Snapshot: Connexins and Disease Dale W

Total Page:16

File Type:pdf, Size:1020Kb

Load more

SnapShot:SnapShot: XXXXXXXXXXXXXXXX Connexins and Disease 1 2 3 AUTHORDale W. XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX Laird, Christian C. Naus, and Paul D. Lampe 1Department of Anatomy and Cell Biology, University of Western Ontario, London, ON N6A 5C1, Canada AFFILIATION XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 2Department of Cellular & Physiological Sciences, University of British Columbia, Vancouver, BC V6T 1Z3, Canada 3Fred Hutchinson Cancer Research Center, Seattle, WA 98109, USA Typical life cycle of connexins Mechanisms linked to connexin diseases Hyperactive mixed Hemichannel Loss of function Gain of function Leaky hemichannel hemichannel Dead hemichannel Gap junction Oligomer Lysosome Transdominant Defective channel Interactome Golgi retention turnover Monomer ERAD Aberrant Defective oligomerization interactome Connexosome Dead gap NUC LEUS junction channels Connexin Connexin Connexin Molecules subtype 1 subtype 2 interactor <1.5 kDa N U C LEUS Connexin subtype 1 Connexin subtype 2 Mutant connexin NUC LEUS Connexin genes linked to disease Diseases/genetic Principle Other connexin Inheritance Frequency Number of Most affected Other affected disorders connexin genes (protein) reported organ/tissue/cells organs/tissues gene (protein) mutations Sensorineural GJB2 (Cx26) GJB6 (Cx30), GJB3 (Cx31) Primarily recessive ~1-2/2000 ~135 Inner ear/cochlea Skin (epidermis) hearing loss Congenital cataracts GJA8 (Cx50) GJA3 (Cx46) Dominant and recessive 15% inherited cataracts ~70 Lens None reported Charcot-Marie-Tooth GJB1 (Cx32) None X-linked ~1/50,000 >300 PNS/Schwann cell Occasionally CNS disease x-linked myelination Pelizaeus-Merzbacher- GJC2 (Cx47) None Recessive Extremely rare ~40 CNS/oligodendro- Other CNS functions, like disease-1 cytes myelination Lymphatics Skin diseases GJB2 (Cx26) GJB6 (Cx30), GJB4 (Cx30.3), Primarily recessive Rare ~50 Skin (epidermis) Hearing GJB3 (Cx31), GJA1 (Cx43) Arrhythmias GJA5 (Cx40) GJA1 (Cx43) Dominant Extremely rare ~15 Heart Developing organs for GJA1 Oculodentodigital GJA1 (Cx43) None Primarily dominant ~1-2/100,000 ~75 Eyes, enamel, Bladder, skin, CNS, others dysplasia digits, facial bones Sensorineural Organ of Corti GJB2, Cx26 Skin diseases GJB2, Cx26 hearing loss Normal Hair cell death Connective Cornified Cochlea Epithelial gap tissue gap Granular junction network junction network Spinous Basal Mutation site Basement Congenital cataracts membrane GJA3, Cx46 GJA8, Cx50 Thicker Flaky and/or loss Eyee Lens Fiber cells of barrier function Cataract Epithelial cells Arrhythmias Normal Demyelinating diseases Pelizaeus- Merzbacher- GJC2, Cx47 Charcot-Marie-Tooth Astrocyte like disease-1 neuropathy x-linked Atriumm Atrial fibrillation Schwann cell Node of Ranvier Myelin sheath PNS CNS His bundle Branch bundles GJB1, Cx32 Purkinje fibers Oligodendrocyte Oculodentodigital dysplasia and related diseases Adult GJA5, Cx40 GJA1, Cx43 Ectoderm Small eyes Enamel loss Tooth decay Fused digits Zygote Day 2 Day 3 Morula Blastocyst Craniofacial bone embryo embryo Mesoderm Endoderm abnormalities Cx26 Cx30 Cx30.3 Cx31Cx32 Cx40 Cx43 Cx46 Cx47 Cx50 See online version for 1260 Cell 170, September 07, 2017 © 2017 Elsevier Inc. DOI http://dx.doi.org/10.1016/j.cell.2017.08.034 legends and references 2 Cell ???, ??MONTH?? ??DATE??, 200? ©200? Elsevier Inc. DOI XXXXXXXXX See online version for ??? SnapShot: Connexins and Disease Dale W. Laird,1 Christian C. Naus,2 and Paul D. Lampe3 1Department of Anatomy and Cell Biology, University of Western Ontario, London, ON N6A 5C1, Canada 2Department of Cellular & Physiological Sciences, University of British Columbia, Vancouver, BC V6T 1Z3, Canada 3Fred Hutchinson Cancer Research Center, Seattle, WA 98109, USA Connexin Life Cycle and Linked Diseases Gap junctions, composed of one or more of the 21-member connexin (Cx) family, are found in virtually every cell type of the human body. Their function as intercellular chan- nels is primarily defi ned by their ability to pass small signaling molecules, metabolites, and electrical stimuli directly between contacting cells. Given their ubiquitous distribution in the human body, it is not surprising that germ-line mutations in ten connexin genes lead to more than two dozen human diseases through loss- or gain-of-function molecular mechanisms (Srinivas et al., 2017; Kelly et al., 2015). Of note, the recognized role of connexins in human physiology and/or pathology has expanded to include hemichannel exchange of small molecules with the extracellular milieu (Laird, 2006). Connexins are integral membrane proteins that oligomerize into homomeric or heteromeric hexamers (also called connexons) in the endoplasmic reticulum or Golgi appara- tus. Upon microtubule-dependent transport to the cell