When in France ... WEEKEND | 18
AUGUST 21, 2015 VOLUME 23, NO. 30 www.MountainViewOnline.com 650.964.6300 MOVIES | 21 Mistral parent tapped to fill school board vacancy JOSÉ GUTIÉRREZ HAS TWO CHILDREN IN MOUNTAIN VIEW WHISMAN’S DUAL IMMERSION PROGRAM
By Kevin Forestieri Dozens of audience members showed up at the meeting, held in fter three rounds of vot- the Mountain View City Council ing to winnow down Chambers on Tuesday night, to Anearly a dozen of appli- see which of 11 applicants would cants, the Mountain View Whis- fill the seat of former board presi- man School District voted Tues- dent Chris Chiang, who resigned day night to appoint district in June with nearly a year and parent José Gutiérrez to an open half left of his seat on the school board. term. The board voted 3-1, with Greg Attendees Coladonato voting for another included city candidate, to select Gutiérrez. council mem- MICHELLE LE Board members at the Aug. 18 bers from Palo Kindergartner Naima hugs her father Emmanuel on the first day of school at Gabriela Mistral meeting celebrated the decision, Alto, Los Altos Elementary on Monday. saying the inclusion of Gutiérrez, and Moun- a parent of two at the new Mistral tain View, four Elementary, adds some much- members of José Gutiérrez Class in session at new needed cultural and geographic the Mountain diversity to the board. It also View-Los Altos marks the first time in several High School District board and Mistral Elementary years that the board has a repre- its Superintendent, Jeff Harding. sentative from the Castro School Throughout the interview pro- DISTRICT’S DUAL IMMERSION PROGRAM LAUNCHES AS NEW SCHOOL community in its ranks. cess, applicants brought up a SEPARATE FROM CASTRO ELEMENTARY Castro School recently split number of issues related to Com- into two schools that share a mon Core, the dysfunctional By Kevin Forestieri ents, both excited and a little bit to the district’s Dual Immer- campus, with the Dual Immer- school board, the achievement anxious, and the first day for sion choice program, which sion program dubbed Gabriela gap and spending plans for the onday marked the Gabriela Mistral Elementary, teaches students in both Eng- Mistral School. Measure G bond money. Many first day of school for the Mountain View Whisman lish and Spanish until they In an emotional speech fol- of the candidates claimed to have Mbustling crowds of district’s newest school. lowing the vote, Board President the experience and the perspec- kindergarten students and par- Mistral Elementary is home See MISTRAL, page 10 Ellen Wheeler emphasized that tive needed to round out the the board needs a voice for the board. underrepresented minority stu- Gutiérrez told the board that dents in the district. She said that one of his top priorities in roughly 35 percent of students working with the superinten- One year later, unsolved slaying in the district are Latino, with dent would be to narrow the a similar percentage of students achievement gap and improve from low-income families, yet the test scores of underrepre- at Shoreline haunts family the board hasn’t had that same sented minority students in the VICTIM’S FAMILY SUES CITY, CONCERT ORGANIZERS representation. district. “There’s a lot of people who In the first round of votes, By Mark Noack investigation, for Johnson’s shooting on the city think it’s about time we had board members homed in on but even though of Mountain View as well as rap- someone from Castro on the Gutiérrez, district parent Sanjay lmost one year ago to his death is per “Young Jeezy” and the orga- board,” Wheeler said. Dave, former City Council mem- the day, 38-year-old Eric unsolved it nizers behind hip-hop artist Wiz Gutiérrez said he was “ecstatic” ber Tom Means, community AJohnson of Contra Costa could soon be Khalifa’s “Under the Influence of to join the school board, and that activist Lisa Garcia and former County was shot and killed while a matter for the Music” tour. he has to get moving to prepare district parent Steve Sherman. backstage at a Shoreline Amphi- courts. A civil Exactly what precipitated John- for the school board meeting on The second round of votes led theatre concert. His Aug. 22, 2014 lawsuit recent- Eric Johnson son’s shooting last year still Thursday of this week. to an unexpected four-way tie, slaying remains the subject of an ly filed by his “I’ve got a lot of homework to ongoing Mountain View police mother is pinning responsibility See UNSOLVED SLAYING, page 9 do,” Gutiérrez said. See GUTIÉRREZ, page 7
INSIDE VIEWPOINT 15 | GOINGS ON 22 | MARKETPLACE 24 | REAL ESTATE 26 Alain Pinel Realtors HOME STARTS HERE
PALO ALTO $2,500,000 LOS ALTOS $2,298,000 SUNNYVALE $1,698,000 475 Oxford Avenue | 4bd/4ba 74 Bay Tree Lane | 2bd/2ba 1456 Owen Sound Drive | 4bd/3ba Bryan & Susan Sweeley | 650.941.1111 Shirley Bailey | 650.941.1111 Cliff Noll & Susan Sims | 650.941.1111
SAN MATEO $1,659,000 WOODSIDE $1,595,000 MOUNTAIN VIEW $1,488,000 1650 Ascension | 4bd/2.5ba 11169 La Honda Road | 3bd/2ba 235 Vincent Drive | 2bd/1ba Erika Ameri | 650.941.1111 Patti Robison & Ursula Cremona Tom Correia | 650.941.1111 650.941.1111
LOS ALTOS $1,100,000 REDWOOD CITY $850,000 SARATOGA $695,000 4388 El Camino Real, Unit 167 | 2bd/2ba 464 Clinton Street, Unit 402 | 3bd/2ba 20700 Fourth Street, Unit 9 | 2bd/1ba Jim & Jimmy Nappo | 650.941.1111 Joanne Fraser | 650.941.1111 Cliff Noll | 650.941.1111
See it all at /alainpinelrealtors
APR.COM @alainpinel
Los Altos Office 650.941.1111
2 Q Mountain View Voice Q MountainViewOnline.com Q August 21, 2015 QA + E BRIEFS
who worked for a time making English voice-overs for Italian Let us help pornography. Shields appears tonight, Friday, Aug. 21, at Kepler’s Books, 1010 El Camino you be happy Real, Menlo Park. Tickets are $10-$20. Go to keplers.com or & Healthy call 650-324-4321.
‘MORE JOY’ Who couldn’t use a little more $ joy in their lives? This Saturday, Aug. 22, at the Ladera Commu- nity Church, 3300 Alpine Road, Portola Valley, join local musi- cians for an uplifting evening COURTESY LINDA TAPSCOTT of folk and bluegrass music and 99 Linda Tapscott’s wire mesh art storytelling. The suggested dona- New Patient Special! “Aquasemeni.” tion is $10. Go to ladera.org or call 650-854-5481. Includes: Exam, Digital WIRE MESH X-Rays & Cleaning Silicon Valley-based artist Lin- HOOKSLIDE da Tapscott creates organic forms As summer slides to a close, A $366 Value! inspired by nature. Her medium there’s one last chance to catch is not paint and canvas, nor is a free live concert at the San it clay, stone or bronze. Instead, Antonio Shopping Center, 2550 Offer valid for new patients only. Second opinions Tapscott uses aluminum wire W. El Camino Real, Mountain welcome. Call for details. Some restrictions may apply. mesh to produce porous, semi- View. This Sunday, Aug. 23, Bay transparent shapes that evoke Area-based a cappella group leaves and shells, nests and seeds. Hookslide will perform from 4-6 Now through the end of August, p.m. on the village green. Go to Dr. William Hall • Dr. Tiffany Chan • Dr. J. Janice Chou • Dr. Rob van den Berg her work will be displayed at hook-slide.com. Konditorei Cafe in Ladera Shop- 100 W. El Camino Real, Suite 63A ping Center, 3130 Alpine Road, Mountain View ( Corner of El Camino & Calderon ) Portola Valley. For those inter- www.SmilesDental.com | 650.564.3333 ested in learning more about how to sculpt using this lightweight material, Tapscott will be offer- ing workshops in wire mesh art at the Pacific Art League on Sept. 13 and Oct. 25. For more about the artist, go to ltapscott.com or Larry’s knows Subaru. call 650-529-3408. To register for V[OLY1HWHULZL=LOPJSLZ workshops, go to pacificartleague. org or call 650-321-3891.
COURTESY GALLERY HOUSE You know you are dealing ‘VOICE OF THE PRAIRIE’ Patricia Nojima’s watercolor, “Red with experts when … Trees.” An itinerant story teller and ;LJOUPJPHUZHYL5H[PVUHSS`*LY[PÄLK4HZ[LYZ his young companion are the unlikely heroes of “The Voice ‘DICHOTOMY’ Technicians receive over 40 hours of the Prairie,” John Olive’s play VMZWLJPHSPaLK[YHPUPUNL]LY``LHY about the early days of radio. The Science versus nature, the ;OL`HYLJLY[PÄLKLU]PYVUTLU[HSS` play opens at Redwood City’s man-made and the organic: MYPLUKS` Dragon Theatre, 2120 Broadway, It’s a duality we live with every (SSYLWHPYZHYLN\HYHU[LLKPU^YP[PUN on Friday, Aug. 21, and runs day in Silicon Valley. On view MVY`LHYZTPSLZ· through Sept. 13. Tickets are Aug. 25 to Sept. 19 at Palo Alto’s $27-$35. Go to dragonproduc- Gallery House, 320 California UVV[OLYZOVWKVLZ[OPZ tions.net or call 650-493-2006. Ave., “Dichotomy: Abstracted Each technician is a specialist Science and Lyrical Landscapes” on the vehicle they service.
includes mixed media works 2 0 1 4 ‘THAT THING YOU DO by Nance Wheeler and Patricia WITH YOUR MOUTH’ Nojima that explore both sides ¸;OLMVSRZH[3HYY`»Z(\[V^VYRZYLHSS`[HRL ¸@V\YHYL[OLILZ[H\[VZOVW0OH]L,=,9 of the divide. A public reception care of you. It’s clear they appreciate your MV\UK*VTWSL[LS`OVULZ[[OVYV\NOHUK Leave the kids at home for this will be held on Friday, Aug. 28, I\ZPULZZHUK[OL`KV[OLQVIYPNO[¹ RUV^SLKNLHISL@V\HYLMHI\SV\Z¹ stimulating evening with best- 6-8 p.m. Admission is free. Go ¶+HYPU44V\U[HPU=PL^ – Carolyn W., Los Altos selling author David Shields, to galleryhouse2.com or call who will discuss his latest work: 650-326-1668. the reminiscences of his cousin, — Elizabeth Schwyzer Fabian Charleston
o SEE MORE i
n
o
t R n ONLINE e A Leghor n n St g M n MountainViewOnline.com s /V\YZ!4VU¶-YP!HT!WT!WT!WT i a d S t Voic es dl o efi r Watch videos of Hookslide and “That eld ff 3LNOVYU:[YLL[4V\U[HPU=PL^ Old Middlefield AROUND TOWN Thing You Do With Your Mouth” Approved in the online version of this story at 650-968-5202c(\[V^VYRZJVT Auto Repair will return next week. mv-voice.com.
