Thashi Bharadwaj 2, Liz M. Nouel-Saied 2 , Anushree Acharya 2, Abdul Nasir 3 , Samuel M. Adadey 1,4 , Shaheen Mowla 5 , Suzanne M. Leal 2 and Ambroise Wonkam 1,* 1 Division of Human Genetics, Faculty of Health Sciences, University of Cape Town, Cape Town 7925, South Africa; [email protected] (E.W.-T.); [email protected] (K.K.E.); [email protected] (S.M.A.) 2 Center for Statistical Genetics, Sergievsky Center, Taub Institute for Alzheimer’s Disease and the Aging Brain, and the Department of Neurology, Columbia University Medical Centre, New York, NY 10032, USA; [email protected] (I.S.); [email protected] (T.B.); [email protected] (L.M.N.-S.); [email protected] (A.A.); [email protected] (S.M.L.) 3 Synthetic Protein Engineering Lab (SPEL), Department of Molecular Science and Technology, Ajou University, Suwon 443-749, Korea; [email protected] 4 West African Centre for Cell Biology of Infectious Pathogens (WACCBIP), University of Ghana, Accra LG 54, Ghana 5 Division of Haematology, Department of Pathology, Faculty of Health Sciences, University of Cape Town, Cape Town 7925, South Africa; [email protected] * Correspondence: [email protected]; Tel.: +27-21-4066-307 Received: 28 September 2020; Accepted: 20 October 2020; Published: 23 October 2020 Abstract: DNA samples from five members of a multiplex non-consanguineous Cameroonian family, segregating prelingual and progressive autosomal recessive non-syndromic sensorineural hearing impairment, underwent whole exome sequencing.
  • Transcriptomic and Proteomic Profiling Provides Insight Into

    Transcriptomic and Proteomic Profiling Provides Insight Into

    BASIC RESEARCH www.jasn.org Transcriptomic and Proteomic Profiling Provides Insight into Mesangial Cell Function in IgA Nephropathy † † ‡ Peidi Liu,* Emelie Lassén,* Viji Nair, Celine C. Berthier, Miyuki Suguro, Carina Sihlbom,§ † | † Matthias Kretzler, Christer Betsholtz, ¶ Börje Haraldsson,* Wenjun Ju, Kerstin Ebefors,* and Jenny Nyström* *Department of Physiology, Institute of Neuroscience and Physiology, §Proteomics Core Facility at University of Gothenburg, University of Gothenburg, Gothenburg, Sweden; †Division of Nephrology, Department of Internal Medicine and Department of Computational Medicine and Bioinformatics, University of Michigan, Ann Arbor, Michigan; ‡Division of Molecular Medicine, Aichi Cancer Center Research Institute, Nagoya, Japan; |Department of Immunology, Genetics and Pathology, Uppsala University, Uppsala, Sweden; and ¶Integrated Cardio Metabolic Centre, Karolinska Institutet Novum, Huddinge, Sweden ABSTRACT IgA nephropathy (IgAN), the most common GN worldwide, is characterized by circulating galactose-deficient IgA (gd-IgA) that forms immune complexes. The immune complexes are deposited in the glomerular mesangium, leading to inflammation and loss of renal function, but the complete pathophysiology of the disease is not understood. Using an integrated global transcriptomic and proteomic profiling approach, we investigated the role of the mesangium in the onset and progression of IgAN. Global gene expression was investigated by microarray analysis of the glomerular compartment of renal biopsy specimens from patients with IgAN (n=19) and controls (n=22). Using curated glomerular cell type–specific genes from the published literature, we found differential expression of a much higher percentage of mesangial cell–positive standard genes than podocyte-positive standard genes in IgAN. Principal coordinate analysis of expression data revealed clear separation of patient and control samples on the basis of mesangial but not podocyte cell–positive standard genes.
  • Transcriptomic Uniqueness and Commonality of the Ion Channels and Transporters in the Four Heart Chambers Sanda Iacobas1, Bogdan Amuzescu2 & Dumitru A