surface, connexons may function as hemichannels or quickly dock with connexons from an opposing cell to assemble a gap junction channel. Connexons sequester into tightly packed structures termed gap junctions, which may be composed of a single or multiple connexin types. The connexin interactome that consists of dozens of binding proteins has been shown to play critical roles in gap junction assembly, stability, channel regulation, and intracellular signaling pathways. During turnover, one of the two contacting cells sharing a gap junction ingests an entire gap junction or gap junction fragments into a unique structure called a con- nexosome (or annular junction), where they fuse with lysosomes to be degraded. Most, but not all, connexins have an unusually short half-life of 1–4 hr (Laird, 2006). Contribution to Human Disease Disease-causing mutations in connexin genes have different effects on connexin proteins. In some cases, the mutant connexin fails quality control mechanisms and proceeds to endoplasmic reticulum associated degradation (ERAD) or gets stalled in the Golgi apparatus. Mutant connexins may lose the ability to form functional hemichannels or gap junction channels likely due to aberrant formation of the channel pore. In other cases, connexins acquire an aberrant half-life or lose interactions with the interactome, all of which can contribute to human pathologies. Gain-of-function mechanisms occur when some mutants bind or oligomerize with co-expressed connexins that they would normally not oligomerize with. These aberrant interactions can lead to transdominant effects on wild-type connexins that result in activated hemichannels and/or dead gap junction channels. Other connexin mutants form leaky homomeric hemichannels that may contribute to cellular pathologies. Impact on Sensory Organs. By far the most common connexin-linked disease is sensorineural hearing loss, which occurs in ~1/2,000 births (Chan and Chang, 2014). Mutation of the GJB2 gene encoding Cx26 constitutes the vast majority of children born with sensorineural hearing loss, with the 35delG mutation being the most common (Petit et al., 2001). The mechanism underpinning GJB2-linked hearing loss in the cochlea is still not fully understood but is likely linked to hair cell death due to aberrant metabolite or ion dispersion within the cochlea. Mutations in GJB3 (Cx31) and GJB6 (Cx30) have both also been linked to sensorineural hearing loss. The eyes are also impacted by mutations, as congenital cataract is the leading cause of reversible blindness in children. GJA3 (Cx46) and GJA8 (Cx50) are exceptionally long-lived connexins in the lens and function in this avascular tissue to enable metabolite, ion, and nutrient exchange (Srinivas et al., 2017). Demyelinating Diseases. GJB1 (Cx32) mutations disrupt the inter-lamellar cytoplasmic continuity within the Schmidt-Lanterman Incisures of Schwann cells, causing the demyelinating disorder Charcot-Marie-Tooth X-linked disease (CMTX1) (Bergoffen et al., 1993). Mutations in the GJC2 (Cx47) gene disrupt heterotypic gap junctions between astrocytes and oligodendrocytes within the CNS, which leads to impairments in oligodendrocyte function and the onset of an extremely rare demyelinating disease called Pelizaeus-Merzbacher-like disease-1 (aka- hypomyelinating leukodystrophy-2) (Uhlenberg et al., 2004). Skin Disease. Mutations in fi ve connexins genes (GJB2, GJB6, GJB4, GJB3, and GJA1) expressed in keratinocytes can cause many rare skin diseases that range in severity from mild increases in skin thickness to life-threatening and fatal barrier breakdown (Lilly et al., 2016). In the case of keratitis-ichthyosis with deafness, often dominant gain-of- function properties caused by leaky mutant connexin hemichannels act to dysregulate calcium homeostasis in the epidermis. Many mutants also cause hearing loss in patients. Others connexin-associated skin diseases include erythrokeratoderma (Cx30.3 and Cx31), Clouston syndrome (Cx30), and palmoplantar keratoderma and erythrokeratodermia variablilis et progressiva (Cx43). Arrhythmias. Given that the GJA5 (Cx40) gene is expressed in both the atria and the conduction system of the heart, it may not be surprising that mutations have been found in a few rare cases of early onset atrial fi brillation (AF) patients (Bai, 2014). One or more GJA1 (Cx43) gene mutations may also be associated with other arrhythmias (Lübkemeier et al., 2015). Oculodentodigital Dysplasia and Related Developmental Abnormalities. Oculodentodigital dysplasia (ODDD) is a complex disease involving multiple organs owing to the expression of the GJA1 (Cx43) gene early on during development and its ubiquitous distribution in the human body (Paznekas et al., 2009). ODDD patients typically exhibit small eyes, enamel
Recommended publications
  • SRC Antibody - N-Terminal Region (ARP32476 P050) Data Sheet