August 21, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 3 Healthy Teeth and Gums LocalNews
That Last a Lifetime! QCRIMEBRIEFS POLICE LOCATE ASSAULT VICTIM
• Voted Best Dentist 2014 Police located the victim of an assault Saturday night after and 2015 sweeping the area around 60 Centre Street in Mountain View during a helicopter-assisted search for the suspect. • Experienced and Gentle Just before 9 p.m., police received a call that the suspect Dentist, and Friendly Staff involved in an assault with a deadly weapon was on the 60 block of El Camino Real and was heading towards the Centre • Caring Treatment that Street area. When police found the alleged suspect, a 19-year- Focuses on old transient man, he turned out to be the injured victim of the Your Comfort assault, according to police spokeswoman Shino Tanaka. The victim, who was eventually located in the 200 block of • New Patients Welcome! Castro Street, was bleeding from a puncture wound on his upper abdomen, Tanaka said. He was treated at the scene and • Free Consultations and transported to a local hospital. His injuries were not considered Second Opinions life-threatening. The case is under investigation and no additional details are • Saturday Appointments being released, police said. There is no suspect information. Available Police sent out messages through social media to residents in the area during the search, warning them to lock their doors and windows and to call 911 if they saw anything suspicious.
Don’t Wait! Call 650.969.6077 WALMART SHOE-SNATCHER SOUGHT for your appointment today! 2014 Police are seeking the public’s help in finding a suspect who escaped Walmart security over the weekend after he put on a pair of new shoes and attempted to leave the store without pay- ing. Conveniently located in Downtown Mountain View The man entered the store on Showers Drive early in the 756 California Street, Suite B Mountain View 94041 afternoon on Sunday, Aug. 16. He reportedly put on the shoes cross street: Castro, next to Bierhaus and attempted to walk out without paying. When Walmart 650.969.6077 security attempted to detain him, the man swung his arms mul- dentalfabulous.com See CRIME BRIEFS, page 14
QPOLICELOG Math Math Test Homework Help Enrichment Prep Help AUTO BURGLARY GRAND THEFT 200 block View St., 8/11 300 block Palo Alto Av., 8/11 200 block Hope St., 8/11 100 block Mercy St., 8/11 200 block S. Rengstorff Av., 8/11 2500 block California St., 8/17 Today’s local news 1100 block San Antonio., 8/11 RESIDENTIAL BURGLARY 1100 block N. Rengstorff Av., 8/13 We make 400 block Church St., 8/11 & hot picks 1000 block N. Shoreline Blvd., 8/13 2300 block Rock St., 8/17 RESISTING PUBLIC OFFICER 600 block Taylor Ct., 8/16 math BATTERY Fresh news 500 block View St., 8/13 STOLEN VEHICLE 1500 block W. El Camino Real, 8/13 700 block N Rengstorff Av., 8/13 make 2400 block Old Middlefield Way, 8/15 1300 block Pear Av., 8/14 delivered 100 block E. Middlefield Rd., 8/16 COMMERCIAL BURGLARY sense. 200 block Escuela Av., 8/12 VANDALISM daily 500 block W. Middlefield Rd., 8/14 100 block Franklin St., 8/12 1600 block N. Shoreline Blvd., 8/14 400 block N Shoreline Blvd., 8/12 1800 block Hackett Ave., 8/14 It provides the Call us today perfect quick-read for a free QCORRECTIONS digest of local Consultation! news and events Last week’s report on the Los Altos School District’s bond spending plans, “LASD narrows down new school options,” in our community erroneously referred to the Measure N bond as “Measure G.” The article on VTA spending plans, “Your tax dollars hard at from the last 24 work ... somewhere else,” refers to $3.3 billion in funding from the Measure A sales tax that has already been spent on BART hours to the next projects. The $3.3 billion is actually expected expenditures across — all without any the entire 30-year life of the sales tax. environmental
Mathnasium of Mountain View-Los Altos impact. The Mountain View Voice (USPS 2560) is published every Friday by Embarcadero Media, 450 Cambridge Ave, Palo Alto CA 94306 (650) 964-6300. 2510 W. El Camino Real, Ste. #4, Mountain View Periodicals Postage Paid at Palo Alto CA and additional mailing offices. The 650-941-MATH (6284) Sign up today at Mountain View Voice is mailed free upon request to homes and apartments in [email protected] MountainViewOnline.com Mountain View. Subscription rate of $60 per year. POSTMASTER: Send address www.mathnasium.com/MountainViewLosAltos changes to Mountain View Voice, 450 Cambridge Ave, Palo Alto, CA 94306.
4 Q Mountain View Voice Q MountainViewOnline.com Q August 21, 2015 MOUNTAINVIEWVOICE QCITY COUNCIL UPDATES LocalNews QCOMMUNITY QFEATURES
Police tech debuts at city showcase BODY CAMERAS AND CRIME SCENE MAPPING BECOMING KEY TOOLS FOR OFFICERS
By Kevin Forestieri of the smallest details. The laser mapping device has already been esidents in Mountain put to work throughout the city, View got a peek last week and used in a number of recent Rat some of the new tech- traffic incidents. nology the city’s police force is While the technology can aid using to fight crime, including investigators in figuring out how the much-anticipated full adop- a homicide played out based tion of body cameras and laser on the position of the body and mapping devices. other evidence, it can be best At the tech showcase on Aug. understood in its use in traffic MICHELLE LE 13, officers were staked out accidents. Detective Sgt. Dan Frohlich demonstrates how police use laser measurement technology at Mountain in front of city hall with what Last week, a man was critically View’s technology showcase on Aug. 13. looked like surveying equip- injured when he was driving east ment — a tripod holding up on Central Expressway toward the car apart into several pieces. The device is able to bounce a according to Sgt. Saul Jaeger advanced hardware that, when Sunnyvale in Mountain View That day, police brought out the laser beam off a reflector on the of the Mountain View Police aimed right, can map out an when his vehicle careened off the mapping equipment and got to device and measure out critical entire crime scene down to some road and struck a tree, breaking work. information about the scene, See TECH EXPO, page 6
launched in August last year and continues to be picked up High school homework gets an app upgrade by schools and school districts across the country, according to from a 10-teacher pilot of the the way, and turn it in with a time Zach Yeskel, a former Oakland GOOGLE APPS TO GUIDE CLASSROOM apps last year, according to a stamp. teacher and the product manager ASSIGNMENTS FOR MVLA district report. “Students and staff have to all for Google Classroom. While he The grand vision for the new be in the same digital ecosys- said he couldn’t give away the By Kevin Forestieri trict’s teachers and students system is for teachers and stu- tem,” Mathiesen said. “That was number of total users, Yeskel said will be automatically signed up dents to seamlessly transition really the driving force behind about 70 million assignments t would be hard to spot the for Google Apps for Education school assignments into the digi- diving in with both feetî have been turned in so far. difference as students head (GAFE), giving them a special- tal realm, according to Associate When students log into their While Google Classroom is by Iback to school this week, but ized suite of Google apps for Superintendent Mike Mathiesen. new school accounts, they are no means the first online man- Google’s ubiquitous presence in turning in and grading assign- Teachers can create an assign- greeted by a dashboard with ager for students to digitally turn Mountain View has found its ments, a digital dashboard for ment and it gets automatically all of their classes for the year, in assignments, there are a few way into the classrooms of the managing their classes and a sent out to students through assignments from teachers and new perks to the suite of Google Mountain View-Los Altos High school Gmail account. their Google accounts. Students their own drive for storing proj- apps. The big difference, Yeskel School District. The adoption of GAFE came can complete their assignments ects and other classwork. Starting this year, the dis- after “very positive feedback” online, saving their work along Google Apps for Education See MVLA UPGRADES, page 13 Pear Theatre moves on to the next stage BIGGER CROWDS, BIGGER PRODUCTIONS IN STORE AS GOOGLE EXPANSION TRIGGERS MOVE TO LARGER SPACE
By Mark Noack “It was like a cozy little liv- Twelve audience members had ing room,” said Jeanie Smith, a to leave at intermission before the Upon opening in 2002, the frequent Pear Theatre director. show could go on. Pear Avenue Theatre and its “I think we managed well even It wasn’t all bad, Pear enthu- plucky band of drama enthu- though the space was a real limi- siasts recalled. Those audience siasts quickly learned how to tation.” members who had to leave mid- work amid tight constraints In fact, during the Pear’s kick- way through the show were — literally. Their theater, situ- off run of “Mrs. Warren’s Profes- invited to come back later that ated in a former North Bayshore sion,” one sold-out performance night for a second performance industrial garage, was a cramped was interrupted by a surprise of the play’s last half. 1,500-square-foot space. Trying visit from the fire marshal. In the end, the community- to make room for seating, stag- The theater troupe was sternly theater crowd learned the hard MICHELLE LE ing and dressing rooms became warned they were over the build- Diane Tasca, the Pear Theatre’s artistic director, checks out the new a nightly act of improvisation. ing’s 49-person max occupancy. See PEAR THEATRE, page 12 black box theater on La Avenida Avenue on Aug. 17. August 21, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 5 LocalNews
and map everything we need to a precise “damage profile” of minimum speed of the vehicle, after years of voluntary-use only. TECH EXPO reconstruct it,” Jaeger said. the car, including any denting, which is what police generally The department ordered 66 body Continued from page 5 That pile of data collected by breakage and the depth of the use, in order to underestimate cameras, at a cost of $135,000, Department. It can record the the laser-mapping equipment crushed windshield, Jaeger said. rather than overestimate. That enough to equip all of the depart- resting place of various parts of can be put into computer-aided After mapping the bicycle and means police can determine the ment’s officers who frequently the vehicle as well as the size, the design (CAD) software to give the vehicle with the device, police minimum speed of an impact make contact with the public. length and the arc of the skid police a 3D rendering of the can get a pretty good idea of the was 60 miles per hour, for exam- How are the officers feeling marks on to road to help police crime scene, used to reconstruct changes in velocity at the scene. ple, with the possibility that it about it? Jaeger said the depart- determine how fast and what what happened — in this case, “In a collision that results in could have been higher. ment still has to work with the angle the car was going when it the initial impact of a car. a fatality or other death-related While the equipment is pretty police union to finalize all the skidded into the center divide In the case of the fatal car acci- accidents, this system gives us a advanced and can help recreate a rules, such as when officers are and into a tree. dent involving a bicyclist on San very accurate big picture of what crime scene, it doesn’t solve dis- required to keep the camera on “We place the head of the unit Antonio Road near El Camino happened,” Jaeger said. putes over who is at fault. Jaeger and when they are allowed to in a fixed location, and from Real, police are continuing to Jaeger said the software can said the “magic” is really in the turn them off to handle sensi- that location we ‘shoot the scene’ investigate the incident with help investigators determine the investigator, rather than the data. tive information and personal Before the Mountain View conversations. But the cameras Police Department picked up themselves are a real hit, he said. the laser-mapping device about “We are going to wear them four years ago, police were stuck because they are fantastic,” Jae- measuring out the crime scene ger said. “It’s amazing to see the by hand with tape measures, and world through the officer’s eyes.” would plug that information into The purchase came after a a CAD program by hand. study of the Rialto Police Depart- Body cameras still ment in Southern California on the way found that formal complaints against officers and use of force Many officers patrolling the complaints both dropped sig- streets in Mountain View already nificantly once police were have them on — tiny clip-on required to wear body cameras. cameras that can be snapped Jaeger said the cameras are also onto uniforms and sunglasses, helpful to fight false allegations, and monitor everything they see and do a much better job show- FRI SEPT 25 7PM in their day-to-day interactions ing what happened than a small snippet recorded on a cell phone REGISTER ONLINE AT PaloAltoOnline.com/moonlight_run with the public. The police body cams made by a bystander. V an appearance at the tech expo, Email Kevin Forestieri at and will soon be fully launched [email protected]
5 minute showers? She’ll get used to it.