    Transcriptomic Uniqueness and Commonality of the Ion Channels and Transporters in the Four Heart Chambers Sanda Iacobas1, Bogdan Amuzescu2 & Dumitru A

    www.nature.com/scientificreports OPEN Transcriptomic uniqueness and commonality of the ion channels and transporters in the four heart chambers Sanda Iacobas1, Bogdan Amuzescu2 & Dumitru A. Iacobas3,4* Myocardium transcriptomes of left and right atria and ventricles from four adult male C57Bl/6j mice were profled with Agilent microarrays to identify the diferences responsible for the distinct functional roles of the four heart chambers. Female mice were not investigated owing to their transcriptome dependence on the estrous cycle phase. Out of the quantifed 16,886 unigenes, 15.76% on the left side and 16.5% on the right side exhibited diferential expression between the atrium and the ventricle, while 5.8% of genes were diferently expressed between the two atria and only 1.2% between the two ventricles. The study revealed also chamber diferences in gene expression control and coordination. We analyzed ion channels and transporters, and genes within the cardiac muscle contraction, oxidative phosphorylation, glycolysis/gluconeogenesis, calcium and adrenergic signaling pathways. Interestingly, while expression of Ank2 oscillates in phase with all 27 quantifed binding partners in the left ventricle, the percentage of in-phase oscillating partners of Ank2 is 15% and 37% in the left and right atria and 74% in the right ventricle. The analysis indicated high interventricular synchrony of the ion channels expressions and the substantially lower synchrony between the two atria and between the atrium and the ventricle from the same side. Starting with crocodilians, the heart pumps the blood through the pulmonary circulation and the systemic cir- culation by the coordinated rhythmic contractions of its upper lef and right atria (LA, RA) and lower lef and right ventricles (LV, RV).
  • Data Supporting Characterization of CLIC1, CLIC4, CLIC5 and Dmclic Antibodies and Localization of Clics in Endoplasmic Reticulum of Cardiomyocytes

    Data Supporting Characterization of CLIC1, CLIC4, CLIC5 and Dmclic Antibodies and Localization of Clics in Endoplasmic Reticulum of Cardiomyocytes

    Data in Brief 7 (2016) 1038–1044 Contents lists available at ScienceDirect Data in Brief journal homepage: www.elsevier.com/locate/dib Data Article Data supporting characterization of CLIC1, CLIC4, CLIC5 and DmCLIC antibodies and localization of CLICs in endoplasmic reticulum of cardiomyocytes Devasena Ponnalagu a, Shubha Gururaja Rao a, Jason Farber a, Wenyu Xin a, Ahmed Tafsirul Hussain a, Kajol Shah a, Soichi Tanda b, Mark A. Berryman c, John C. Edwards d, Harpreet Singh a,n a Department of Pharmacology and Physiology, Drexel University College of Medicine, Philadelphia, PA 19102, United States b Department of Biological Sciences, Ohio University, Athens, OH 45701, United States c Department of Biomedical Sciences, Ohio University, Athens, OH 45701, United States d Division of Nephrology, St. Louis University, St. Louis, MO 63110, United States article info abstract Article history: Chloride intracellular channel (CLICs) proteins show 60–70% Received 22 January 2016 sequence identity to each other, and exclusively localize to the Received in revised form intracellular organelle membranes and cytosol. In support of 22 February 2016 our recent publication, “Molecular identity of cardiac mito- Accepted 16 March 2016 chondrial chloride intracellular channel proteins” (Ponnalagu Available online 26 March 2016 et al., 2016) [1], it was important to characterize the specificity Keywords: of different CLIC paralogs/ortholog (CLIC1, CLIC4, CLIC5 and Chloride intracellular channels DmCLIC) antibodies used to decipher their localization in car- Endoplasmic reticulum diac cells. In addition, localization of CLICs in the other orga- Mitochondria nelles such as endoplasmic reticulum (ER) of cardiomyocytes Cardiomyocytes was established. This article also provides data on the different primers used to show the relative abundance of CLIC paralogs in cardiac tissue and the specificity of the various CLIC antibodies used.
  • Application of Microrna Database Mining in Biomarker Discovery and Identification of Therapeutic Targets for Complex Disease