    SRC Antibody - N-Terminal Region (ARP32476 P050) Data Sheet

    SRC antibody - N-terminal region (ARP32476_P050) Data Sheet Product Number ARP32476_P050 Product Name SRC antibody - N-terminal region (ARP32476_P050) Size 50ug Gene Symbol SRC Alias Symbols ASV; SRC1; c-SRC; p60-Src Nucleotide Accession# NM_005417 Protein Size (# AA) 536 amino acids Molecular Weight 60kDa Product Format Lyophilized powder NCBI Gene Id 6714 Host Rabbit Clonality Polyclonal Official Gene Full Name V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) Gene Family SH2D This is a rabbit polyclonal antibody against SRC. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the Description of Target regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the
  • Post-Mortem Whole-Exome Analysis in a Large Sudden Infant Death Syndrome Cohort with a Focus on Cardiovascular and Metabolic Genetic Diseases

    Post-Mortem Whole-Exome Analysis in a Large Sudden Infant Death Syndrome Cohort with a Focus on Cardiovascular and Metabolic Genetic Diseases

    European Journal of Human Genetics (2017) 25, 404–409 & 2017 Macmillan Publishers Limited, part of Springer Nature. All rights reserved 1018-4813/17 www.nature.com/ejhg ARTICLE Post-mortem whole-exome analysis in a large sudden infant death syndrome cohort with a focus on cardiovascular and metabolic genetic diseases Jacqueline Neubauer*,1, Maria Rita Lecca2, Giancarlo Russo2, Christine Bartsch3, Argelia Medeiros-Domingo4, Wolfgang Berger5,6,7 and Cordula Haas1 Sudden infant death syndrome (SIDS) is described as the sudden and unexplained death of an apparently healthy infant younger than one year of age. Genetic studies indicate that up to 35% of SIDS cases might be explained by familial or genetic diseases such as cardiomyopathies, ion channelopathies or metabolic disorders that remained undetected during conventional forensic autopsy procedures. Post-mortem genetic testing by using massive parallel sequencing (MPS) approaches represents an efficient and rapid tool to further investigate unexplained death cases and might help to elucidate pathogenic genetic variants and mechanisms in cases without a conclusive cause of death. In this study, we performed whole-exome sequencing (WES) in 161 European SIDS infants with focus on 192 genes associated with cardiovascular and metabolic diseases. Potentially causative variants were detected in 20% of the SIDS cases. The majority of infants had variants with likely functional effects in genes associated with channelopathies (9%), followed by cardiomyopathies (7%) and metabolic diseases (1%). Although lethal arrhythmia represents the most plausible and likely cause of death, the majority of SIDS cases still remains elusive and might be explained by a multifactorial etiology, triggered by a combination of different genetic and environmental risk factors.
  • A Rare Missense Mutation in GJB3 (Cx31g45e) Is Associated with a Unique Cellular Phenotype Resulting in Necrotic Cell Death Easton, J