During this drought, those long, luxurious showers have got to go. So please, keep it clean and quick. Limit your showers to 5 minutes or less. And keep a bucket in the shower to save the water that’s warming up. Then, use that water to fl ush the toilet, clean the bathroom, wash the dog or water the plants. For more information, go to watersavings.org.
watersavings.org
6 Q Mountain View Voice Q MountainViewOnline.com Q August 21, 2015 LocalNews
www.demartiniorchard.com GUTIÉRREZ litigation. He said his wife has 66 N. San Antonio Rd., Los Altos Continued from page 1 Open Daily 650-948-0881 been active as both a substitute 8am-7pm teacher and community volun- Prices Effective Farm Fresh and derailing the planned voting pro- teer. He said he was encouraged 08/19 thru 08/25 cess for the evening meeting. The by members of the community to Always the Best final vote saw board members apply for the open position on the LOS ALTOS HILLS' GROWN CALIF. GROWN SEEDLESS Wheeler, Bill Lambert and Steve board. CRAIG MURRAY'S GARDEN $ Nelson voting for Gutiérrez, The board member selection 99 GRAPES 1 LB. and Coladonato voting for Tom process kicked off after Chiang TOMATOES ORGANIC Means. announced he would step down $ 99 EARLY GIRL OR $ 99 GRAPES 2 LB. Nelson pointed to Gutiérrez’s from the school board following 2 LB. BIG BEEF CONCORD GRAPES $299 experience as a student trust- the June 11 board meeting. At $ 99 BSK. HEIRLOOM 3 LB. COTTON CANDY $ 99 ee at the West Valley-Mission the time, Chiang said he could 4 LB. Community College District not continue to work on a board ASSORTED $ 99 NATURAL SEEDLESS $199 as helpful experience that gave with fellow trustee Nelson. He CHERRY TOMATOES 4 LB. GRAPES LB. him a good idea of the public said Nelson’s hostility and “bul- SAN JOSE GROWN LAKE COUNTY legislative format, and that the lying” towards district staff and WHITE CORN BARTLETT PEARS HONEYDEW addition of Gutiérrez means fellow board members was left MELONS IN HUSK RIPE $ SUGAR ¢ the board finally has represen- unchecked by the board, and SUPER EARS ¢ SWEET 69 SWEET 49 FOR 99 1 3 LB. LB. tation from the area between caused the district to lose valu- SWEET JUICY El Camino Real and Central able staff members. ORGANIC LARGE ORGANIC LOCAL ORGANIC LOCAL Expressway. Nelson was one of Many of the candidates, in CAULIFLOWER the swing votes that led to the their pitch to the school board, BABY BOK CHOYBROCCOLINI F STIR TENDER selection of Gutiérrez. said they would be able to bring $ 00 FRY $ 99 $ 99 2 O BABY R 6 1 1 Wheeler said the vote was very the school board together on dif- TIME LB. BROCCOLI BUN. difficult for her, and that she ficult issues, and that it was a top Your Everyday Farmers Market was torn between Garcia and priority to work well with others Online at www.DeMartiniOrchard.com Gutiérrez. One of the things she and get around personal, politi- took into account in her decision, cal agendas. Wheeler said, was whether the Following the 3-1 vote on can- appointee could fare well in a didates, the board unanimously future election. She said Garcia approved the appointment of Ever Bitten Off More has what it takes to run a success- Gutiérrez, who will be sworn in ful campaign. at the Aug. 20 board meeting. V Gutiérrez works for a law Email Kevin Forestieri at Than You Can Chew? firm that specializes in patent [email protected]
Mountain View Center for the Performing Arts 8:00 p.m.
SERIES SPONSOR Jean Lane in memory of Bill Lane
MEDIA SPONSORS The Almanac vÞÕ½ÀiÃÃ}>Þ«iÀ>iÌ>`ÕÌÌiiÌ ]ÌV>`iwÌiÞviiÌ >ÌÜ>ÞÃiÌið Palo Alto Weekly >Ì}ÕÌ Ü>ÌiÀ}]`iVÕÃv`ÃV>LiÀiv>«>Ì >̽ÃÜÀÌ ° MONDAY // August 31 Mountain View Voice Ruth Reichl iÌ>«>ÌÃ>Ài`i>vÀÀi«>V}ÃÃ}ÌiiÌ >`V>>ii>Ì}iÞ>Li SUBSCRIBE TODAY >}>°ÌÜ>à i«ÀiÌ>Ì i>ÌÕÀ>à >«ivÞÕÀv>Vi>`>ÜiLÞÀi`ÕV} FOOD CRITIC, AUTHOR & RESTAURATEUR LiÃð iÌ>«>ÌÃ}Ài>Ì]vii>ÌÕÀ>>`>ÃÌ>}Ìi° (650) 854-7696 x315 In conversation with Michael openspacetrust.org/lectures Krasny, host of Forum on KQED Call Dr. McEvoy at 650-969-2600 for your free implant consultation. SINGLE TICKETS Ms. Reichl is the author of books Then make a reservation at your favorite restaurant and prepare to eat with abandon! On Sale February 1 including Delicious!, Comfort me MVCPA Box Office with Apples, and Tender at the Bone, (650) 903-6000 as well as numerous other novels As a Diplomat of the Board of Oral Implantology and a Fellow of the mvcpa.com and nonfiction works. She was Editor American Academy of Implant Dentistry, Dr. McEvoy has in Chief of Gourmet magazine the highest level of certification possible. from 1999 to 2009. Prior to that, This means you can have your implant she was the restaurant critic for both The New York Times (1993- managed by just one highly trained 1999) and the Los Angeles Times doctor and you’ll soon be smiling again. (1984-1993). COSMETIC DENTISTRY • ONE TREATMENT LASER WHITENING • NO-PREP VENEERS CEREC (ONE VISIT CROWNS) • GENERAL DENTISTRY • SEDATION DENTISTRY Peninsula Open Space Trust 105 South Dr., Ste. 200, Mountain View | www.drmcevoy.com 969-2600
August 21, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 7 LocalNews
Happy Hour ects, the trenching of Caltrain 4pm-9pm Sun-Thurs 2014 Cities challenge VTA on stands out for its scale, cost +TIZSM¼[*]ZOMZ[̆ WЄ and overwhelming popularity. .ZMVKP.ZQM[̆ WЄ Palo Alto’s 4-mile rail corridor transportation funding is expected to get busier in the WЄIVaLQVVMZ coming years, thanks to Cal- • Kids 12 & under - buy 1 get 1 free* train’s electrification (which will *item from kids menu of equal or lessersser value MAYORS FROM NORTH COUNTY, WEST VALLEY CALL enable an increase in trains) and NOW HIRING applications @clarkes.com FOR ‘TRANSFORMATIVE LONG-RANGE VISION’ the potential arrival of high- th year and Restaurant speed rail, further complicating 70 By Gennady Sheyner the morning and afternoon rush the already inconvenient east- ANNIVERSARY! hours, officials are trying to west journey in the southern Open 7 days Clarkes.com ith the regional push ensure that a good chunk of the half of the city. Recent clusters of Lunch & Dinner 11am-9pm; Fri ’til 10pm for a transportation funds raised through the poten- teenager suicides on the tracks Breakfast on Weekends 8am-2pm Wtax measure cruising tial tax will help remedy the situ- added urgency to the project, Mountain View • 61615 W. El Camino Real • (650) 967-0851 toward November 2016, Palo Alto, ation. with officials now focusing on Mountain View and other cities During a lengthy discussion “means restriction” as part of in northern part of Santa Clara that dominated its first meeting the citywide suicide-prevention County are joining forces to make after the summer break, the Palo effort. sure their needs don’t get over- Alto City Council expressed Lest the VTA miss the point, Inspirations shadowed by those of San Jose. its own frustrations about tax Palo Alto supplemented its laun- The unusual alliance between allocations and unanimously dry list of projects with a shorter 11 cities in the northern part approved the letter to the VTA, priority list, which includes Cal- a guide to the spiritual community of the county was prompted by which calls for the county to train in the top spot, followed by years of complaints about the focus its attention on commuting bicycle improvements; first- and LOS ALTOS LUTHERAN To include your lack of balance in how the tax patterns along busy Peninsula last-mile services from Caltrain Bringing God’s Love and Hope to All funds have historically been allo- arteries such as U.S. Highway to employment centers in north Church in cated. 101, Interstate 280, Highway 85 Santa Clara County; and support Children’s Nursery Inspirations According to an analysis by and State Route 237. for “transportation-demand- 10:00 a.m. Worship the office of Santa Clara County Signaling the renewed spir- management” (TDM) policies, 10:10 Sunday School Please call Supervisor Joe Simitian, whose it of cooperation, Mountain which shift commuters from cars 11:15 a.m. Fellowship Blanca Yoc district includes the northern part View Mayor John McAlister and to other modes of transportation. Pastor David K. Bonde of the county, nearly 80 percent of Councilman Lenny Siegel both Councilman Tom DuBois was Outreach Pastor Gary Berkland at 650-223-6596 the funds from the past two ballot attended the Palo Alto meeting. one of several members to call or email measures have been spent on the Siegel told the Palo Alto council trenching Caltrain his “one pri- 460 South El Monte (at Cuesta) extension of BART from the East that the root of the problem in ority.” 650-948-3012 www.losaltoslutheran.org [email protected] Bay to San Jose. This includes the Santa Clara County is that “we “I think it has an opportu- entire $320 million raised so far don’t have a transit system in the nity to improve Palo Alto in a from the 2008 measure and $3.3 county that serves our existing way that no other option really MOUNTAIN VIEW CENTRAL SEVENTH-DAY ADVENTIST CHURCH billion of the $4.3 billion raised commuting patterns.” offers,” DuBois said, noting that from the 2000 measure. “A study of our transportation train frequencies are set to rise in Sabbath School: 9:30 a.m. Simitian’s analysis also showed needs throughout the county and the near future. Saturday Services: Worship 10:45 a.m. that District 5, which also beyond is something that has to The project would “improve Wednesday Study Groups: 10-11 a.m. includes a portion of West Val- come out of the current process,” quality of life” in the Peninsula ley, received just 5.3 percent of Siegel said. cities, eliminate the train-safety Pastor Kenny Fraser, B.A.M. DIV the proceeds from the 2000 mea- So far, the VTA’s approach issues and eliminate train noise, 1425 Springer Rd., Mtn. View - Office Hrs. M-F 9am-1pm sure. District 1, which includes to the measure has consisted DuBois said. www.mtviewda.adventistfaith.org Phone: 650-967-2189 the remainder of the West Valley primarily of conducting surveys “I think this is a time to start cities, received just 4.5 percent and soliciting projects from each really asking for a large amount from that measure. city in the county. The process, of money from the sales tax to be Now, the cities see the 2016 known as Envision Silicon Val- for the trench,” DuBois said. transportation measure as the ley, aims to collect all the data His colleagues agreed, though perfect opportunity to change and then use it to figure out the vote on the priority list split Adult Day Care that imbalance. To that end, which projects to fund. With San 5-3, with Councilwoman Liz elected officials and city man- Jose boasting the largest popula- Kniss, Councilman Eric Filseth agers from these cities have tion in the county and the most and Vice Mayor Greg Schmid and Support co-written a letter urging the representatives on both the VTA voting no (Councilman Greg Santa Clara Valley Transporta- and the Board of Supervisors, Scharff was absent). Though no tion Authority (VTA) to consider the BART extension is expected one disputed prioritizing Cal- more comprehensive and inte- to do well once again. Bike proj- train, the dissenting members grated transportation solutions ects, bus programs and pothole wanted to defer the full discus- that would serve the needs of repairs throughout the county sion about prioritization until the entire county. It calls for the are also expected to win alloca- next month, when the council is VTA, the agency pursuing the tions. set to discuss the city’s long-term 2016 measure, to initiate a com- Palo Alto’s top priority is vision for transportation. The • Alzheimer’s prehensive study to develop a Caltrain. On Monday night, the full list, which includes about “system-wide plan that integrates city reaffirmed its commitment 50 projects, was approved by all • Dementia future mass transit investments to boosting Caltrain’s capac- eight council members. • Parkinson’s in Santa Clara County with con- ity and moving the train tracks Council members also unani- nections to other counties, via into a trench so that they would mously agreed that Palo Alto • Stroke such systems as Caltrain, as well no longer intersect with local should strengthen its collabora- as community-level systems and streets. The project, which would tion with neighboring cities and ‘first/last mile’ strategies,’” the cost more than $500 million in lobby for a regional transporta- We accept VA letter reads. the southern half of Palo Alto tion plan. Filseth pointed to San Though the letter doesn’t spe- alone, is one of dozens the city is Mateo County, which has a coor- and MediCal cifically mention the proposed preparing to submit to the VTA dinated transportation plan, and tax measure, its strategic signifi- — a list that also includes bike argued that Santa Clara County cance is clear. With highway traf- boulevards, an expanded shuttle should follow that model. 