sign in sign up
<<
Home , Alteromonadales, Celeribacter, Cobetia, Fictibacillus, Pseudomonadaceae, Pseudomonadales

1 Supplement Evaluating the quorum quenching potential of associated to

Aurelia aurita and Mnemiopsis leidyi

Daniela Prasse1*, Nancy Weiland-Bräuer1*, Cornelia Jaspers2, Thorsten B.H. Reusch2, and Ruth

A. Schmitz1

1Institute of General , Christian-Albrechts University Kiel, Am Botanischen Garten 1-

9, 24118 Kiel, Germany

2GEOMAR Helmholtz Centre for Ocean Research Kiel, Marine Evolutionary Ecology, Kiel,

Germany

*Contributed equally to this work

2 Supplement Tab. S1: Primers used for QQ-ORF amplification and sequence analysis. Underlined parts are added restriction sites for directed cloning.

Primer Sequence 5´ 3´ 91_5/E6_ORF1_for GAATTCATGAACTTTACAGACAAATCAATTAAGGC 91_5/E6_ORF1_rev TCTAGATTACAATACTAAGCTTACTTTATGGC 91_5/E6_ORF2_for GAATTCATGCGTGGTACCCTAAACATTGC 91_5/E6_ORF2_rev AAGCTTTTACAGACCTCCCTTGAGATACCGC 91_5/E6_ORF3_for GAATTCATGAGCAACAATAAAGACACAGTGC 91_5/E6_ORF3_rev AAGCTTTTAATGAGCAACAATAAAGACACAG

3 Supplement Tab. S2: Bacteria isolated from Aurelia aurita, Mnemiopsis leidyi and ambient seawater. Bacteria were isolated by classical enrichment on agar plates and taxonomically classified based on full length 16S rRNA gene sequences. QQ activities of isolates are stated in (-) no activity, (+) low, (++) mid, and (+++) high activity against acyl-homoserine lactone (AHL) and autoinducer-2 (AI-2).

best homologue QQ taxonomic classification based on 16S full activity colony Isolate origin length rRNA gene morphology (Accession No., phylum class order family AHL AI-2 identity) A. aurita stutzeri yellowish-white, 1 medusa - -

(JX177727.1, 99%) smeary Baltic Sea A. aurita 2 medusa Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae orange, round ++ -

(JN228326.1, 99%) Baltic Sea A. aurita Pseudomonas segetis white, round, 3 medusa Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae - - (AY770691.2, 99%) smeary Baltic Sea A. aurita 4 medusa sp. 191Z-13 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae white, smeary +++ -

Baltic Sea (JX310231.1, 99%) A. aurita Uncultured bacterium white with orange 5 medusa clone ncd1928c11c1 n.a. n.a. n.a. n.a. +++ - spots, smeary Baltic Sea (JF165581.1, 93%) A. aurita white with orange 6 medusa Proteobacteria Gammaproteobacteria Vibrionales Vibrionaceae - - (KP698605.1, 99%) spots, smeary Baltic Sea A. aurita Vibrio sp. S54CA 7 medusa Proteobacteria Gammaproteobacteria Vibrionales Vibrionaceae white, smeary - - (KF188533.1, 98%) Baltic Sea A. aurita Pseudomonas stutzeri 8 medusa Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae yellow, round ++ -

(JN228326.1, 99%) Baltic Sea A. aurita Pseudomonas stutzeri 9 medusa Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae yellow, roundish + -

(JX177727.1, 99%) Baltic Sea A. aurita Pseudomonas sp. 10 medusa BJGMM-B54 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae yellow, roundish ++ - Baltic Sea (JQ716254.1, 99%) A. aurita Pseudomonas stutzeri 11 medusa Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae yellow, roundish ++ -

(JX177727.1, 99%) Baltic Sea A. aurita 12 medusa genoviensis Proteobacteria Gammaproteobacteria Alteromonadales light yellow, round ++ - Baltic Sea (FJ040187.1, 99%) 4 Supplement

A. aurita Bacillus subtilis 13 medusa white, oval - -

(JX188065.1, 98%) Baltic Sea A. aurita Microbacterium 14 medusa lacticum strain 2833 Actinobacteria Actinomycetales Microbacteriaceae white, smeary - -

Baltic Sea (EU714346.1, 99%) A. aurita Sulfitobacter sp. light orange in 15 medusa QD214-NF102 Proteobacteria +++ + centre, round

Baltic Sea (KC689801.1, 99%) A. aurita Micrococcus sp. 3455 16 medusa Actinobacteria Actinobacteria Actinomycetales Micrococcaceae white, round - -

(KP345948.1, 99%) Baltic Sea A. aurita Bacillus cereus 17 medusa Firmicutes Bacilli Bacillales Bacillaceae white, roundish - -

(KF624695.1, 98%) Baltic Sea A. aurita medusa yellow, roundish- 18 aureus Firmicutes Bacilli Bacillales Staphylococcaceae ++ + Baltic Sea smeary

(CP011528.1, 99%) husbandry A. aurita medusa Bacillus cereus 19 Firmicutes Bacilli Bacillales Bacillaceae white, smeary - - Baltic Sea (DQ339684.1, 99%) husbandry A. aurita Phaeobacter medusa 20 gallaeciensis Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae white, smeary + - Baltic Sea (NR_027609.1, 82%) husbandry A. aurita medusa Cobetia amphilecti white-orange, 21 Proteobacteria Gammaproteobacteria Cobetia + - Baltic Sea (NR_113404.1, 99%) smeary husbandry A. aurita Pseudolateromonas medusa 22 sp. MACL07 Flavobacteriia Flavobacteriales Flavobacteriaceae orange, round ++ - Baltic Sea

(EF198247.1, 99%) husbandry A. aurita medusa Sulfitobacter sp. S7-80 23 Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae white, round ++ -

Baltic Sea (KU999998.1, 99%) husbandry A. aurita Pseudoalteromonas medusa 24 sp. MACL07 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae light orange, round + - Baltic Sea

(EF198247.1, 99%) husbandry A. aurita Pseudoalteromonas medusa 25 issachenkonii Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae white, round ++ - Baltic Sea (JQ799065.1, 99%) husbandry A. aurita Enterococcus white, roundish- 73 Firmicutes Bacilli Lactobacillales Enterococcaceae + - polyp casseliflavus smeary 5 Supplement

Baltic Sea (KJ571214.1, 99%) husbandry A. aurita polyp Micrococcus sp. 3723 74 Actinobacteria Actinobacteria Actinomycetales Micrococcaceae light yellow, round - - Baltic Sea (KP345967.1, 99%) husbandry A. aurita Arthrobacter polyp 75 davidanieli Actinobacteria Actinobacteria Actinomycetales Micrococcaceae white, round - - Baltic Sea