    A Rare Missense Mutation in GJB3 (Cx31g45e) Is Associated with a Unique Cellular Phenotype Resulting in Necrotic Cell Death Easton, J

    University of Dundee A rare missense mutation in GJB3 (Cx31G45E) is associated with a unique cellular phenotype resulting in necrotic cell death Easton, J. A.; Alboulshi, A. K.; Kamps, M. A. F.; Brouns, G. H.; Broers, M. R.; Coull, B. J.; Oji, V.; van Geel, M.; van Steensel, M. A. M.; Martin, P. E. Published in: Experimental Dermatology DOI: 10.1111/exd.13542 Publication date: 2018 Document Version Peer reviewed version Link to publication in Discovery Research Portal Citation for published version (APA): Easton, J. A., Alboulshi, A. K., Kamps, M. A. F., Brouns, G. H., Broers, M. R., Coull, B. J., ... Martin, P. E. (2018). A rare missense mutation in GJB3 (Cx31G45E) is associated with a unique cellular phenotype resulting in necrotic cell death. Experimental Dermatology. https://doi.org/10.1111/exd.13542 General rights Copyright and moral rights for the publications made accessible in Discovery Research Portal are retained by the authors and/or other copyright owners and it is a condition of accessing publications that users recognise and abide by the legal requirements associated with these rights. • Users may download and print one copy of any publication from Discovery Research Portal for the purpose of private study or research. • You may not further distribute the material or use it for any profit-making activity or commercial gain. • You may freely distribute the URL identifying the publication in the public portal. Take down policy If you believe that this document breaches copyright please contact us providing details, and we will remove access to the work immediately and investigate your claim.
  • Viewed Under 23 (B) Or 203 (C) fi M M Male Cko Mice, and Largely Unaffected Magni Cation; Scale Bars, 500 M (B) and 50 M (C)

    Viewed Under 23 (B) Or 203 (C) fi M M Male Cko Mice, and Largely Unaffected Magni Cation; Scale Bars, 500 M (B) and 50 M (C)

    BRIEF COMMUNICATION www.jasn.org Renal Fanconi Syndrome and Hypophosphatemic Rickets in the Absence of Xenotropic and Polytropic Retroviral Receptor in the Nephron Camille Ansermet,* Matthias B. Moor,* Gabriel Centeno,* Muriel Auberson,* † † ‡ Dorothy Zhang Hu, Roland Baron, Svetlana Nikolaeva,* Barbara Haenzi,* | Natalya Katanaeva,* Ivan Gautschi,* Vladimir Katanaev,*§ Samuel Rotman, Robert Koesters,¶ †† Laurent Schild,* Sylvain Pradervand,** Olivier Bonny,* and Dmitri Firsov* BRIEF COMMUNICATION *Department of Pharmacology and Toxicology and **Genomic Technologies Facility, University of Lausanne, Lausanne, Switzerland; †Department of Oral Medicine, Infection, and Immunity, Harvard School of Dental Medicine, Boston, Massachusetts; ‡Institute of Evolutionary Physiology and Biochemistry, St. Petersburg, Russia; §School of Biomedicine, Far Eastern Federal University, Vladivostok, Russia; |Services of Pathology and ††Nephrology, Department of Medicine, University Hospital of Lausanne, Lausanne, Switzerland; and ¶Université Pierre et Marie Curie, Paris, France ABSTRACT Tight control of extracellular and intracellular inorganic phosphate (Pi) levels is crit- leaves.4 Most recently, Legati et al. have ical to most biochemical and physiologic processes. Urinary Pi is freely filtered at the shown an association between genetic kidney glomerulus and is reabsorbed in the renal tubule by the action of the apical polymorphisms in Xpr1 and primary fa- sodium-dependent phosphate transporters, NaPi-IIa/NaPi-IIc/Pit2. However, the milial brain calcification disorder.5 How- molecular identity of the protein(s) participating in the basolateral Pi efflux remains ever, the role of XPR1 in the maintenance unknown. Evidence has suggested that xenotropic and polytropic retroviral recep- of Pi homeostasis remains unknown. Here, tor 1 (XPR1) might be involved in this process. Here, we show that conditional in- we addressed this issue in mice deficient for activation of Xpr1 in the renal tubule in mice resulted in impaired renal Pi Xpr1 in the nephron.
  • Nrf2 Modulates Host Defense During Streptococcus Pneumoniae Pneumonia in Mice