270 Escuela Avenue, Mountain View fic around Palo Alto, Mountain system and the potential widen- “The Envision Silicon Valley View, Los Altos Hills and Cuper- ing of Page Mill Road. (650) 289-5499 • avenidas.org/care tino severely congested during In this crowded field of proj- See VTA FUNDING, page 11
8 Q Mountain View Voice Q MountainViewOnline.com Q August 21, 2015 LocalNews Give Feedback: September 2, 6:30 p.m.
he was a popular figure. Follow- successfully argued that stadium at the Senior Center (266 Escuela Ave.) UNSOLVED SLAYING ing news of his death, the local officials bore partial responsi- Continued from page 1 Peet’s branch even named his bility for not providing enough remains a mystery. Johnson, the favorite coffee blend after him — security to prevent the attack. owner of the music company the “E. Special,” his sister said. Last year, a jury awarded Stow “Full Pull Entertainment,” was He was also a loving father, $18 million in damages. arranging an after-party to fol- although Secrease declined to It remains unclear whether a low the concert. His lawyers talk about his children out of fear similar argument of inadequate say he brokered a deal earlier to of their safety. security can be made against have Young Jeezy appear at the Since his death, Johnson’s Mountain View and Shoreline Should Mountain View party in exchange for $20,000. family has had a complicated Amphitheatre. City officials could But when he approached the relationship with the Mountain not immediately say how many Minimum Wage be performer and his entourage View police department. Secrease police officers were at Shoreline backstage around 11 p.m., they believes that the city’s detectives providing security on the night demanded an extra $10,000. are making a diligent effort to of the shooting. City Attorney Attorneys for Johnson’s family find her brother’s killer, but she Jannie Quinn was unavailable for $15.00 allege Young Jeezy had a reputa- also hinted that her family’s comment on Wedneday prior to tion for bilking music promoters patience is nearing its limit. Police the Voice’s press deadline. with this trick in the past. officials have treated her family Plaintiff attorneys say Shore- per hour The quarrel over payment soon “not kind” in their interactions, line Amphetheatre would escalated into a heated argument. she said, declining to elaborate. employ 150 to 250 in-house It’s not clear how the situation Johnson’s family had little security guards, depending on by 2018? turned violent, but Johnson was insight into how the investiga- a concert’s size. But the venue’s shot multiple times by someone tion is going, and nearly all their security detail had poor poli- with a pistol. He was later pro- information has come from cies and equipment, they allege. nounced dead at the hospital. media reports, she said. Like Guards were provided little more Young Jeezy and his cadre were everyone else, they have many than a T-shirt, and they weren’t www.MountainView.gov/MinWage the police officials’ prime sus- questions — What transpired issued walkie-talkies, batons or pects in the case. Three days after before the shooting? How did the other equipment, the attorneys the concert, the rapper and five gunman escape? Why weren’t say. While regular concert-goers others were arrested on weapons Young Jeezy and his entourage are each given a pat-down for charges in Irvine after a search detained on the night of the weapons at the gate, security was warrant turned up an AK-47 rifle crime? “lax” for backstage guests, said in their tour bus. But the firearm “There’s a lot of open questions attorney Ashkahn Mohamadi. couldn’t be linked to Johnson’s that we’d really like answered,” Performers and their entourages death, and it wasn’t clear who she said. “I don’t want to get into were never searched, he said. owned it. Police were later forced playing the blame game. We just The wrongful-death lawsuit to drop the charges after DNA want it solved.” also names as defendants Young evidence failed to link them to Wrongful death claim Jeezy and the five members of his the gun. entourage arrested by police last Since then, there has been little Johnson’s mother Roseanna year in Irvine. The suit alleges information disclosed about the Robinson last month filed a that one of those individuals is investigation. The last update sweeping wrongful-death lawsuit to blame for shooting Johnson. from police came in February against nearly a dozen parties The suit doesn’t mention how when they released a sketch draw- connected to the 2014 concert. much it is seeking in damages. ing of the suspected gunman. Defendants in the case include Johnson’s family and their attor- The case remains a high priority the city of Mountain View, Def neys said the lawsuit shouldn’t for the department, said police Jam Records —Young Jeezy’s impact the ongoing murder spokeswoman Shino Tanaka. label — and Live Nation Enter- investigation. The two cases were “We’re still looking into a tainment, the company that unrelated, Secrease said. variety of leads, and we’re still in owns and manages Shoreline “We have all the confidence communication with the victim’s Amphitheatre. The suit alleges in the Mountain View police family,” she said. “We want to the city police and concert orga- that they’ll put their nose to the bring closure to the victim and nizers were essentially negligent grindstone to investigate this,” his family.” in not planning adequate security she said. A music-lover’s dream for a event that reasonably could Family members say they hope erupt in violence. Representing the Johnson’s death can elicit Johnson’s sister, Zsanna the family, attorney Christopher some positive change. In the Secrease, describes her brother Aumais of the Los Angeles firm months following his death, his as a kind-hearted man who was Girardi & Keese pointed out that mother has been trying to rally striving to establish himself as a the concert’s headline performer, support for an online petition promoter in the East Bay music Wiz Khalifa, had fights and other for “Eric’s Law” — a proposal scene. His dream was coming to violent incidents at past perfor- to tighten backstage security at fruition. Days before his death, mances. Shoreline organizers large events. Their petition calls Johnson had organized his big- should have planned extra secu- for security checks for everyone, gest concert to date at the Stock- rity measures in advance, he said. including performers and their ton Arena with artists including “(At the concert) it didn’t seem bodyguards. “My Eric would still Lil Boosie, Juvenile and Aka like there were many security be alive today,” if such a measures Frank. Ultimately, his goal was guards or police, or that it was had been enacted, his mother to showcase local musicians, his very organized,” Aumais said. wrote. sister said. “This venue should have known The family is marking the “He loved music ever since he there was a potential for vio- anniversary of Johnson’s death was young,” Secrease said. “He lence.” with a “Walk for Life” at 4 p.m. wanted to do something for all Aumais’ law firm has a history on Saturday at Lake Merritt in the talent he saw in the Bay Area.” with successfully litigating simi- Oakland. They hope to use the Johnson was also an avid jog- lar cases, most notably a 2011 event to share Johnson’s memory ger, known for heading out at the lawsuit on behalf of Bryan Stow, and collect more signatures for crack of dawn for a run around the San Francisco Giants fan the petition. V Lake Merritt in Oakland. His who was brutally beaten at the Email Mark Noack post-run routine was to relax at Los Angeles Dodgers’ stadium. at [email protected] the nearby Peet’s Coffee, where In that case, Stow’s attorneys
August 21, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 9 LocalNews
MISTRAL Continued from page 1 are fluent in both languages. The program used to be part of Castro School, and continues to share the campus with Castro’s traditional elementary school program. What does Dual Immersion look like? Marcela Simoes de Carvalho, the principal of the new school, gave parents a pretty good example that morning as she seamlessly switched between English to Spanish, explaining her role and naming the new leadership on the Parent Teacher Associa- tion. Most of the PTA speakers didn’t need a translator — they did it themselves. As far as the first day of school goes, Carvalho said it was a pretty easy transition, thanks in part to a parent and staff-attended picnic last Fri- day afternoon, where class lists were posted and students could meet their new teachers. “It’s been pretty smooth. We’ve had strong support from staff with the nuts-and-bolts pieces and a lot of PTA mes- saging,” Carvalho said. It turns out there’s an app for MICHELLE LE Fernando, 8, looks for his classroom assignment with his mother Georgina at Mistral Elementary. that. The Mistral Elementary PTA, as well as the PTA at Bubb Elementary, is using a new app English-language learners, and called Konstella, which is used district and school staff agreed to send announcements, mes- the split would make it easier sages, sign-up sheets and event to get to the root of the stu- notices to parents. Carvalho dents’ needs and narrow the said it can also be used for district’s achievement gap. classroom-specific informa- Families from both schools tion for parents, like when were able to attend the Com- assignments are due or details munity Resource Fair, where about upcoming potlucks. 20 agencies and organizations Students heading into their including Community Ser- first year at both Castro and vices Agency and the Commu- Mistral Elementary are going nity Health Awareness Council to see a lot of change at their staked out behind the Castro campus over the next five Elementary cafeteria. There, years. The next major phase parents could sign up for of school construction for the social services and academic Measure G school bond funds programs right on the first includes turning the campus day of school. Castro Principal into what it has become on Theresa Lambert said the event an administrative level — a was well-attended and helped dual campus for two distinct to empower families with schools. access to the services that are The $43 million plan calls available to the community. for the current classrooms on New faces the west end of the campus to be modernized for Mistral Carvalho isn’t the only new Elementary, and new, two- principal in town. Significant story buildings on the east staffing changes over the last side of the campus for Castro year brought new administra-