    Application of Microrna Database Mining in Biomarker Discovery and Identification of Therapeutic Targets for Complex Disease

    Article Application of microRNA Database Mining in Biomarker Discovery and Identification of Therapeutic Targets for Complex Disease Jennifer L. Major, Rushita A. Bagchi * and Julie Pires da Silva * Department of Medicine, Division of Cardiology, University of Colorado Anschutz Medical Campus, Aurora, CO 80045, USA; [email protected] * Correspondence: [email protected] (R.A.B.); [email protected] (J.P.d.S.) Supplementary Tables Methods Protoc. 2021, 4, 5. https://doi.org/10.3390/mps4010005 www.mdpi.com/journal/mps Methods Protoc. 2021, 4, 5. https://doi.org/10.3390/mps4010005 2 of 25 Table 1. List of all hsa-miRs identified by Human microRNA Disease Database (HMDD; v3.2) analysis. hsa-miRs were identified using the term “genetics” and “circulating” as input in HMDD. Targets CAD hsa-miR-1 Targets IR injury hsa-miR-423 Targets Obesity hsa-miR-499 hsa-miR-146a Circulating Obesity Genetics CAD hsa-miR-423 hsa-miR-146a Circulating CAD hsa-miR-149 hsa-miR-499 Circulating IR Injury hsa-miR-146a Circulating Obesity hsa-miR-122 Genetics Stroke Circulating CAD hsa-miR-122 Circulating Stroke hsa-miR-122 Genetics Obesity Circulating Stroke hsa-miR-26b hsa-miR-17 hsa-miR-223 Targets CAD hsa-miR-340 hsa-miR-34a hsa-miR-92a hsa-miR-126 Circulating Obesity Targets IR injury hsa-miR-21 hsa-miR-423 hsa-miR-126 hsa-miR-143 Targets Obesity hsa-miR-21 hsa-miR-223 hsa-miR-34a hsa-miR-17 Targets CAD hsa-miR-223 hsa-miR-92a hsa-miR-126 Targets IR injury hsa-miR-155 hsa-miR-21 Circulating CAD hsa-miR-126 hsa-miR-145 hsa-miR-21 Targets Obesity hsa-mir-223 hsa-mir-499 hsa-mir-574 Targets IR injury hsa-mir-21 Circulating IR injury Targets Obesity hsa-mir-21 Targets CAD hsa-mir-22 hsa-mir-133a Targets IR injury hsa-mir-155 hsa-mir-21 Circulating Stroke hsa-mir-145 hsa-mir-146b Targets Obesity hsa-mir-21 hsa-mir-29b Methods Protoc.
  • Human Induced Pluripotent Stem Cell–Derived Podocytes Mature Into Vascularized Glomeruli Upon Experimental Transplantation

    Human Induced Pluripotent Stem Cell–Derived Podocytes Mature Into Vascularized Glomeruli Upon Experimental Transplantation

    BASIC RESEARCH www.jasn.org Human Induced Pluripotent Stem Cell–Derived Podocytes Mature into Vascularized Glomeruli upon Experimental Transplantation † Sazia Sharmin,* Atsuhiro Taguchi,* Yusuke Kaku,* Yasuhiro Yoshimura,* Tomoko Ohmori,* ‡ † ‡ Tetsushi Sakuma, Masashi Mukoyama, Takashi Yamamoto, Hidetake Kurihara,§ and | Ryuichi Nishinakamura* *Department of Kidney Development, Institute of Molecular Embryology and Genetics, and †Department of Nephrology, Faculty of Life Sciences, Kumamoto University, Kumamoto, Japan; ‡Department of Mathematical and Life Sciences, Graduate School of Science, Hiroshima University, Hiroshima, Japan; §Division of Anatomy, Juntendo University School of Medicine, Tokyo, Japan; and |Japan Science and Technology Agency, CREST, Kumamoto, Japan ABSTRACT Glomerular podocytes express proteins, such as nephrin, that constitute the slit diaphragm, thereby contributing to the filtration process in the kidney. Glomerular development has been analyzed mainly in mice, whereas analysis of human kidney development has been minimal because of limited access to embryonic kidneys. We previously reported the induction of three-dimensional primordial glomeruli from human induced pluripotent stem (iPS) cells. Here, using transcription activator–like effector nuclease-mediated homologous recombination, we generated human iPS cell lines that express green fluorescent protein (GFP) in the NPHS1 locus, which encodes nephrin, and we show that GFP expression facilitated accurate visualization of nephrin-positive podocyte formation in
  • Recombinant Human Chloride Intracellular Channel Protein 5/CLIC5 (N-6His)