    Nrf2 Modulates Host Defense During Streptococcus Pneumoniae Pneumonia in Mice

    Nrf2 Modulates Host Defense during Streptococcus pneumoniae Pneumonia in Mice This information is current as John C. Gomez, Hong Dang, Jessica R. Martin and Claire of September 28, 2021. M. Doerschuk J Immunol published online 26 August 2016 http://www.jimmunol.org/content/early/2016/08/26/jimmun ol.1600043 Downloaded from Supplementary http://www.jimmunol.org/content/suppl/2016/08/26/jimmunol.160004 Material 3.DCSupplemental http://www.jimmunol.org/ Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication by guest on September 28, 2021 *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2016 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. Published August 26, 2016, doi:10.4049/jimmunol.1600043 The Journal of Immunology Nrf2 Modulates Host Defense during Streptococcus pneumoniae Pneumonia in Mice John C. Gomez,*,† Hong Dang,†,‡ Jessica R. Martin,*,† and Claire M. Doerschuk*,†,x Nrf2 regulates the transcriptional response to oxidative stress. These studies tested the role of Nrf2 during Streptococcus pneumoniae pneumonia and identified Nrf2-dependent genes and pathways in lung tissue and in recruited neutrophils.
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
  • Cardiomyopathy

    Cardiomyopathy

    UNIVERSITY OF MINNESOTA PHYSICIANS OUTREACH LABS Submit this form along with the appropriate MOLECULAR DIAGNOSTICS (612) 273-8445 Molecular requisition (Molecular Diagnostics or DATE: TIME COLLECTED: PCU/CLINIC: Molecular NGS Oncology). AM PM PATIENT IDENTIFICATION DIAGNOSIS (Dx) / DIAGNOSIS CODES (ICD-9) - OUTPATIENTS ONLY SPECIMEN TYPE: o Blood (1) (2) (3) (4) PLEASE COLLECT 5-10CC IN ACD-A OR EDTA TUBE ORDERING PHYSICIAN NAME AND PHONE NUMBER: Tests can be ordered as a full panel, or by individual gene(s). Please contact the genetic counselor with any questions at 612-624-8948 or by pager at 612-899-3291. _______________________________________________ Test Ordered- EPIC: Next generation sequencing(Next Gen) Sunquest: NGS Brugada syndrome DMD Aortopathy Full panel DNAJC19 SCN5A DSP Full panel GPD1L Cardiomyopathy, familial MYH11 CACNA1C hypertrophic ACTA2 SCN1B Full panel MYLK KCNE3 ANKRD1 FBN2 SCN3B JPH2 SLC2A10 HCN4 PRKAG2 COL5A2 MYH7 COL5A1 MYL2 COL3A1 Cardiomyopathy ACTC1 CBS Cardiomyopathy, dilated CSRP3 SMAD3 Full panel TNNC1 TGFBR1 LDB3 MYH6 TGFBR2 LMNA VCL FBN1 ACTN2 MYOZ2 Arrhythmogenic right ventricular DSG2 PLN dysplasia NEXN CALR3 TNNT2 TNNT2 NEXN Full panel RBM20 TPM1 TGFB3 SCN5A MYBPC3 DSG2 MYH6 TNNI3 DSC2 TNNI3 MYL3 JUP TTN TTN RYR2 BAG3 MYLK2 TMEM43 DES Cardiomyopathy, familial DSP CRYAB EYA4 restrictive PKP2 Full panel Atrial fibrillation LAMA4 MYPN TNNI3 SGCD MYPN TNNT2 Full panel CSRP3 SCN5A MYBPC3 GJA5 TCAP ABCC9 ABCC9 SCN1B PLN SCN2B ACTC1 KCNQ1 MYH7 KCNE2 TMPO NPPA VCL NPPA TPM1 KCNA5 TNNC1 KCNJ2 GATAD1 4/1/2014
  • Transcriptomic Analysis of Native Versus Cultured Human and Mouse Dorsal Root Ganglia Focused on Pharmacological Targets Short