Elementary. Both schools will tors at several schools, and MICHELLE LE share both a new multi-use major changes in the district Jake and Lily, both age 5, pose for a first-day-of-school photo at Mistral Elementary in Mountain View. building and a new library. office. The Dual Immersion pro- Earlier this year, Rebecca gram was split off from the Westover was selected to head school late last year when the the district’s parent participa- Principal Carmen Mizell was with district staff and getting The district also has a new board decided that the lan- tion school, Stevenson PACT, selected to be the district’s new up to speed following the June chief business officer in Rob- guage choice program and after former Principal Tyler director of special education, departure of Interim Superin- ert Clark, who previously the traditional school had Graff resigned to lead an alter- and Ryan Santiago, a former tendent Kevin Skelly, who led worked in administrative entirely different needs. Castro native school in San Francisco. teacher, is now principal of the district through challeng- roles at Alameda Unified Elementary has a high concen- Steve Chesley also took over as Theuerkauf Elementary. ing district-wide issues related School District. V tration of socio-economically principal of Landels Elemen- Superintendent Ayinde to school boundaries and Email Kevin Forestieri at disadvantaged students and tary this year after former Rudolph has been working facilities plans for six months. [email protected]
10 Q Mountain View Voice Q MountainViewOnline.com Q August 21, 2015 LocalNews
MV firefighters battle Mad River blazes VTA FUNDING acknowledge is not going By Carl Sibley Continued from page 8 to solve any kind of major transportation issue,” Hol- few weeks ago, the Moun- measure doesn’t feel like man said. “It’s going to get tain View Fire Depart- that,” Filseth said. “It feels someone to punch the card Ament called on its neigh- like a single-point project (on the ballot) but it’s not bors through a mutual aid pro- wrapped around with a going to solve the transpor- gram to help extinguish a two- scaffold designed like a tation issues.” alarm fire on Escuela Avenue. political poll (created) to But even with the greater Now Mountain View firefighters pass a public vote.” cooperation, success in are returning the favor. Councilman Pat Burt, a securing funding is far Five of the city’s firefighters long-time advocate for a from certain. Palo Alto came home this Sunday after Caltrain trench, thanked has no representatives spending two weeks in Trinity the Mountain View council on the VTA’s 18-member County helping battle the Mad members who attended the board. And four of the five River Complex Fire. The wild- Monday meeting and said districts in Santa Clara fire began on July 30 when a he is “very encouraged by County include sections of lightning storm passed through the current Mountain View San Jose, making Simitian Northern California. Mountain council’s interest in working the lone voice representing View fire sent out a strike team together with Palo Alto.” the northern section of the leader and an engine crew to “We look forward to coop- county. Councilwoman Liz fight the fires on Aug. 1. COURTESY OF MOUNTAIN VIEW FIRE DEPARTMENT erating,” Burt said. Kniss, a former county The crew worked the night Mountain View firefighters spent two weeks battle wildfires in the Mayor Karen Holman, supervisor, warned her shift, holding the fire line and Mad River area of Northern California. who took part in putting colleagues that the VTA is preventing trees from falling, the letter together, said she “dominated by San Jose.” according to a fire department anticipates more coopera- “I sat there for the first two spokeswoman. As of Aug. 17, the The firefighters are working ity is, if there’s a major incident tion with neighboring cities years desperately trying to fire had burned 23,628 acres and through the statewide mutual aid like a large fire, we need addi- in the coming months. She get money into north county is 65 percent contained. program, which allows Moun- tional resources.” agreed with Filseth and and away from BART — it’s “The fire is endangering the tain View and other California That’s where mutual aid comes Councilman Marc Berman extraordinarily difficult,” community of Forest Glen, and cities to call on each other for in. In some cases, the city might that the process used by the Kniss said. V one of the priorities of everybody assistance. just call on resources from sur- VTA is “flawed.” Email Gennady Sheyner at up there is keeping that commu- “Here in Mountain View, we rounding cities, as it did with the “It focuses a lot on pothole [email protected] nity safe,” said fire department staff 21 firefighters every single repairs, which all the cities spokeswoman Jaime Garrett. day,” Garrett said. “But the real- See FIRE, page 12
Your weekly Coming Soon… email with tips and insights about hot events and cool activities
• Music • Eating out • Movies • Fun and free • Art exhibits EAT 7KH¿UVWVWHS • Theater • Lectures and learning SEE in planning your PLAY weekend starts here
Presented by
August 21, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 11 LocalNews
MICHELLE LE Artistic Director Diane Tasca and Technical Director Dan Nitzan chat in the scene shop at the new Pear Theatre on Aug. 17.
PEAR THEATRE in the old space, Tasca said. Continued from page 5 The new space is a serendipi- way that their theater’s size put tous change for the Pear Theatre. a real cap on what they could Google acquired ownership of accomplish artistically. Certain the theater’s old space in 2008, plays with large casts or staging and last year the company made were impractical or downright clear there were plans to add the impossible to pull off. A large-cast site to its growing campus. At the musical was all but a pipe dream. time, the theater and two other Given that backdrop, it was tenants still had active leases, particularly special time for so Google ended up relocating local theater fans on Saturday those tenants one block away. when the newly dubbed Pear Along with more room, the Theatre debuted its new, much new space has other notable larger, home. About three times improvements. The Pear now the size of the old space, the new has a separate rehearsal space, a black-box theater off La Avenida scene shop and larger dressing Avenue provides room for an rooms equipped with their own audience of about 90 as well as a bathrooms. The theater is taking variety of stage setups. Perhaps the opportunity to upgrade other most important for theater buffs, aspects of stagecraft, buying the new digs represent a dra- better sound and lighting equip- matic expansion in the repertoire ment. of plays the Pear can stage. “We hope this will enable “Before, it was very difficult us to continue raising the bar, to do a show with more than polishing our work and offering 10 people in it — we could only fair-priced tickets for our work,” fit seven people in our dressing Tasca said. room!” said Diane Tasca, the The new Pear Theatre is still Pear’s artistic director. “Given being readied for performances. this new space, we can think The first production in the new about all kinds of possibilities.” space, “The Walls of Jericho” is The calendar for the upcom- set to open on Sept. 18. ing year already provides one More information about the solid example of how the Pear Pear Theatre, now located at 1110 will make use of this extra space. La Avenida Ave. in Mountain Next summer, the troupe plans View, including its schedule of to stage “August: Osage County” performances, can be found at with its huge cast and a multi- thepear.org. V story stage. Such a production Email Mark Noack never would have been possible at [email protected]
When it comes to something FIRE larger, like the current Mad River Continued from page 11 Complex Fire, an affected city or county can request additional fire at the Park Vista apartment resources from the entire region. complex on Escuela Avenue on These past two weeks, the Moun- July 30, the same day that the tain View fire crew had to work Mad River Complex Fire began. through the night and then try to To battle the apartment fire, sleep through the noise from heli- Mountain View drew upon aid copters during the day. The city’s from the Santa Clara County firefighters returned on Sunday, to Fire Department, Palo Alto Fire finally get a good night’s rest. V Department and Sunnyvale Email Carl Sibley Department of Public Safety. at [email protected]
12 Q Mountain View Voice Q MountainViewOnline.com Q August 21, 2015 LocalNews
acclimatized to the new system of what they put on there. New locker rooms mer, bringing in approximately MVLA UPGRADES and new teachers Continued from page 5 and are familiar with Gmail, Mathiesen compared the new 25 new teachers as of late last which comes with a similar suite Google accounts to a “technol- Outside of cyberspace, the month, according to Associate said, is that all the data is stored of apps, although without the ogy locker” which could be school district also went to work Superintendent Eric Goddard. in the cloud, so teachers can Google Classroom dashboard, checked when staff needs to over the summer constructing While the teacher shortage has review and comment on student while others have headed into search a particular student, and $2 million upgrades to the locker been pervasive across the state work in real time. totally uncharted territory with said the change could be seen rooms at Mountain View High and is affecting plenty of Bay Area That means teachers can GAFE. as a healthy step for students to School, gutting and renovating school districts, Goddard said not only go paperless, but the To help get everyone up to start establishing a separate set the inside of the facilities. The MVLA had no trouble attracting school’s IT department no lon- speed, the district has enlisted of emails for professional and library has also been reconfig- talented applicants this year. ger has to store and manage all the help of their new instructional personal use. ured and outfitted with mov- This year also marks the first that data themselves — a big technology specialist, Joe John- “We look at it from an educa- able bookshelves and areas with year with the new superintendent plus for the district, Mathiesen son, and a support team of four tional standpoint, preparing stu- half-wall partitions for students Jeff Harding at the helm. Former said. district teachers who can help out. dents to maintain in their adult to have more flexibility to work Superintendent Barry Groves “When more information Teachers can ease into the transi- lives a professional presence and alone or in groups. retired on June 30 after leading and resources are hosted off- tion at their own pace, Mathiesen that personal presence,” Mathie- The district also went on a the school district for the past site, that frees up our IT staff to said, and there’s no district man- sen said. small hiring spree over the sum- nine years. V focus on other things,” Mathie- date to use Google Classroom to sen said, noting that the staff manage their classes. has had to manage thousands “If they don’t use Google of new district-owned Chrome- Classroom this year, that’s okay,” books in recent years. Mathiesen said. 65 46 35 MILE RIDES The adoption of GAFE comes The tech upgrade also comes after last year’s announcement with some new privacy implica- that students at Los Altos tions. The district owns all of presented by High School students would the new Google accounts and be required to bring a laptop email addresses, meaning they or Chromebook to school each are subject to searches, Mathie- day. The district loans Chrome- sen said. The acceptable use books to students who cannot agreement students sign at the afford to buy their own. beginning of the year has been Adopting the new system has updated with language remind- been a mixed bag so far, Mathie- ing students that any content sen told the school board at an on the drive can be accessed by Aug. 3 meeting. Some staff have district staff, and to be mindful