(AF099202.1, 99%) husbandry A. aurita polyp Bacillus mycoides 76 Firmicutes Bacilli Bacillales Bacillaceae white, irregular - -

Baltic Sea (CP009692.1, 98%) husbandry A. aurita polyp Vibrio ordalii white-brownish, 77 Proteobacteria Gammaproteobacteria Vibrionales Vibrionaceae ++ -

Baltic Sea (KC884626.1, 99%) smeary husbandry A. aurita Sulfitobacter sp. polyp 78 DG885 Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae white, smeary ++ - Baltic Sea

(AY258079.1, 99%) husbandry A. aurita Olleya marilimosa polyp 79 strain KMM6714 Bacteroidetes Flavobacteriia Flavobacteriales Flavobacteriaceae orange, round +++ + Baltic Sea

(KC247324.1, 99%) husbandry A. aurita polyp Vibrio anguillarum white-brown, 80 Proteobacteria Gammaproteobacteria Vibrionales Vibrionaceae +++ -

Baltic Sea (JX966409.1, 99%) smeary husbandry A. aurita polyp Vibrio anguillarum 81 Proteobacteria Gammaproteobacteria Vibrionales Vibrionaceae yellow, round +++ ++

Baltic Sea (JX966409.1, 99%) husbandry A. aurita Arthrobacter sp. polyp 82 MB182 Actinobacteria Actinobacteria Actinomycetales Micrococcaceae white, round + - Baltic Sea

(JF706644.1, 99%) husbandry A. aurita polyp Gordonia terrae 83 Actinobacteria Actinobacteria Actinomycetales Nocardiaceae light orange, round - -

Baltic Sea (KM113032.1, 97%) husbandry A. aurita Arthrobacter sp. polyp 84 MB182 Actinobacteria Actinobacteria Actinomycetales Micrococcaceae white, round (tiny) ++ - Baltic Sea

(JF706644.1, 100%) husbandry A. aurita Staphylococcus polyp 85 warneri Firmicutes Bacilli Bacillales Staphylococcaceae white-yellow, round + - Baltic Sea

(LC035464.1, 99%) husbandry 6 Supplement

A. aurita Alpha proteobacterium polyp 86 C45 Proteobacteria Alphaproteobacteria n.a. n.a. white, smeary - - Baltic Sea (AB302365.1, 96%) husbandry A. aurita Staphylococcus sp. polyp 87 C34 Firmicutes Bacilli Bacillales Staphylococcaceae brownish, round + + Baltic Sea (JX482523.1, 99%) husbandry A. aurita polyp Paracoccus sp. UBF- 88 Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae white, smeary - -

Baltic Sea P7 (JX239761.1, 99%) husbandry A. aurita Alpha proteobacterium polyp 89 C45 Proteobacteria Alphaproteobacteria n.a. n.a. white, round - - Baltic Sea

(AB302365.1, 99%) husbandry A. aurita polyp 90 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae white-yellow, round ++ ++

Baltic Sea (FJ577648.1, 96%) husbandry A. aurita Pseudoalteromonas polyp white-brownish, 91 issachenkonii Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae +++ + Baltic Sea smeary (JQ799065.1, 98%) husbandry A. aurita polyp Pseudomonas putida 92 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae white, round ++ - Baltic Sea (GU191929.1, 99%) husbandry A. aurita Pseudomonas sp. polyp white, round with 93 GA87 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae ++ - Baltic Sea dent (AB934380.1, 99%) husbandry A. aurita Pseudomonas polyp 94 monteilii Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae orange, roundish ++ - Baltic Sea

(KP056325.1, 99%) husbandry A. aurita polyp Streptococcus infantis 95 Firmicutes Bacilli Lactobacillales Streptococcaceae white, round - - North Sea (GU561389.1, 98%) husbandry A. aurita Enterococcus polyp 96 casseliflavus Firmicutes Bacilli Lactobacillales Enterococcaceae white, round + - North Sea

(KJ571214.1, 99%) husbandry A. aurita sp. W3- polyp 97 18-1 Proteobacteria Alteromonadales Oxalobacteraceae yellowish, smeary + + North Sea

(CP000503.1, 99%) husbandry 7 Supplement

A. aurita Olleya marilimosa polyp yellow/orange, 98 strain KMM6714 Bacteroidetes Flavobacteriia Flavobacteriales Flavobacteriaceae - - North Sea smeary (KC247324.1, 99%) husbandry A. aurita Pseudoalteromonas polyp 99 issachenkonii Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae light orange, round ++ + North Sea (JQ799065.1, 99%) husbandry A. aurita Sulfitobacter sp. polyp white-yellow, 100 DG885 Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae +++ - North Sea smeary

(AY258079.1, 99%) husbandry A. aurita Pseudoalteromonas polyp very light orange, 101 issachenkonii Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae - - North Sea smeary (JQ799065.1, 99%) husbandry A. aurita white, brownish in polyp Alteromonas sp. SN2 102 Proteobacteria Gammaproteobacteria Alteromonadales Alteromonadaceae center, round- + -

North Sea (KJ781946.1, 99%) smeary husbandry A. aurita Pseudoalteromonas polyp ruthenica 103 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae brownish, smeary +++ - North Sea (NR_025140.1, 98-

husbandry 99%) A. aurita polyp Ruegeria mobilis light, orange, 104 Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae ++ -

North Sea (HQ338148.1, 99%) smeary husbandry A. aurita polyp Shewanella basaltis white-yellow, 105 Proteobacteria Betaproteobacteria Alteromonadales Oxalobacteraceae -

North Sea (KC534403.1, 99%) smeary husbandry A. aurita Hymenobacter polyp 106 psychrophilus Bacteroidetes Cytophagia Cytophagales Hymenobacteraceae orange-pink, round - - North Sea

(NR_117214.1, 98%) husbandry A. aurita polyp Luteococcus japonicas orange, round, 107 Actinobacteria Actinobacteria Actinomycetales Propionibacteriaceae + -

North Sea (NR_119351.1, 99%) smeary husbandry A. aurita Chryseobacterium polyp 108 hominis Bacteroidetes Flavobacteriia Flavobacteriales Flavobacteriaceae white, round + - North Sea

(JX100820.1, 98-99%) husbandry A. aurita Rhodococcus polyp white, roundish- 109 erythropolis PR4 Actinobacteria Actinobacteria Actinomycetales Nocardiaceae - - North Sea smeary

(CP011295.1, 100%) husbandry 8 Supplement

A. aurita Enterococcus polyp translucent, 110 casseliflavus Firmicutes Bacilli Lactobacillales Enterococcaceae - - North Sea smeary