    Transcriptomic Analysis of Native Versus Cultured Human and Mouse Dorsal Root Ganglia Focused on Pharmacological Targets Short

    bioRxiv preprint doi: https://doi.org/10.1101/766865; this version posted September 12, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-ND 4.0 International license. Transcriptomic analysis of native versus cultured human and mouse dorsal root ganglia focused on pharmacological targets Short title: Comparative transcriptomics of acutely dissected versus cultured DRGs Andi Wangzhou1, Lisa A. McIlvried2, Candler Paige1, Paulino Barragan-Iglesias1, Carolyn A. Guzman1, Gregory Dussor1, Pradipta R. Ray1,#, Robert W. Gereau IV2, # and Theodore J. Price1, # 1The University of Texas at Dallas, School of Behavioral and Brain Sciences and Center for Advanced Pain Studies, 800 W Campbell Rd. Richardson, TX, 75080, USA 2Washington University Pain Center and Department of Anesthesiology, Washington University School of Medicine # corresponding authors [email protected], [email protected] and [email protected] Funding: NIH grants T32DA007261 (LM); NS065926 and NS102161 (TJP); NS106953 and NS042595 (RWG). The authors declare no conflicts of interest Author Contributions Conceived of the Project: PRR, RWG IV and TJP Performed Experiments: AW, LAM, CP, PB-I Supervised Experiments: GD, RWG IV, TJP Analyzed Data: AW, LAM, CP, CAG, PRR Supervised Bioinformatics Analysis: PRR Drew Figures: AW, PRR Wrote and Edited Manuscript: AW, LAM, CP, GD, PRR, RWG IV, TJP All authors approved the final version of the manuscript. 1 bioRxiv preprint doi: https://doi.org/10.1101/766865; this version posted September 12, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity.
  • Minding the Calcium Store: Ryanodine Receptor Activation As a Convergent Mechanism of PCB Toxicity

    Minding the Calcium Store: Ryanodine Receptor Activation As a Convergent Mechanism of PCB Toxicity

    Pharmacology & Therapeutics 125 (2010) 260–285 Contents lists available at ScienceDirect Pharmacology & Therapeutics journal homepage: www.elsevier.com/locate/pharmthera Associate Editor: Carey Pope Minding the calcium store: Ryanodine receptor activation as a convergent mechanism of PCB toxicity Isaac N. Pessah ⁎, Gennady Cherednichenko, Pamela J. Lein Department of Molecular Biosciences, School of Veterinary Medicine, University of California, Davis, CA 95616, USA article info abstract Keywords: Chronic low-level polychlorinated biphenyl (PCB) exposures remain a significant public health concern since Ryanodine receptor (RyR) results from epidemiological studies indicate that PCB burden is associated with immune system Calcium-induced calcium release dysfunction, cardiovascular disease, and impairment of the developing nervous system. Of these various Calcium regulation adverse health effects, developmental neurotoxicity has emerged as a particularly vulnerable endpoint in Polychlorinated biphenyls PCB toxicity. Arguably the most pervasive biological effects of PCBs could be mediated by their ability to alter Triclosan fi 2+ Bastadins the spatial and temporal delity of Ca signals through one or more receptor-mediated processes. This Polybrominated diphenylethers review will focus on our current knowledge of the structure and function of ryanodine receptors (RyRs) in Developmental neurotoxicity muscle and nerve cells and how PCBs and related non-coplanar structures alter these functions. The Activity dependent plasticity molecular and cellular mechanisms by which non-coplanar PCBs and related structures alter local and global Ca2+ signaling properties and the possible short and long-term consequences of these perturbations on neurodevelopment and neurodegeneration are reviewed. © 2009 Elsevier Inc. All rights reserved. Contents 1. Introduction ............................................... 260 2. Ryanodine receptor macromolecular complexes: significance to polychlorinated biphenyl-mediated Ca2+ dysregulation .
  • Genes in Eyecare Geneseyedoc 3 W.M