MICHELLE LE Knightscope’s security robots were a popular prop for photos at the Tech Showcase. First city tech expo dubbed a success Apps, robots and a variety of attraction that drew count- state-of-the-art gizmos took less cellphone pics was the SATURDAYAUGUST 22 center-stage last week for R2D2-like security bots from Mountain View’s first-ever Knightscope that roamed the showcase of locally created plaza scanning for crime. REGISTER: www.tourdemenlo.com tech marvels. Turnout was better than The city’s Tech Showcase expected, and this could be Ride Day registration 7-10am @ Menlo-Atherton on Aug. 13 drew hundreds the first of more expos to High School, 555 Middlefield Rd, Atherton to the Mountain View Civil come, said city economic Center, where attendees could development manager Alex ride electric skateboards, test Andrade. out prototype apps and see “The response has been robots take the reins. Exhibi- amazing,” he said. “I could tors included only local tech already foresee next year’s companies, including giants event being even larger.” V like Google and LinkedIn, as Email Mark Noack at well as nascent start-ups. One [email protected]
August 21, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 13 LocalNews
A cappella idols Pentatonix come to Shoreline with Kelly Clarkson
By Karla Kane
n 2002, 10-year-old Kirstin Maldonado watched a fellow ITexan named Kelly Clarkson make reality-television history as the first winner of the singing competition, “American Idol.” “I grew up 15 minutes away from her,” Maldonado said of the woman who would become a pop superstar and one of Mal- donado’s childhood role models. Nearly a decade later, as part of the a cappella group Pentatonix, Maldonado herself was crowned the winner of “The Sing-Off,” another TV vocal contest. This summer, Clarkson and Pentato- nix, along with singer-songwriter Eric Hutchinson, have teamed up on a national tour that includes a stop at Mountain View’s Shoreline Amphitheatre on Sunday, Aug. 23. Though they gained fame from TV exposure, Pentatonix are no manufactured act. Maldonado grew up with bandmates Scott Hoying and Mitch Grassi; they all sang together at Martin High School in Arlington, Texas. They went their separate ways in col- lege, with Maldonado earning a full scholarship to study musical theater at the University of Okla- homa. But Hoying called upon Maldonado and Grassi to reform the group in 2011, along with two new members to round out the low-end sound: bass vocalist JIRO SCHNEIDER Avi Kaplan and beat boxer/cellist A cappella band Pentatonix will perform at Mountain View’s Shoreline Amphitheatre on Sunday, Aug. 23. Kevin Olusola. They named their quintet after the pentatonic scale — a five-note scale common in really organic process,” she said, most organized, the ‘dad,’” she and only occasionally exasperat- we release them and gauging the western music — and quickly adding that their compositional said of Yale-educated Olusola. ing — brothers. “We’re all very audience’s reaction,” she said. She developed a worldwide follow- process is similar to that of an “He was pre-med, and he can different and relate in different and her crew are hoping their live ing, thanks not only to their instrumental band in that the speak Chinese fluently. He’s ways. It’s a big family,” she said. success translates to their upcom- “Sing-Off” win but also to their rhythm parts — in their case the incredible, and he works the When not performing and ing original record. “It’s something YouTube covers of popular songs beat boxing and bass lines — usu- hardest.” Deep-voiced Kaplan recording as Pentatonix, the we’re really proud of,” she said. by artists including Beyoncé, ally come first. She described it as is “the most passionate. He’s so members branch out into other As for what it’s like to tour Katy Perry and many others, a trial-and-error method of per- dedicated and goes full out for projects. Maldonado said she’d alongside her childhood idol, featuring their distinctive vocal fecting the complex vocal harmo- everything to make sure it can be like to get back into musical the- Maldonado said Clarkson arrangements. nies and counterpoints, often with the best it can be.” ater eventually. remains a role model. Social media and fan interac- the help of longtime producer Ben Her band co-founders and A month into the two-and-a “She’s so inspiring,” Maldona- tion have been crucial to their Bram, who’s been with them since childhood friends, Hoying and half-month tour, Maldonado said do said, adding, “She’s just nor- success, as well as personally the “Sing-Off” days. Grassi, are two peas in a pod, she’s looking forward to her first mal and genuine. She proves you important, Maldonado said. Though they’re most famous serving as court jesters, motiva- trip to Silicon Valley. Fans in the can be yourself and stand up for “Once you come off a reality for their cover versions of popu- tors and spirit-lifters. “They’re audience at Shoreline can expect yourself” — and be a success in show it’s easy to fade out, so it’s lar songs, the group is currently so funny,” she said. “Anytime many familiar tunes as well as a the music industry. V important to stay connected with working on an album of original anyone has a bad day they make handful of songs from the new Freelance writer our fan base,” she said. “It’s really music. Maldonado said all five us laugh.” Maldonado said she work in progress. Karla Kane can be emailed fun, too. We’re really close to our members of Pentatonix contrib- sees her bandmates as beloved — “We’re throwing in new songs as at [email protected]. fans.” ute to the songwriting. Now signed, like Clarkson, to “It’s totally been a learning QINFORMATION RCA Records, Pentatonix has process of what we wanted our CRIME BRIEFS medium build in his early gained millions of YouTube vid- sound to be like,” she said. What: Kelly Clarkson, Penta- Continued from page 4 30s, between 5-feet-6-inches eo subscribers, released several The songs and styles on the tonix and Eric Hutchinson and 5-feet-8-inches tall and records (including a best-selling new album, which is due out later tiple times and hit one of the weighing between 140 and 150 Christmas album) and a tour this year, will reflect the diversity Where: Shoreline Amphithe- security officers in the face, pounds. A security camera documentary, and even won a in taste of the band members. atre, 1 Amphitheatre Parkway, according to police spokes- photo is online at mountain- Grammy for their a cappella trib- That variety is what makes Mountain View woman Shino Tanaka. Police viewpoliceblog.com. ute to French electronic music Pentatonix work so well, both did not locate the suspect. Anyone with information is duo, Daft Punk. musically and socially, Maldo- When: Sunday, Aug. 23, 7 p.m. The Walmart security offi- asked to call Detective Kevin Developing their intricate nado said, explaining that each Cost: Tickets start at $24 cer declined medical treat- Galloway at 650-903-6624 and vocal arrangements is a collab- member brings something spe- Info: Go to theshorelineam- ment. The suspect is described refer to case number 15-4848. orative effort, Maldonado said. cial to the group. as a bald man with a beard, —Kevin Forestieri “We sit in a circle and it’s just a “Kevin is the ‘smart’ one, the phitheatre.com. a light complexion and a
14 Q Mountain View Voice Q MountainViewOnline.com Q August 21, 2015 QEDITORIAL Viewpoint QYOUR LETTERS QGUEST OPINIONS
QEDITORIAL THE OPINION OF THE VOICE
Founding Editor, Kate Wakerly QSTAFF Timing’s right to exercise political might EDITOR Andrea Gemmet (223-6537) omentum is growing among cities in the northern part persuasion if the county wants them to check that “yes” box
EDITORIAL of Santa Clara County to seize an opportunity arising agreeing to raise the county’s sales tax, already among the highest Associate Editor from the potential transportation tax measure on the rates in the state, to pay for transportation projects. North County Renee Batti (223-6528) M Staff Writers November 2016 ballot. With recently compiled data showing that officials are wise to act on that inevitable dissatisfaction over the Kevin Forestieri (223-6535) nearly 80 percent of the revenue generated since 2000 by the two funding inequity revealed in Simitian’s analysis as they push for Mark Noack (223-6536) Intern voter-approved transportation taxes is funding the extension of balance in distributing tax revenue. “If we’re going to ask taxpay- Carl Sibley BART to San Jose through the East Bay, Mountain View and 10 ers to impose yet another tax on themselves, we should expect Photographer Michelle Le (223-6530) other cities are joining forces to ensure that a bigger piece of the them to ask how this is going to relieve congestion,” Simitian told Contributors Dale Bentson, Angela Hey, tax-revenue pie is divvied up to support North County projects. the Voice. Sheila Himmel, Ruth Schecter The timing of the joint effort sparks hope that some relief may Mountain View and other cities are compiling a list of desired DESIGN & PRODUCTION Marketing and Creative Director be on the way for residents and commuters now forced to navi- projects to submit to the VTA by the end of the month — a stan- Shannon Corey (223-6560) gate clogged highways and inadequate public transit in the north dard practice. “This year, because of the potential (tax) revenue Design and Production Manager Kristin Brown (223-6562) region. The county’s Valley Transportation Authority (VTA) is measure, we are expanding the list in order to get more potential Designers Linda Atilano, Diane Haas, talking up the need for a sales-tax boost to fund transportation projects considered,” City Manager Dan Rich said in an email to Rosanna Leung, Paul Llewellyn, Nick Schweich, Doug Young projects, indicating that a measure may be on next year’s ballot. So the Voice.