(KJ571214.1, 98-99%) husbandry A. aurita Brevibacterium polyp 111 frigoritolerans Actinobacteria Actinobacteria Actinomycetales Brevibacteriaceae white, round +++ - North Sea (JF411310.1, 99%) husbandry A. aurita Rhodococcus sp. polyp 112 B126 Actinobacteria Actinobacteria Actinomycetales Nocardiaceae white, smeary ++ + North Sea

(KJ781946.1, 99%) husbandry A. aurita Sulfitobacter sp. 132Z- polyp 113 6 Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae white, smeary - - North Sea

(JX310150.1, 99%) husbandry A. aurita polyp North Pseudomonas stutzeri 114 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae white-yellow, round ++ -

Atlantic (HM137032.1, 99%) husbandry A. aurita polyp North osloensis 115 Proteobacteria Gammaproteobacteria Halobacteriales white, round - -

Atlantic (AB643593.1, 99%) husbandry A. aurita Enterococcus polyp North 116 casseliflavus Firmicutes Bacilli Lactobacillales Enterococcaceae white, round - - Atlantic

(KJ571214.1, 99%) husbandry A. aurita polyp North Ruegeria mobilis 117 Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae pink, smeary +++ -

Atlantic (HQ338132.1, 99%) husbandry A. aurita polyp North Micrococcus sp. 3723 118 Actinobacteria Actinobacteria Actinomycetales Micrococcaceae white, round - -

Atlantic (KP345967.1, 96%) husbandry A. aurita Pseudoalteromonas polyp North 119 issachenkonii Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae light orange, round ++ - Atlantic (JQ799065.1, 99%) husbandry A. aurita Pseudoalteromonas polyp North white-brownish, 120 sp. MACL07 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae ++ - Atlantic round

(EF198247.1, 99%) husbandry A. aurita polyp North Olleya sp. MOLA 14 121 Bacteroidetes Flavobacteriia Flavobacteriales Flavobacteriaceae light orange, round ++ -

Atlantic (AM990790.1, 99%) husbandry A. aurita sp. KMM 122 Proteobacteria Gammaproteobacteria Alteromonadales Alteromonadaceae white, smeary - - polyp North 6755 9 Supplement

Atlantic (KF273912.1, 99%) husbandry A. aurita polyp North Luteococcus japonicus 123 Actinobacteria Actinobacteria Actinomycetales Propionibacteriaceae white, round + -

Atlantic (NR_119351.1, 99%) husbandry A. aurita Staphylococcus polyp North 124 epidermidis Firmicutes Bacilli Bacillales Staphylococcaceae white, smeary - - Atlantic

(FJ030635.1, 97%) husbandry A. aurita Sulfitobacter sp. polyp North 125 DG885 Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae white, round - - Atlantic

(AY258079.1, 99%) husbandry A. aurita Sulfitobacter sp. polyp North white-orange, 126 QD214-NF102 Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae +++ - Atlantic round

(KC689801.1, 99%) husbandry A. aurita Staphylococcus polyp North 127 succinus subsp. casei Firmicutes Bacilli Bacillales Staphylococcaceae orange, roundish +++ - Atlantic

(NR_037053.1, 99%) husbandry A. aurita Rhodococcus sp. polyp North white, orange, 128 B126 Actinobacteria Actinobacteria Actinomycetales Nocardiaceae +++ - Atlantic round-smeary (KJ781946.1, 98%) husbandry A. aurita Staphylococcus polyp North white-yellow, 129 aureus Firmicutes Bacilli Bacillales Staphylococcaceae - - Atlantic roundish

(CP011528.1, 99%) husbandry A. aurita Pseudomonas polyp North 130 pachastrellae Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae white, roundish + - Atlantic

(EU603457.1, 99%) husbandry A. aurita Rhodococcus sp. polyp North 131 FXJ8.222 Actinobacteria Actinobacteria Actinomycetales Nocardiaceae translucent, round +++ - Atlantic

(KM507704.1, 99%) husbandry Uncultured bacterium M. leidyi yellow, roundish, 51 clone nck64c11c1 n.a. n.a. n.a. n.a. - - Baltic Sea smeary (KF072560.1, 92%) Micrococcus M. leidyi 52 endophyticus Actinobacteria Actinobacteria Actinomycetales Micrococcaceae light yellow, round - - Baltic Sea

(JQ659309.1, 99%) M. leidyi Alteromonas sp. 2c3 white, roundish- 53 Proteobacteria Gammaproteobacteria Alteromonadales Alteromonadaceae ++ -

Baltic Sea (AJ294361.1, 99%) smeary M. leidyi Lacinutrix sp. JR-M6 white-orange, 54 Bacteroidetes Flavobacteriia Flavobacteriales Flavobacteriaceae ++ -

Baltic Sea (KJ461692.1, 99%) round 10 Supplement

Marinomonas M. leidyi 55 hwangdonensis Proteobacteria Gammaproteobacteria Oceanospirillaceae translucent, round +++ - Baltic Sea

(NR_109448.1, 98%) M. leidyi 56 sp.BSs20120 Proteobacteria Gammaproteobacteria Alteromonadales light orange, round - - Baltic Sea

(EU330346.1, 99%) Olleya marilimosa M. leidyi 57 strain KMM6714 Bacteroidetes Flavobacteriia Flavobacteriales Flavobacteriaceae translucent, round +++ + Baltic Sea

(KC247324.1, 99%) Rhodococcus sp. M. leidyi orange, roundish- 58 ZS342 Actinobacteria Actinobacteria Actinomycetales Nocardiaceae - - Baltic Sea smeary

(JX428878.1, 99%) Microbacterium sp. M. leidyi 59 CDR2P2B2 Actinobacteria Actinobacteria Actinomycetales Microbacteriaceae white, round - - Baltic Sea (KJ567128.1, 99%) M. leidyi Alteromonas sp. 2c3 white, round, 60 Proteobacteria Gammaproteobacteria Alteromonadales Alteromonadaceae ++ -

Baltic Sea (AJ294361.1, 99%) smeary Phaeocystidibacter M. leidyi 61 luteus Bacteroidetes Flavobacteriia Flavobacteriales Cryomorphaceae dark orange, oval - - Baltic Sea

(HQ434766.1, 99%) M. leidyi Sagittula sp. BG-9-E2 62 Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae yellowish, oval - -

Baltic Sea (KF560336.1, 89%) Microbacterium M. leidyi 63 oxydans Actinobacteria Actinobacteria Actinomycetales Microbacteriaceae white, round - - Baltic Sea