    Recombinant Human Chloride Intracellular Channel Protein 5/CLIC5 (N-6His)

    9853 Pacific Heights Blvd. Suite D. San Diego, CA 92121, USA Tel: 858-263-4982 Email: [email protected] 32-7190: Recombinant Human Chloride Intracellular Channel Protein 5/CLIC5 (N-6His) Gene : CLIC5 Gene ID : 53405 Uniprot ID : Q9NZA1 Description Source: E.coli. MW :30.3kD. Recombinant Human CLIC5 is produced by our E.coli expression system and the target gene encoding Met1-Ser251 is expressed with a 6His tag at the N-terminus. Chloride Intracellular Channel Protein 5 (CLIC5) is a single-pass membrane protein which belongs to the chloride channel CLIC family. It contains one GST C-terminal domain. Chloride intracellular channels are involved in chloride ion transport within various subcellular compartments. CLIC5 can insert into membranes and form selective ion channels regulated by actin that may transport chloride ions. It may play a role in the regulation of transepithelial ion absorption and secretion. CLIC5 specifically associates with the cytoskeleton of placenta microvilli. CLIC5 is required for the development and/or maintenance of the proper glomerular endothelial cell and podocyte architecture. Product Info Amount : 10 µg / 50 µg Content : Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Storage condition : Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. Amino Acid : MGSSHHHHHHSSGLVPRGSHMTDSATANGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLK GVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESN TAGIDIFSKFSAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGD ELTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAK RLSRS Application Note Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
  • Supplementary Figure S1

    Supplementary Figure S1

    Supplementary Figure S1 Supplementary Figure S2 Supplementary Figure S3 Supplementary Figure S4 Supplementary Figure S5 Supplementary Figure S6 Supplementary Table 1: Baseline demographics from included patients Bulk transcriptomics Single cell transcriptomics Organoids IBD non-IBD controls IBD non-IBD controls IBD non-IBD controls (n = 351) (n = 51) (n = 6 ) (n= 5) (n = 8) (n =8) Disease - Crohn’s disease 193 (55.0) N.A. 6 (100.0) N.A. 0 (0.0) N.A. - Ulcerative colitis 158 (45.0) 0 (0.0) 8 (100.0) Women, n (%) 183 (52.1) 34 (66.7) 5 (83.3) 1 (20.0) 4 (50.0) 5 (62.5) Age, years, median [IQR] 41.8 (26.7 – 53.0) 57.0 (41.0 – 63.0) 42.7 (38.5 – 49.5) 71.0 (52.5 – 73.0) 41.3 (35.9 – 46.5) 45.0 (30.5 – 55.9) Disease duration, years, median [IQR] 7.9 (2.0 – 16.8) N.A. 13.4 (5.8 – 22.1) N.A 10.5 (7.8 – 12.7) N.A. Disease location, n (%) - Ileal (L1) 41 (21.3) 3 (50.0) - Colonic (L2) 23 (11.9) N.A. 0 (0.0) N.A. N.A. N.A. - Ileocolonic (L3) 129 (66.8) 3 (50.0) - Upper GI modifier (+L4) 57 (29.5) 0 (0.0) - Proctitis (E1) 13 (8.2) 1 (12.5) - Left-sided colitis (E2) 85 (53.8) N.A. N.A. N.A. 1 (12.5) N.A. - Extensive colitis (E3) 60 (38.0) 6 (75.0) Disease behaviour, n (%) - Inflammatory (B1) 95 (49.2) 0 (0.0) - Fibrostenotic (B2) 55 (28.5) N.A.
  • NIH Public Access Author Manuscript FEBS Lett