ADVERTISING the leveraging power of cities that feel short-changed by the VTA’s North County and West Valley mayors and city managers are Vice President Sales and Marketing funding decisions over the last 15 years may be the highest it will also signing a letter urging the VTA to conduct a comprehen- Tom Zahiralis (223-6570) be for many years. sive study on the county’s transportation system, with an initial Advertising Representative Adam Carter (223-6573) The funding inequity came to light thanks to county Supervisor attention to distressingly overburdened corridors in need of Real Estate Account Executive Joe Simitian, whose District 5 includes Mountain View and other improvement: Highway 85, U.S. Route 101, State Route 237, and Rosemary Lewkowitz (223-6585) North County and West Valley communities. His office analyzed Interstate 280. Published every Friday at data collected from the county and the VTA to find that funding North County officials are doing the right thing in pressuring 450 Cambridge Avenue Palo Alto, CA 94306 for District 5 projects amounted to just 5.3 percent of proceeds from the county’s transportation authority before the language of an (650) 964-6300 fax (650) 964-0294 the tax measure passed in 2000. Revenue generated so far by the almost certain tax measure is crafted. Residents and those who Email news and photos to: [email protected] 2008-approved Measure B has gone entirely to the BART project. work in the county’s northern region would be wise to join in the Email letters to: [email protected] Given these facts, those who use local roads and highways, effort. It’s an opportunity to take advantage of the political might News/Editorial Department (650) 964-6300 fax (650) 964-0294 particularly during commute hours, might need some serious of the ballot box. V Display Advertising Sales (650) 964-6300 Classified Advertising Sales (650) 964-6490 • (650) 326-8286 QLETTERS fax (650) 326-0155 VOICES FROM THE COMMUNITY Email Classified [email protected] Email Circulation CHALLENGE AHEAD IN is not just a home to Google and essentially in conflict. And Moun- We have done it before; let’s do [email protected] PLANNING NORTH BAYSHORE The Voice is published weekly by Embar- its employees — it is an important tain View has a history of bringing it again. cadero Media Co. and distributed free to Should the new Google head- part (perhaps even becoming the people together to accomplish Bruce Liedstrand residences and businesses in Mountain View. If you are not currently receiving the quarters be a sprawling cam- most important, part) of the city important community goals. Bentley Square paper, you may request free delivery by pus of iconic modern buildings of Mountain View. calling 964-6300. Subscriptions for $60 per and canopies, perhaps including The City Council’s decision year, $100 per 2 years are welcome. some retail and employee hous- to add a residential neighbor- ©2015 by Embarcadero Media Company. All rights reserved. ing, but intentionally separated hood in NBS is the first step. Member, Mountain View from the non-Google parts of Now, let’s have a collaborative, Chamber of Commerce North Bayshore to meet Google community-based, learning and privacy desires? decision-making process, includ- Or should Google headquarters ing Google and the City Council, QWHAT’S YOUR VIEW? be part of an environmentally and as well as the community. We economically sustainable, mixed- need to learn the fundamentals of All views must include a home address use, mid-rise neighborhood, that designing and planning the NBS and contact phone number. Published community. One of the key issues letters will also appear on the web site, integrates living, working, shop- www.MountainViewOnline.com, and ping and play into a human- is how to create a modern per- occasionally on the Town Square forum. scaled and walkable, community. sonal mobility system in NBS, so Town Square forum Perhaps, if we do it right, NBS people can live there comfortably Post your views on Town Square at may even become a world-class and conveniently without needing MountainViewOnline.com “Creative Community.” to own a car. Email your views to [email protected]. Indicate if Google has an important role It is essential that Google, the letter is to be published. in this decision about the future community and the City Council Mail to: Editor of NBS. But the Mountain View all work together to design and Mountain View Voice, P.O. Box 405 community and the Mountain plan North Bayshore as a good Mountain View, CA 94042-0405 View City Council have equally place for all of us.t Although there Call the Viewpoint desk at 223-6528 important roles. North Bayshore are differing interests, they are not
August 21, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 15 0LGGOHÀHOG5RDG3DOR$OWR Offered at $2,298,000 Gracious Home Promotes Outdoor Living Basking on a lot of 5,625 sq. ft. (per city), an extensive, private terrace adjoins the sun-filled interior of this 4 bedroom, 3.5 bath home, which includes 2,520 sq. ft. (per county) plus a lower level of 999 sq. ft. (per plans). Featuring drought-tolerant landscaping and tall trees for added privacy, this upgraded outdoor space is overlooked by a large outdoor patio. Brazilian cherry hardwood floors, an extra-insulated structure, dual-pane windows, and a central vacuum system enhance the fine interior. The formal living room boasts a fireplace and links to the formal dining room, while the upgraded kitchen provides high- end appliances and opens to the spacious family room designed with custom sculptural lighting. The home office features a cherry bookcase, while the versatile lower level includes a media center and a wine room. Boasting a fantastic walk-in closet, the upstairs master suite enjoys patio access. Moments from Stanford and University Avenue, this home is also an easy stroll to Rinconada Park. Top schools nearby include Walter Hays Elementary (API 934), Jordan Middle (API 934), and Palo Alto High (API 905) (buyer to verify eligibility).
For more information, please visit: www.1540Middlefield.com
® OPEN HOUSE Saturday & Sunday, 1-5 pm Complimentary KenKDL DeLeon MiMichael h l RRepka k CalBRE #01342140 CalBRE #01854880 Lunch & Lattes
650.488.7325 | [email protected] | www.deleonrealty.com | CalBRE #01903224
16 Q Mountain View Voice Q MountainViewOnline.com Q August 21, 2015 328 Felton Drive, Menlo Park Offered at $4,188,000 New Home, Timeless Luxury Exceptional details and a peaceful setting alongside Holbrook-Palmer Park defi ne this brand-new 5 bedroom, 3.5 bathroom residence of 3,860 sq. ft. (per plans) on a lot of 0.28 acres (per plans). White oak fl oors, dimmable lighting, and ceilings of nearly 10 feet accent the interior, which presents a dining room with wainscoting, a living room with coff ered ceilings, and a main-level guest bedroom. Off ering fi ne appliances and granite countertops, a regal island kitchen adjoins both a breakfast nook and a handsome family room with vaulted beamed ceilings. A magnifi cent staircase leads to four more bedrooms, including a majestic master suite with a marble-clad bathroom. Outdoors, enjoy large lawns, slate terraces, a motor court, and a detached two-car garage. Other highlights include a central vacuum system, an outdoor barbecue, and two fi replaces. Close to downtown Menlo Park, the home is also near Caltrain and prestigious Sacred Heart and Menlo Schools. More terrifi c schools nearby include Encinal Elementary (API 930), Hillview Middle (API 950), and Menlo-Atherton High (buyer to verify eligibility). For video tour & more photos, please visit: www.328Felton.com
OPEN HOUSE Saturday & Sunday, 1-5 pm Complimentary Ken DeLeon Michael Repka CalBRE #01342140 CalBRE #01854880 Lunch & Lattes
650.488.7325 | [email protected] | www.deleonrealty.com | CalBRE #01903224
August 21, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 17 VOICE MOUNTAINVIEW QRESTAURANT REVIEW We ekend QMOVIE TIMES QBEST BETS FOR ENTERTAINMENT
Review by Photos by DALE F. BENTSON VERONICA WEBER
A mainstay for decades, Palo Alto’s Café Brioche continues to deliver
House-made profiteroles at Café Brioche are stuffed Q RESTAURANTREVIEW with vanilla bean ice cream and drizzled with fudge sauce. alifornia Avenue in Palo Alto is not quite the Rue de Buci in Paris, but it is inching in that direction. C Not every restaurant has yet taken advantage of the city’s newly completed sidewalk widening and beauti- fication project. It’s a unique opportunity for restaurateurs to supplement their interior space with al fresco dining, and with minimal investment. It’s getting there: Joanie’s Cafe, Pastis, Café Brioche and others have installed new outdoor tables, umbrellas and awnings. Some have added new signage to accent the fresh vibe on the street.
18 Q Mountain View Voice Q MountainViewOnline.com Q August 21, 2015 Weekend
According to Marco Kurt, Café Brioche’s general manager, the QDININGNOTES upgrade is bringing in new cus- tomers from further away. Cali- Café Brioche fornia Avenue’s eateries are seg- 445 S. California Ave., Palo Alto ueing from neighborhood dining 650-326-8640 spots to destination restaurants. cafebrioche-paloalto.com What has also helped Café Bri- oche, Kurt said, is adding a full Hours: bar to complement their wine list Lunch: Mon.-Thu. 11a.m.-3 p.m. and joining OpenTable’s online Dinner: Mon.-Sat. 5-9:30 p.m. reservation system. Sun. 5-9 p.m. The bistro has been an anchor Breakfast: Fri. only, 9-11 a.m. on California Avenue since 1987, Brunch: despite the decline of French Sat and Sun., 9 a.m.-3 p.m. eateries in the Bay Area over the past two decades. Happily, there Reservations is a spate of new French restau- Credit Cards rants and bistros springing up around the region. Happy Hour Café Brioche has remained Children because the food is uncom- Takeout plicated and well-prepared by Outdoor Dining chef Ricardo Molina, prices are Duck ragout is served over mini shell pasta and topped with gremolata. rational, the service competent Private Parties and the dining room cozy. It Parking City Lots has been a winning formula. Paired with a sip of icy rosé, what with pancetta, red onions, baby crisp and fresh-tasting — not Alcohol Full bar While I enjoyed dining with could be more idyllic for a mid- spinach and creamy Dijon mus- greasy — with a shaving of Par- a partner, I equally enjoyed eat- day repast? tard and served on toasted sour mesan cheese atop. Corkage $15 ing alone at lunch. Being free of The lunch menu was sand- bâtard bread. The oyster was The doughy beignet frit Noise Level Moderate conversation allowed my mind wich-centric but did offer a few fried golden and stayed crisp to ($9.95) — three fried brioche Bathroom Very good to wander and let me people- main courses as well. Nonethe- the last bite. balls filled with chopped arti- Cleanliness watch — which is half the charm less, I couldn’t resist the huîtres Fried calamari is my litmus choke hearts, shallots and goat of any French bistro, whether in (oyster) sandwich ($12.75). It test to gauge the competence cheese — came with a refreshing Paris or Palo Alto. came not with Arcachon oysters, of a kitchen. Fail that, and the lemon-aioli dipping sauce. leeks. The flavors were well- The first course of fried Brus- nor even Tomales Bay bivalves; rest of the meal usually falls Hazelnut-crusted salmon balanced and the salmon was sels sprouts ($9.95) arrived tossed yet the single, fat, Washington short as well. At dinner, the ($21.95) with a merlot-blackber- fresh, pink and luscious. with cashews, chopped parsley State cornmeal-crusted sautéed deep-fried calamari ($11.95) ry puree was served over a bed and dabbled with an apple glaze. oyster was scrumptious, topped with lemon aioli was perfect: of sautéed spinach and roasted Continued on next page
DINNER BY THE MOVIES AT SHORELINE’S
LIVE MUSIC NOW OPEN! Thursdays 5-8pm Breakfast served daily Cucina Venti’s Wine Club (except Saturdays) Invites You to a Complimentary Wine Tasting Featuring a variety of wines created by Robert Mondavi Wednesday, August 26, 2015 from 5 p.m. to 7 p.m. Please RSVP at [email protected]
Cucina Venti The Voya Restaurant 1390 Pear Ave., Mountain View Make your 1390 Pear Ave., Mountain View (650) 254-1120 reservation on (650) 386-6471 www.CucinaVenti.com For information on future events, follow us on www.TheVoyaRestaurant.com
August 21, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 19 Weekend
Continued from previous page overfilled with vanilla bean ice cream and drizzled with choco- Coq au vin ($19.50) was late fudge. better than I expected. I’m Café Brioche’s version of tarte not a huge fan, but Café Tartin (7.50) was up to the Brioche’s was worthwhile. task. The warm upside-down The marinated chicken was caramelized apple cinnamon plump and juicy; the mush- tart was crowned with vanilla rooms, carrots, cipollini bean ice cream. The best part? onions and whipped pota- It wasn’t overly sweet. toes added a rustic savori- The crème brûlée ($7.50) was ness; and the sauce was thick satisfactory. Served in a small and fragrant. ceramic dish, the custard was Duck ragout ($24.95), a tad grainy yet flavorful. The mixed with pasta shells thin, burnt sugar cap had been and gremolata (a citrus- torched to order, so it was served and-herb condiment), was slightly warm. earthy and fragrant. The The wine list, divided into duck had been browned and Old World and New World roasted with wine, stock and selections, was more than vegetables, then deboned adequate and paired well with and simmered like a stew the cuisine. until thick. The results were Café Brioche is a bistro both mouthwatering. Francophiles and non-Franco- For dessert, the house- philes can enjoy. Food, service made profiteroles ($7.50) and ambiance are first-rate and were hard to beat. The pastry now there’s the added attraction Beignet frit at Café Brioche are filled with chopped artichoke hearts, shallots and goat cheese, was puffy and feather-light, of people-watching. V and served with lemon aioli.