(KP136285.1, 99%) M. leidyi Vibrio sp. 213 Proteobacteria Gammaproteobacteria Vibrionales Vibrionaceae yellowish, round +++ + Baltic Sea (MF975618.1, 98%) M. leidyi Pseudomonas sp. 215 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae white-yellow, round + - Baltic Sea (KM461109.1, 99%) M. leidyi Pseudoclavibacter sp. 218 Actinobacteria Actinobacteria Actinomycetales Microbacteriaceae yellow, round - - Baltic Sea (KY074321.1, 97%) Pseudoalteromonas M. leidyi 219 tunicata Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae violet, round +++ - Baltic Sea (KY319053.1, 99%) Aeromonas M. leidyi 221 salmonicida Proteobacteria Gammaproteobacteria Aeromonadales Aeromonadaceae translucent, round ++ - Baltic Sea (HG941669.1, 98%) M. leidyi Marinomonas pontica 222 Proteobacteria Gammaproteobacteria Oceanospirillales Oceanospirillaceae translucent, round +++ - Baltic Sea (NR_042965.1, 100%) Uncultured M. leidyi Alteromonas sp. clone white with black 223 Proteobacteria Gammaproteobacteria Alteromonadales Alteromonadaceae - - Baltic Sea G9UC_PoM_0m_07 center, round (KP076503.1, 98%) Pseudoalteromonas M. leidyi 224 sp. Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae white, round +++ + Baltic Sea (KY671155.1, 97%) M. leidyi sp. 225 Proteobacteria Gammaproteobacteria Halobacteriales Moraxellaceae white, spreading - - Baltic Sea (JX266367.1, 99%) 11 Supplement

M. leidyi Shewanella sp. 228 Proteobacteria Betaproteobacteria Alteromonadales Oxalobacteraceae yellow, round ++ ++ Baltic Sea (KX230028.1, 96%) M. leidyi Shewanella sp. 229 Proteobacteria Betaproteobacteria Alteromonadales Oxalobacteraceae red, round +++ + Baltic Sea (JQ867500.1, 99%) Pseudoalteromonas M. leidyi 232 sp. Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae orange, round + - Baltic Sea (JQ406678.1, 99%) M. leidyi Shewanella sp. 233 Proteobacteria Betaproteobacteria Alteromonadales Oxalobacteraceae white, round - - Baltic Sea (KX531009.1, 99%) Pseudoalteromonas M. leidyi 234 sp. Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae black, round +++ - Baltic Sea (EU935585.1, 99%) M. leidyi Shewanella sp. 235 Proteobacteria Betaproteobacteria Alteromonadales Oxalobacteraceae yellow, round ++ - Baltic Sea (KX531009.1, 99%) M. leidyi Shewanella sp. 237 Proteobacteria Betaproteobacteria Alteromonadales Oxalobacteraceae red, round - - Baltic Sea (JQ867500.1, 99%) Pseudoalteromonas M. leidyi 240 sp. Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae yellow, round +++ - Baltic Sea (HQ882787.1, 99%) Pseudoalteromonas M. leidyi 241 sp. Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae white, round - - Baltic Sea (EU330361.1, 99%) Uncultured bacterium M. leidyi 242 clone A3_91 n.a. n.a. n.a. n.a. translucent, round - - Baltic Sea (MF113934.1, 99%) Pseudoalteromonas M. leidyi 243 tunicata Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae black, round + - Baltic Sea (KY319053.1, 99%) M. leidyi Pseudomonas sp. white-yellow, 246 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae +++ - Baltic Sea (HQ844525.1, 97%) spreading M. leidyi Shewanella sp. translucent-yellow, 247 Proteobacteria Betaproteobacteria Alteromonadales Oxalobacteraceae +++ - Baltic Sea (JF825437.1, 98%) round Uncultured bacterium M. leidyi clone Woods- 248 n.a. n.a. n.a. n.a. white-yellow, round - - Baltic Sea Hole_a2237 (KF798527.1, 98%) Pseudoalteromonas M. leidyi 249 sp. Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae black, round ++ - Baltic Sea (KT583320.1, 97%) Pseudoalteromonas M. leidyi 250 sp. Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae violet, round +++ - Baltic Sea (FR821214.1, 99%) Pseudoalteromonas M. leidyi 251 tunicata Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae white, round - - Baltic Sea (KY319053.1, 99%) M. leidyi Shewanella sp. 254 Proteobacteria Betaproteobacteria Alteromonadales Oxalobacteraceae red, round +++ - Baltic Sea (KC247331.1, 99%) M. leidyi Pseudoclavibacter sp. 255 Actinobacteria Actinobacteria Actinomycetales Microbacteriaceae light yellow, round - - Baltic Sea (KM199858.1, 97%) 12 Supplement

Pseudoalteromonas M. leidyi 256 tunicata Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae yellow, round + - Baltic Sea (KY319053.1, 99%) M. leidyi Shewanella sp. 260 Proteobacteria Betaproteobacteria Alteromonadales Oxalobacteraceae white-red, round +++ + Baltic Sea (KX692892.1, 99%) M. leidyi 261 cryohalolentis Proteobacteria Gammaproteobacteria Halobacteriales Moraxellaceae white, spreading - - Baltic Sea (KY405931.1, 98%) M. leidyi Marinomonas pontica 262 Proteobacteria Gammaproteobacteria Oceanospirillales Oceanospirillaceae translucent, round +++ - Baltic Sea (NR_042965.1, 98%) Exiguobacterium M. leidyi 264 acetylicum Firmicutes Bacilli Bacillales Bacilli orange, round - - Baltic Sea (MG490164.1, 99%) M. leidyi Pseudomonas sp. 265 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae yellow, round + - Baltic Sea (KY907020.1, 98%) Phaeobacter M. leidyi translucent-yellow, 269 daeponensis Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae - - Baltic Sea oval (NR_044026.1, 99%)

M. leidyi Bacillus sp. 270 Firmicutes Bacilli Bacillales Bacillaceae black, round - -

Baltic Sea (KF746902.1, 97%)

M. leidyi Pseudoalteromonas 65 Baltic Sea atlantica Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae white, smeary + +

husbandry (KP645203.1, 99%) M. leidyi Alteromonas 66 Baltic Sea genoviensis Proteobacteria Gammaproteobacteria Alteromonadales Alteromonadaceae white, round ++ -

husbandry (FJ040187.1, 99%) M. leidyi Shewanella sp. KMM 67 Baltic Sea 6721 Proteobacteria Betaproteobacteria Alteromonadales Oxalobacteraceae translucent, round +++ ++

husbandry (KC247331.1, 99%) M. leidyi Vibrio sp. VibC-Oc- 68 Baltic Sea 066 Proteobacteria Gammaproteobacteria Vibrionales Vibrionaceae light orange, round +++ +

husbandry (KF577069.1, 99%) M. leidyi Rhodobacter sp. 69 Baltic Sea W402 Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae orange, round - -

husbandry (KF268394.1, 99%) M. leidyi Vibrio sp. VibC-Oc- white, orange in 70 Baltic Sea 066 Proteobacteria Gammaproteobacteria Vibrionales Vibrionaceae ++ - center, round husbandry (KF577069.1, 99%) M. leidyi Ochrobactrum sp. 71 Baltic Sea P1(2013) Proteobacteria Alphaproteobacteria Rhizobiales Brucellaceae white, round - -

husbandry (KF987808.1, 99%) M. leidyi Microbacterium sp. yellowish-white, 72 Baltic Sea MN2-1 Actinobacteria Actinobacteria Actinomycetales Microbacteriaceae - - round husbandry (JQ396523.1, 99%) M. leidyi Hydrogenophaga translucent-red, 217 Baltic Sea taeniospiralis Proteobacteria Betaproteobacteria Comamonadaceae - - round husbandry (AB795550.1, 99%) 13 Supplement