    Genes in Eyecare Geneseyedoc 3 W.M

    Genes in Eyecare geneseyedoc 3 W.M. Lyle and T.D. Williams 15 Mar 04 This information has been gathered from several sources; however, the principal source is V. A. McKusick’s Mendelian Inheritance in Man on CD-ROM. Baltimore, Johns Hopkins University Press, 1998. Other sources include McKusick’s, Mendelian Inheritance in Man. Catalogs of Human Genes and Genetic Disorders. Baltimore. Johns Hopkins University Press 1998 (12th edition). http://www.ncbi.nlm.nih.gov/Omim See also S.P.Daiger, L.S. Sullivan, and B.J.F. Rossiter Ret Net http://www.sph.uth.tmc.edu/Retnet disease.htm/. Also E.I. Traboulsi’s, Genetic Diseases of the Eye, New York, Oxford University Press, 1998. And Genetics in Primary Eyecare and Clinical Medicine by M.R. Seashore and R.S.Wappner, Appleton and Lange 1996. M. Ridley’s book Genome published in 2000 by Perennial provides additional information. Ridley estimates that we have 60,000 to 80,000 genes. See also R.M. Henig’s book The Monk in the Garden: The Lost and Found Genius of Gregor Mendel, published by Houghton Mifflin in 2001 which tells about the Father of Genetics. The 3rd edition of F. H. Roy’s book Ocular Syndromes and Systemic Diseases published by Lippincott Williams & Wilkins in 2002 facilitates differential diagnosis. Additional information is provided in D. Pavan-Langston’s Manual of Ocular Diagnosis and Therapy (5th edition) published by Lippincott Williams & Wilkins in 2002. M.A. Foote wrote Basic Human Genetics for Medical Writers in the AMWA Journal 2002;17:7-17. A compilation such as this might suggest that one gene = one disease.
  • Hearing Loss Carrie Crain, B.S

    Hearing Loss Carrie Crain, B.S

    R.C.P.U. NEWSLETTER Editor: Heather J. Stalker, M.Sc. Director: Roberto T. Zori, M.D. R.C. Philips Research and Education Unit Vol. XIX No. 2 A statewide commitment to the problems of mental retardation January 2008 R.C. Philips Unit ♦ Division of Pediatric Genetics, Box 100296 ♦ Gainesville, FL 32610 ♦ (352)392-4104 E Mail: [email protected]; [email protected] Website: http://www.peds.ufl.edu/divisions/genetics/newsletters.htm Hearing Loss Carrie Crain, B.S. Regional Follow-Up Coordinator, Newborn Hearing Screening Introduction Phase 1: Screening It is estimated that 70 million people world-wide, or 1% of the All newborns are screened for hearing loss shortly after birth world’s population have some form of hearing loss that affects using either evoked otoacoustic emissions (EOAE) or auditory language communication. Profound congenital hearing loss is brainstem response testing (ABR) to look for permanent estimated to affect 1 in 1000 births (Tekin et al. 2001). If bilateral, unilateral, sensory or conductive hearing loss significant hearing loss is not detected early in life, it can have averaging 30-40 dB or more. negative impacts on speech, language and cognitive ABR testing uses a series of clicks to evoke responses, development. originating in the eighth cranial nerve and auditory brainstem and recorded by electrodes placed on the head. EOAE testing Newborn Screening uses a probe inserted into the ear to measure sounds The history of newborn screening dates back to the 1960’s originating within the cochlea. EOAEs reflect the activity of the when newborns were first screened for phenylketonuria (PKU).
  • New Developments in Charcot–Marie–Tooth Neuropathy and Related Diseases

    New Developments in Charcot–Marie–Tooth Neuropathy and Related Diseases

    CE: Alpana; WCO 300505; Total nos of Pages: 10; WCO 300505 REVIEW CURRENT OPINION New developments in Charcot–Marie–Tooth neuropathy and related diseases Davide Pareyson, Paola Saveri, and Chiara Pisciotta Purpose of review Charcot–Marie–Tooth disease (CMT) and related neuropathies represent a heterogeneous group of hereditary disorders. The present review will discuss the most recent advances in the field. Recent findings Knowledge of CMT epidemiology and frequency of the main associated genes is increasing, with an overall prevalence estimated at 10–28/100 000. In the last years, the huge number of newly uncovered genes, thanks to next-generation sequencing techniques, is challenging the current classification of CMT. During the last 18 months other genes have been associated with CMT, such as PMP2, MORC2, NEFH, MME, and DGAT2. For the most common forms of CMT, numerous promising compounds are under study in cellular and animal models, mainly targeting either the protein degradation pathway or the protein overexpression. Consequently, efforts are devoted to develop responsive outcome measures and biomarkers for this overall slowly progressive disorder, with quantitative muscle MRI resulting the most sensitive-to-change measure. Summary This is a rapidly evolving field where better understanding of pathophysiology is paving the way to develop potentially effective treatments, part of which will soon be tested in patients. Intense research is currently devoted to prepare clinical trials and develop responsive outcome measures. Keywords