    NIH Public Access Author Manuscript FEBS Lett

    NIH Public Access Author Manuscript FEBS Lett. Author manuscript; available in PMC 2011 May 17. NIH-PA Author ManuscriptPublished NIH-PA Author Manuscript in final edited NIH-PA Author Manuscript form as: FEBS Lett. 2010 May 17; 584(10): 2102±2111. doi:10.1016/j.febslet.2010.01.037. Chloride Channels of Intracellular Membranes John C. Edwards* and Christina R. Kahl UNC Kidney Center and the Division of Nephrology and Hypertension, Department of Medicine, University of North Carolina at Chapel Hill Abstract Proteins implicated as intracellular chloride channels include the intracellular ClC proteins, the bestrophins, the cystic fibrosis transmembrane conductance regulator, the CLICs, and the recently described Golgi pH regulator. This paper examines current hypotheses regarding roles of intracellular chloride channels and reviews the evidence supporting a role in intracellular chloride transport for each of these proteins. Keywords chloride channel; ClC; CLIC; bestrophin; GPHR The study of chloride channels of intracellular membranes has seen enormous advances over the past two decades and exciting recent developments have sparked renewed interest in this field. The discovery of important roles for intracellular chloride channels in human disease processes as diverse as retinal macular dystrophy, osteopetrosis, renal proximal tubule dysfunction, and angiogenesis have highlighted the importance of these molecules in critical cellular activities. Startling discoveries regarding the intracellular ClC family of proteins have forced a re-examination
  • Engineered Type 1 Regulatory T Cells Designed for Clinical Use Kill Primary

    Engineered Type 1 Regulatory T Cells Designed for Clinical Use Kill Primary

    ARTICLE Acute Myeloid Leukemia Engineered type 1 regulatory T cells designed Ferrata Storti Foundation for clinical use kill primary pediatric acute myeloid leukemia cells Brandon Cieniewicz,1* Molly Javier Uyeda,1,2* Ping (Pauline) Chen,1 Ece Canan Sayitoglu,1 Jeffrey Mao-Hwa Liu,1 Grazia Andolfi,3 Katharine Greenthal,1 Alice Bertaina,1,4 Silvia Gregori,3 Rosa Bacchetta,1,4 Norman James Lacayo,1 Alma-Martina Cepika1,4# and Maria Grazia Roncarolo1,2,4# Haematologica 2021 Volume 106(10):2588-2597 1Department of Pediatrics, Division of Stem Cell Transplantation and Regenerative Medicine, Stanford School of Medicine, Stanford, CA, USA; 2Stanford Institute for Stem Cell Biology and Regenerative Medicine, Stanford School of Medicine, Stanford, CA, USA; 3San Raffaele Telethon Institute for Gene Therapy, Milan, Italy and 4Center for Definitive and Curative Medicine, Stanford School of Medicine, Stanford, CA, USA *BC and MJU contributed equally as co-first authors #AMC and MGR contributed equally as co-senior authors ABSTRACT ype 1 regulatory (Tr1) T cells induced by enforced expression of interleukin-10 (LV-10) are being developed as a novel treatment for Tchemotherapy-resistant myeloid leukemias. In vivo, LV-10 cells do not cause graft-versus-host disease while mediating graft-versus-leukemia effect against adult acute myeloid leukemia (AML). Since pediatric AML (pAML) and adult AML are different on a genetic and epigenetic level, we investigate herein whether LV-10 cells also efficiently kill pAML cells. We show that the majority of primary pAML are killed by LV-10 cells, with different levels of sensitivity to killing. Transcriptionally, pAML sensitive to LV-10 killing expressed a myeloid maturation signature.