M. leidyi Pseudomonas sp. 226 Baltic Sea Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae light yellow, round ++ - (LC272923.1, 99%) husbandry M. leidyi Staphylococcus sp. 227 Baltic Sea Firmicutes Bacilli Bacillales Staphylococcaceae yellow-red, round - -

(MG162674.1, 99%) husbandry M. leidyi Pseudoalteromonas 239 Baltic Sea Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae white-yellow, round + -

sp. (JX310130.1, 99%) husbandry M. leidyi Thalassomonas sp. translucent-yellow, 244 Baltic Sea Proteobacteria Gammaproteobacteria Alteromonadales Colwelliaceae - -

(KC247368.1, 97%) round husbandry M. leidyi Chryseobacterium sp. 257 Baltic Sea Bacteroidetes Flavobacteriia Flavobacteriales Flavobacteriaceae yellow-red, round ++ -

(HQ911369.1, 97%) husbandry M. leidyi Alteromonas sp. 267 Baltic Sea Proteobacteria Gammaproteobacteria Alteromonadales Alteromonadaceae white, spreading + - (KX989422.1, 99%) husbandry Ambient plymuthica 214 water Baltic Proteobacteria Gammaproteobacteria Enterobacteriales Yersiniaceae red, round +++ -

(KR611045.1, 99%) Sea Ambient Pseudoalteromonas 230 water Baltic sp. Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae white, round +++ -

Sea (KM979153.1, 99%) Ambient Pseudomonas sp. 231 water Baltic Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae white, spreading - -

(JF766700.1, 99%) Sea Ambient Fictibacillus sp. translucent yellow, 253 water Baltic Firmicutes Bacilli Bacillales Bacillaceae - -

(KX033807.1, 98%) round Sea Ambient Pseudoalteromonas 259 water Baltic sp. Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae red, round ++ -

Sea (KF188488.1, 99%) Ambient Pseudoalteromonas translucent yellow, 266 water Baltic sp. Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae + - round Sea (FR821212.1, 97%) Artificial Pseudomonas light orange, 132 Seawater anguilliseptica Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae - - smeary

18 PSU (JX177685.1, 98-99%) Artificial Pseudomonas sp. 133 Seawater MBEF06 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae light orange, round - - 18 PSU (AB733556.1, 97%) Artificial Pseudomonas 134 Seawater anguilliseptica Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae light yellow, round +++ -

18 PSU (JX177685.1, 99%) Artificial Moraxella sp. 135 Seawater CHZYR52 Proteobacteria Gammaproteobacteria Halobacteriales Moraxellaceae white, round ++ - 18 PSU (AB905490.1, 99%) 14 Supplement

Artificial Pseudomonas white-yellowish, 136 Seawater anguilliseptica Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae - - round

18 PSU (JX177685.1, 99%) Artificial Sulfitobacter sp. 137 Seawater DG885 Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae white, smeary + +

18 PSU (AY258079.1, 99%) Artificial Celeribacter 138 Seawater baekdonensis Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae white, smeary - -

18 PSU (NR_117908.1, 99%) Artificial Alteromonas sp. JAM- 139 Seawater GA15 Proteobacteria Gammaproteobacteria Alteromonadales Alteromonadaceae orange, round ++ -

18 PSU (AB526338.1, 99%) Artificial Alteromonas sp. SN2 140 Seawater Proteobacteria Gammaproteobacteria Alteromonadales Alteromonadaceae white, smeary ++ -

(CP002339.1, 99%) 18 PSU Artificial Pseudomonas 141 Seawater cuatrocienegasensis Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae yellow, round - - 18 PSU (JN644592.1, 98%) Artificial Pseudomonas sp. 142 Seawater MBEF06 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae orange, smeary + -

18 PSU (AB733556.1, 99%) Artificial Rhodococcus 143 Seawater yunnanensis Actinobacteria Actinobacteria Actinomycetales Nocardiaceae white, round - - 18 PSU (JN638050.1, 99%) Artificial Staphylococcus 145 Seawater warneri Firmicutes Bacilli Bacillales Staphylococcaceae white, round ++ -

18 PSU (LC035464.1, 99%) Artificial Staphylococcus 146 Seawater pasteuri Firmicutes Bacilli Bacillales Staphylococcaceae white, round - -

18 PSU (KP267845.1, 99%) Artificial Leisingera sp. MA2-16 147 Seawater Proteobacteria alphaproteobacteria rhodobacterales rhodobacteraceae white, round - -

(KJ889016.1, 98%) 18 PSU Artificial Alteromonas sp. SN2 148 Seawater Proteobacteria Gammaproteobacteria Alteromonadales Alteromonadaceae white, smeary + -

(CP002339.1, 99%) 18 PSU Artificial Staphylococcus 149 Seawater saprophyticus Firmicutes Bacilli Bacillales Staphylococcaceae white, smeary - -

18 PSU (KM095954.1, 99%) Artificial Staphylococcus 150 Seawater warneri Firmicutes Bacilli Bacillales Staphylococcaceae white, round - -

18 PSU (LC035464.1, 99%) Artificial Staphylococcus 151 Seawater warneri Firmicutes Bacilli Bacillales Staphylococcaceae white line, round - -

18 PSU (LC035464.1, 99%) Artificial Staphylococcus sp. 152 Seawater DVRSG-2 Firmicutes Bacilli Bacillales Staphylococcaceae white line, smeary - -

18 PSU (KF779128.1, 99%) 15 Supplement

Artificial Glaciecola sp.DHVB6 153 Seawater Proteobacteria Gammaproteobacteria Alteromonadales Alteromonadaceae white, round - -

(FJ848889.1, 99%) 18 PSU Artificial Alteromonas sp. 154 Seawater EM12a Proteobacteria Gammaproteobacteria Alteromonadales Alteromonadaceae white, smeary ++ -

18 PSU (HG004180.1, 99%) Artificial sp. NP- white-yellowish, 155 Seawater 1383C-30R Proteobacteria Gammaproteobacteria Alteromonadales Alteromonadaceae +++ - round

18 PSU (KJ914666.1, 99%) Artificial Micrococcus sp. 3723 156 Seawater Actinobacteria Actinobacteria Actinomycetales Micrococcaceae yellow, round - -

(KP345967.1, 99%) 18 PSU Artificial Corynebacterium sp. 157 Seawater NML96-0244 Actinobacteria Actinomycetales Corynebacteriaceae Corynebacterium white, round - -

18 PSU (GU238410.1, 99%) Artificial Pseudomonas sp. MT- light yellow, 158 Seawater Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae + - 1 (AP014655.1, 99%) smeary 18 PSU Artificial Pseudomonas sp. light yellow, 159 Seawater MBEF06 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae + - smeary

18 PSU (AB733556.1, 98-99%) Artificial Staphylococcus 160 Seawater aureus Firmicutes Bacilli Bacillales Staphylococcaceae yellow, round - -

18 PSU (CP011528.1, 99%) Artificial Pseudomonas sp. yellow-orange, 161 Seawater MBEF06 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae - - smeary

18 PSU (AB733556.1, 98-99%) Artificial Staphylococcus 162 Seawater aureus Firmicutes Bacilli Bacillales Staphylococcaceae orange, smeary - -

18 PSU (CP011528.1, 99%) Artificial Alteromonas sp. JAM- 163 Seawater GA15 Proteobacteria Gammaproteobacteria Alteromonadales Alteromonadaceae orange, round +++ -

18 PSU (AB526338.1, 99%) Artificial Celeribacter sp. 164 Seawater CY411 Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae white, round - -

18 PSU (KP201135.1, 99%) Artificial Celeribacter white with light 165 Seawater baekdonensis Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae yellow center, - -

18 PSU (NR_117908.1, 99%) smeary Artificial Celeribacter 166 Seawater baekdonensis Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae white, smeary - -

18 PSU (NR_117908.1, 99%) Artificial Pseudoalteromonas white-yellowish, 167 Seawater sp. BSi20316 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae ++ - round

18 PSU (DQ492738.1, 99%) Artificial Salinibacterium sp. 168 Seawater ZS4-2 Actinobacteria Actinobacteria Actinomycetales Microbacteriaceae yellow, round - -

18 PSU (FJ196007.1, 99%) 16 Supplement

Artificial Rhodococcus fascians 169 Seawater Actinobacteria Actinobacteria Actinomycetales Nocardiaceae orange, roundish - -

(FJ999590.1, 99%) 18 PSU Artificial Pseudomonas stutzeri 170 Seawater strain QT 34 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae yellow, round +++ -

18 PSU (HQ848122.1, 99%) Artificial Pseudomonas sp. 171 Seawater MBEF06 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae yellowish, round ++ -

18 PSU (AB733556.1, 98-99%) Artificial Bacillus sp. O-NR1 172 Seawater Firmicutes Bacilli Bacillales Bacillaceae white, round - - (JN613469.1, 99%) 30 PSU Salinibacterium Artificial amurskyense strain light orange-white, 173 Seawater Actinobacteria Actinobacteria Actinomycetales Microbacteriaceae - - y358 round 30 PSU

(KF306352.1, 99%) Staphylococcus Artificial aureus subsp. aureus 174 Seawater Firmicutes Bacilli Bacillales Staphylococcaceae white, round - - SA268 30 PSU (CP006630.1, 93%) Artificial Micrococcus sp. 3723 orange, roundish- 175 Seawater Actinobacteria Actinobacteria Actinomycetales Micrococcaceae - - (KP345967.1, 99%) smeary 30 PSU Artificial Halomonas boliviensis 176 Seawater Proteobacteria Gammaproteobacteria Oceanospirillales Halomonadaceae light orange, round - -

(JX262399.1, 99%) 30 PSU Artificial Maribacter sp. H24 177 Seawater Bacteroidetes Flavobacteriia Flavobacteriales Flavobacteriaceae yellowish, smeary + -

(FJ903191.1, 98) 30 PSU Artificial Salinibacterium 178 Seawater amurskyense Actinobacteria Actinobacteria Actinomycetales Microbacteriaceae yellowish, round - -

30 PSU (KF306352.1, 98-99%) Artificial Bacillus sp. Aza15 179 Seawater Firmicutes Bacilli Bacillales Bacillaceae white, round - - (JQ977243.1, 99%) 30 PSU Artificial Staphylococcus white, brownish 180 Seawater aureus Firmicutes Bacilli Bacillales Staphylococcaceae +++ - center, round

30 PSU (CP011528.1, 99%) Artificial Chryseobacterium sp. light orange, 181 Seawater WW-RP5 Bacteroidetes Flavobacteriia Flavobacteriales Flavobacteriaceae - - smeary

30 PSU (KJ958497.1, 99%) Artificial Microbacterium sp. 182 Seawater Cai-b5 Actinobacteria Actinobacteria Actinomycetales Microbacteriaceae pink, round - -

30 PSU (JX997907.1, 99%) Artificial Bacillus simplex white, brownish 184 Seawater Firmicutes Bacilli Bacillales Bacillaceae - - (KJ161409.1, 96%) center, round 30 PSU Artificial Alteromonas macleodii 185 Proteobacteria Gammaproteobacteria Alteromonadales Alteromonadaceae orange, round +++ -

Seawater (KP074899.1, 99%) 17 Supplement

30 PSU

Artificial Alteromonas sp. 186 Seawater SCS1700m-1 Proteobacteria Gammaproteobacteria Alteromonadales Alteromonadaceae brownish, round +++ -

30 PSU (JX533655.1, 99%) Artificial Bacillus sp. 7B-230 187 Seawater Firmicutes Bacilli Bacillales Bacillaceae pink, smeary - -

(KF441670.1, 99%) 30 PSU Sulfitobacter Artificial pseudonitzschiae 188 Seawater Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae white, smeary +++ - strain H3 30 PSU

(KF006321.2, 99%) Artificial Bacillus vietnamensis 189 Seawater Firmicutes Bacilli Bacillales Bacillaceae pink, round - - (KF933713.1, 100%) 30 PSU Artificial Pseudoalteromonas 190 Seawater sp. 191Z-13 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae light-orange, round - - 30 PSU (JX310231.1, 99%) Artificial Celeribacter sp. 191 Seawater CY411 Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae white, round - -

30 PSU (KP201135.1, 99%) Artificial Microbacterium sp. light orange, 192 Seawater JL1103 Actinobacteria Actinobacteria Actinomycetales Microbacteriaceae - - smeary

30 PSU (DQ985063.1, 99%) Artificial Brevibacterium 193 Seawater frigoritolerans Actinobacteria Actinobacteria Actinomycetales Brevibacteriaceae white, roundish ++ -

30 PSU (KJ767331.1, 99%) Artificial Cobetia amphilecti 194 Seawater Proteobacteria Gammaproteobacteria Halomonadaceae Cobetia pink, round + -

(KP204120.1, 85%) 30 PSU Artificial Bacillus sp. T1T 195 Seawater Firmicutes Bacilli Bacillales Bacillaceae translucent, round - - (AM983464.1, 99%) 30 PSU Artificial Pseudomonas 196 Seawater syringae pv. pisi Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae yellow, round +++ + 30 PSU (KP211411.1, 99%) Artificial Pseudomonas 197 Seawater pachastrellae Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae white, round - - 30 PSU (KM460937.1, 99%) Artificial white, round, Maribacter sp. H24 199 Seawater Bacteroidetes Flavobacteriia Flavobacteriales Flavobacteriaceae smeary in high - -

(FJ903191.1, 93) 30 PSU density Artificial Pseudoalteromonas 200 Seawater sp. AB293f Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae grey-white, round ++ -

30 PSU (FR821202.1, 99%) Artificial Cobetia amphilecti 201 Seawater Proteobacteria Gammaproteobacteria Halomonadaceae Cobetia white, round ++ -

(NR_113404.1, 99%) 30 PSU 18 Supplement

Artificial Maribacter sp. H24 202 Seawater Bacteroidetes Flavobacteriia Flavobacteriales Flavobacteriaceae white, round, small - - (FJ903191.1, 99%) 30 PSU Artificial Pseudoalteromonas white, round, 203 Seawater espejiana Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae smeary in high +++ - 30 PSU (KP204135.1, 99%) density Artificial Sulfitobacter sp. white, round, 204 Seawater QD214-NF102 Proteobacteria Alphaproteobacteria Rhodobacterales Rhodobacteraceae smeary in high - -

30 PSU (KC689801.1, 99%) density Artificial Pseudomonas sp. 205 Seawater MBTN3D1-a3 Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae white, round - -

30 PSU (JN975148.1, 89%) Artificial white- Bacillus mycoides 206 Seawater Firmicutes Bacilli Bacillales Bacillaceae orange/brownish, - -

(CP009692.1, 99%) 30 PSU smeary Artificial Bacillus hwajinpoensis white-orange, 207 Seawater Firmicutes Bacilli Bacillales Bacillaceae - -

(KJ009474.1, 99%) smeary 30 PSU Artificial Pseudoalteromonas white-yellowish, 208 Seawater issachenkonii Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae + - smeary 30 PSU (JQ799065.1, 99%) Artificial Brevibacterium 209 Seawater frigoritolerans Actinobacteria Actinobacteria Actinomycetales Brevibacteriaceae white, roundish - -

30 PSU (KF475857.1, 99%) Artificial Bacillus simplex 210 Seawater Firmicutes Bacilli Bacillales Bacillaceae white, smeary ++ -

(KM817245.1, 99%) 30 PSU Artificial Fictibacillus translucent, 212 Seawater phosphorivorans Firmicutes Bacilli Bacillales Bacillaceae - - smeary

30 PSU (NR_118455.1, 99%)

19 Supplement Sequence data of identified putative QQ-ORFs of fosmid clone 5/E6 originating from the genomic library of isolate 91 (Pseudoalteromonas issachenkonii)

I. 91_5/E6_ORF1

Best homologue Protein Accession No. Identity (based on aa sequence) Pseudoalteromonas sp. Integrase WP_024602773.1 98 % TB41

>ORF1_nucleotide sequence

ATGAACTTTACAGACAAATCAATTAAGGCACTTAAGGCCAAAGAAAAACGTTACGTATTAACCGAGTCAGGTAACTAT GGGGAAGGGCGTTTACAAATAAGGGTGAGTGAATCAGGCGCTAAAACGTTTCGGGTTCAGTATCACATAAACGGTAAG CGCAAAGTAATTGGTCTTGGTAATTATCCTACCGTTGATCTTAAAAAAGCACGTAGTAAACATGCAAAAATAGCAGTC TTATTAAGTGACAATATCGACCCGCAAGAGCATCAATTAGAAGCCCAAAAAATAGAGTTCGAATCATCAGCAAAGCGT ACCATGTTACAAATGCTCGCTGACTTTAATGTATTCATAAGTACACGCTGGGCAGAGTCAACAATAGACCGAACTGAA AAACTCATTAAAAGAAACATCACCCCGTTTATAAAACCCGAATTAATGCCCGACGAGTTCACCATAGATATGGCCCGC GACATTATTTACCGTGTTTATAATCGTGGCGCAAAAGAACAAGCGCGACTAGTTCGCAGCATACTAATGAGCATATTA AAATTTGCTATAGATTTTGATAACTCACCAGAGCAATACAAAAAGCCAAACCTATACGACATAAAAACAAATTTCATC AGAGACATTAACTTTGAAACGCCAAAAAACAAAGGTGAACGCTGGTTAAGCGAGGCTGAACTAAAAAAAGTATGGAAT GCAGACGACCTACCTTATTACACCCACCAATACATAAAACTGGCATTATTACTTGGTGGTCAGCGAGTAAATGAGGTT TACGGCTCATACGTAAGTGACTTTGATTTAGAAAATAAAACTTTCACTATCCCCGCAAATCGTATCAAAGTACAACAA CGGGGCGATCACATAGTGCCATTATGCGAAACCGCAATACCAATCATCCAAGAGCTAATTCAACAAGCAGGTAAAGCT GGTCAAATGTTCCCGCATCGCGACAACCCAACAGCCACCGCCCATGTATCAACACTTCGAATGGCAATATTACGATGG TGCGAAAAAAACAAAGTGCCAAACTTTAATCCCCGTGATCTACGCAGAACGTGTAAAACACTCATGGGCAAAGCAGGC ATAGATAAAATAAACCGCGACATACTGCAGCAACACAACAAGTTTGATGTATCAAGTGTGCATTACGACAGATACGAC TATATGAAAGAAAAACGCCAAAGCATTGAGGTGTGGGAAACTGCTTATGAATTGTGCCATAAAGTAAGCTTAGTATTG TAA

>ORF1_amino acid sequence

MNFTDKSIKALKAKEKRYVLTESGNYGEGRLQIRVSESGAKTFRVQYHINGKRKVIGLGNYPTVDLKKARS KHAKIAVLLSDNIDPQEHQLEAQKIEFESSAKRTMLQMLADFNVFISTRWAESTIDRTEKLIKRNITPFIK PELMPDEFTIDMARDIIYRVYNRGAKEQARLVRSILMSILKFAIDFDNSPEQYKKPNLYDIKTNFIRDINF ETPKNKGERWLSEAELKKVWNADDLPYYTHQYIKLALLLGGQRVNEVYGSYVSDFDLENKTFTIPANRIKV QQRGDHIVPLCETAIPIIQELIQQAGKAGQMFPHRDNPTATAHVSTLRMAILRWCEKNKVPNFNPRDLRRT CKTLMGKAGIDKINRDILQQHNKFDVSSVHYDRYDYMKEKRQSIEVWETAYELCHKVSLVL

II. 91_5/E6_ORF2

Best homologue Protein Accession No. Identity (based on aa sequence) Pseudoalteromonas Cation/H+ WP_096038305.1 98 % 20 Supplement

teradonis antiporter

>ORF2_nucleotide sequence

ATGCGTGGTACCGACACTTGGTTTTTATTAGTCGGTTTGACGGGTTTAACTACACTTTTATTTGGCGCTTACATCGCG CTATTCAAACATGATTTAAAAGGCTTATTAGCCTATTCAACAATTAGTCATTTAGGCCTAATTACTCTATTACTCGGC CTAGACACACAACTTGCAACCGTAGCCGCTATTTTTCATATTATTAACCATGCTACGTTTAAAGCGTCGTTATTTATG GCCACGGGTATTATTGACCATGAAACCGGCACGCGTGATATGCGCAAACTCAATGGCATGTGGCGCTACTTACCTTAT ACGGCCACATTAGCGATGGTGGCCGCTGCCGCTATGGCGGGTGTACCGCTATTAAATGGTTTCTTATCTAAAGAAATG TTTTTTGCTGAAACACTGCATCAGCAAGTACTTGGCTCTATGTCGTGGTTAATTCCTGTGCTGGCAACCGTTGCAGGT GCGCTGTCGGTAGCGTACTCATCTCGCTTTATTCATGACGTGTTCTTTAATGGTGAACCGATAGACTTACCACGCACC CCTCATGAGGCGCCACGTTATATGCGTGTGCCTATCGAAATTTTAGTGGTGCTATGTATTTTAGTGGGTATTTTTCCG CACTTTGCAGTAGATGGTATTTTATCGGCTGCCTCATTGGCCGTACTTGGCCAAGCTATGCCTGAGTACAAGCTAACT ATTTGGCACGGTTTCAATTTACCTCTACTTATGAGTGGTATGGCGGTGATTGGTGGTTTATTTATTTACGTTAATCGT AAGTACTTGTTCCAGTTTCAGGCGTCGTTACCTCCTTTTAACGCTAAAAAAATCTTCGAGCGTTTTTTAGCGGTTGTG GTTAATTGGTGTCAAAACAAAATCCAATCAAACAGAAAATGGCTCATTACAACGCTATGTATTTATTATGTTAGGTGT TGTATTGCTTGCCTCAGGTTGGCCATTATTTGA

>ORF2_amino acid sequence

MRGTDTWFLLVGLTGLTTLLFGAYIALFKHDLKGLLAYSTISHLGLITLLLGLDTQLATVAAIFHIINHATFKASLFM ATGIIDHETGTRDMRKLNGMWRYLPYTATLAMVAAAAMAGVPLLNGFLSKEMFFAETLHQQVLGSMSWLIPVLATVAG ALSVAYSSRFIHDVFFNGEPIDLPRTPHEAPRYMRVPIEILVVLCILVGIFPHFAVDGILSAASLAVLGQAMPEYKLT IWHGFNLPLLMSGMAVIGGLFIYVNRKYLFQFQASLPPFNAKKIFERFLAVVVNWCQNKIQSNRKWLITTLCIYYVRC CIACLRLAII

III. 91_5/E6_ORF3

Best homologue Protein Accession No. Identity (based on aa sequence) Pseudoalteromonas sp. Cation/H+ WP_09049398.1 100 % DSM 26666 antiporter

>ORF2_nucleotide sequence

ATGCACGGCGGCGGTAAACCAAAAACACGTGCAGCACTGCATTACGTTATTTTAAACTTGGTTGGCTCAAGTGTATTT TTAATCGGCTTAGGTATTTTATATGGGGTATTGGGTACCCTAAACATTGCTGATATGGCTAATAAAGTACCGCAGTTA ACTGGTGATGATGTTTATTTAGCTAAAGCGGGCGGGTTACTATTGCTTGTAGTATTTGCCCTTAAAAGTGCACTATTA CCACTGCATTTATGGCTCCCAAATGCCTATTCAAGTGCGACACCTGTGGTTGCTGCATTATTCGCGATTATGACCAAA GTAGGTGTTTACGCCACTTTACGCGTATATACAGTGGTATTTGGTGAGCAAGCCGGTGAACTTGAGCATATGGCGCAG TCTTGGCTATGGGCGTTGGCCATTGCTACTATAGTGATTGGGGCAATCGGGGTGTTGGCAGCACAAGATTTACGTAAG CTTACCGCAAACTTAGTACTGGTTTCTGTGGGTACTTTAGTGGCACTGGTTGCACTTCAAAATATAAACGCCACAGCT GCACTATTGTATTATTTGGTGCACTCAACGTTAGTGACTGCAGCACTATTTTTACTGGCTGATTTAATTGCAACTCAG CGAGGTAAAGCCGGCGACAGATTAGTTGGCGGACGCGCAGTTAAACAACCATTCTTGTTGGGAGCGTGTTTTATTATC GCTGGACTAACCGTCATAGGTATGCCGCCACTTTCAGGTTTTGTAGGTAAAATTTGGATTTTAAAAACCACCTTAAAC AGTGAGCAAGCACTGGTATTTTGGCCTGTTTACTTAATTATGAGCTTAGCGTTAATTGTTGCTATATCACGTGCAGGC ACGAGTTTGTTTTGGGAGCATAAAGACAAAGGCGGTGAGGCTGGTGATGTTGCTAATGCACATCCGTTGCAAGTTATC 21 Supplement GTACTTGTTGGCCTGCTCACAAGCTCAATACTGTTGGTTGTTTTTGGTGATTTGGCAACGCAATATGCACTTGAAACA GCAACACAACTTCATGATATTAGTGGTGGTATTAATGCGGTACTCAAGGGAGGTCTGTAA

>ORF3_amino acid sequence

MHGGGKPKTRAALHYVILNLVGSSVFLIGLGILYGVLGTLNIADMANKVPQLTGDDVYLAKAGGLLLLVVFALKSALL PLHLWLPNAYSSATPVVAALFAIMTKVGVYATLRVYTVVFGEQAGELEHMAQSWLWALAIATIVIGAIGVLAAQDLRK LTANLVLVSVGTLVALVALQNINATAALLYYLVHSTLVTAALFLLADLIATQRGKAGDRLVGGRAVKQPFLLGACFII AGLTVIGMPPLSGFVGKIWILKTTLNSEQALVFWPVYLIMSLALIVAISRAGTSLFWEHKDKGGEAGDVANAHPLQVI VLVGLLTSSILLVVFGDLATQYALETATQLHDISGGINAVLKGGL