Notice of Bicycle/Pedestrian Advisory Committee Meeting
California / Escuela / Shoreline Complete Streets Project
The Community is invited to attend and provide input on the alternative designs for the Complete Streets Feasibility Study
Wednesday, August 26, 2015 – 6:30 p.m. Plaza Conference Room Second Floor, City Hall 500 Castro Street, Mountain View
For further information visit the City Projects webpage at http://www.mountainview.gov/cityprojects or contact [email protected]
20 Q Mountain View Voice Q MountainViewOnline.com Q August 21, 2015 Weekend
QMOVIEOPENINGS QMOVIETIMES
source material for — attentive American Ultra (R) Century 16: 10 a.m., 12:30, 3, 5:30, 8 & 10:35 p.m. aspiring fiction writer Tracy. Century 20: 11:35 a.m., 2:10, 4:45, 7:20 & 10 p.m. The oddly paced story cul- Amy (R) Palo Alto Square: Fri & Sat 9:40 p.m. minates in an extended climax Ant-Man (PG-13) +++ whereby Brooke leads Tracy Century 16: 10:30 a.m., 1:30, 4:30, 7:40 & 10:30 p.m. and a couple of tenuous friends Century 20: 11:05 a.m. & 7:55 p.m. In 3-D at 1:50, 4:55 & 10:45 p.m. to the Greenwich, Connecticut Best of Enemies (R) 1/2 Aquarius Theatre: 2 & 7:10 p.m. home of her rich ex-boyfriend, +++ Dylan (Michael Chernus of The Diary of a Teenage Girl (R) “Orange Is the New Black”). Century 16: 9:05 & 11:40 a.m., 2:15, 4:50, 7:20 & 10 p.m. Brooke intends to ply him for The End of the Tour (R) +++1/2 money she feels owed, if only Century 20: 11:30 a.m., 2:15, 4:50, 7:25 & 10:05 p.m. she can do an end-run around Palo Alto Square: 1:30, 4:15 & 7 p.m., Fri & Sat 9:45 p.m. his wife, Mimi Clare (Heather ESL One Cologne Counter-Strike: GO Finals Live (Not Rated) Lind). The sequence hits the Century 20: Sun 10 a.m. ground running at a deliber- Fantastic Four (PG-13) Century 16: 9:15 a.m., noon, 2:45, 5:25, 8:15 & 10:55 p.m. Century 20: 11:15 a.m., 1:50, 4:25, 7:05 & 9:45 p.m. COURTESY RT FEATURES ately Hawksian screwball pace, Greta Gerwig and Lola Kirke as future step-sisters in “Mistress America.” but even considering Brooke’s Forbidden Planet (1956) (Not Rated) motormouth, this second act Stanford Theatre: Sat & Sun 3:45 & 7:30 p.m. marks an awkward tonal shift, The Gift (R) Century 16: 9 & 11:50 a.m., 2:35, 5:15, 7:55 & 10:40 p.m. promptly abandoned again for Century 20: 11:40 a.m., 2:20, 5, 7:40 & 10:25 p.m. There she is ... a more circumspect coda. The Hidden Fortress (1958) (Not Rated) The film’s oddly ramshackle Stanford Theatre: Fri 7:30 p.m. construction hurts, but the ‘MISTRESS AMERICA’ OFFERS A TALE Hitman: Agent 47 (R) Century 16: 9:45 a.m., 12:20, 2:50, 5:20, 7:55 zesty dialogue and the charac- & 10:25 p.m. Century 20: 11:45 a.m., 2:30, 5:05, 7:50 & 10:20 p.m. OF FRIENDSHIP AND BETRAYAL ter work and chemistry of Kirke and Gerwig compensate might- Inside Out (PG) +++1/2 Century 16: 9:10 & 11:45 a.m., 2:25 & 5 p.m. 00 1/2 (Aquarius) self (an ice-breaking activity ily, as does the film’s refreshing Century 20: 11:25 a.m., 1:55, 4:30, 7:10 & 9:40 p.m. “You want a piece of me?” gifts her the defining symbol focus on female friendship, its Irrational Man (R) ++ Palo Alto Square: 1:55, 4:30 & 7:15 p.m. Them’s fighting words, but also of a tracking device), Tracy joys and limitations. Baumbach Kick 2 (Not Rated) Century 16: Fri 9 p.m., Sat 6 p.m. ones that reflect a psycho-soci- decides to introduce herself and Gerwig also nose around in The Man from U.N.C.L.E (PG-13) ++1/2 ological truism about human to her one New York con- interesting ideas about creative Century 16: 9:55 a.m., 1, 4:10, 7:20 & 10:25 p.m. interaction. Jealousy and a kind tact, her soon-to-be-stepsister, appropriation, an increasingly Century 20: 11:10 a.m., 2, 4:50, 7:40 & 10:30 p.m. of parasitic ambition form the Brooke Cardinas (Gerwig). A superficial culture and sensitiv- Minions (PG) ++ Century 16: 9:10 & 11:35 a.m., 2:10, 4:45, 7:25 & dark side of many a seemingly fateful phone call later, Tracy ity to age — all prime subjects 9:55 p.m. Century 20: 11:20 a.m., 1:35, 4:05, 6:50 & 9:15 p.m. collegial friendship. And so it has boarded the express train of Baumach’s previous film, Mission Impossible: Rogue Nation (PG-13) ++1/2 goes in Noah Baumbach and that is Brooke, destination “While We’re Young.” Century 16: 9, 9:50 & 10:35 a.m., 12:15, 1:50, 3:30, 5:05, 7, 8:40 & 10:15 Greta Gerwig’s new film “Mis- unknown. An ‘80s nostalgia score by p.m. Century 20: 11:20 a.m., 12:15, 2:25, 3:30, 5:30, 6:30, 7:30, 8:35 & tress America,” in which two Gerwig applies her consid- Dean Wareham and Britta 9:35 p.m., Fri & Sat 1:20. In D-BOX at 11:20 a.m., 2:25, 5:30 & 8:35 p.m. women forge and test a friend- erable comic aplomb to the Phillips signals the influence of Mistress America (R) ++1/2 ship based largely on mutual whirligig Brooke, a Soul Cycle pictures like “Something Wild” Aquarius Theatre: 1, 3, 5:15, 7:30 & 9:45 p.m. self-interest. instructor who, in her personal and “After Hours,” the zanily Mr. Holmes (PG) +++1/2 Guild Theatre: 2, 4:30, 7:10 & 9:40 p.m. Director/co-writer Baum- life, combines that job’s aggres- farcical heights of which the bach and star/co-writer Ger- sive can-do energy with monu- relatively contained “Mistress Pixels (PG-13) +1/2 Century 20: 10:55 a.m., 1:25, 4, 6:55 & 9:30 p.m. wig (currently a couple) have in mental self-absorption. As they America” never approaches. Planes, Trains and Automobiles (1987) (R) “Mistress America” a comedy swap stories over dorm-room Like Brooke, the film flies a Century 16: Sun 2 p.m. Century 20: Sun 2 p.m. of friendship found, lost, and screwdrivers, Brooke at one strange and arresting course: Ricki and the Flash (PG-13) ++ found again. Lola Kirke (“Gone point responds to Tracy, “That’s if not quite a screwball, then Century 20: 11:10 a.m., 1:40, 4:10, 7 & 9:50 p.m. Girl”) plays Tracy Fishko, a cool about the yogurt machine. certainly a change-up pitch. Shaun the Sheep Movie (PG) newly installed freshman at Everyone I love dies.” A hustler Rated R for language, includ- Century 16: 9:20 & 11:55 a.m., 2:20, 4:55 & 7:15 p.m. New York City’s Barnard Col- who has yet to make good, ing some sexual references. One Century 20: 5:35 & 8 p.m., Fri & Sat 10:50 a.m., 1 & 3:15 p.m., Sun 3:20 p.m. lege. Immediately established Brooke makes for a dangerous hour, 24 minutes. Sinister 2 (R) Century 16: 9:30 a.m., noon, 2:40, 5:10, 7:45 & 10:20 p.m. as being on a lonely search for role model to — and brilliant — Peter Canavese Century 20: 11:55 a.m., 2:40, 5:20, 8:10 & 10:45 p.m. Southpaw (R) Century 20: 4:40 & 10:35 p.m. Tour,” a film inspired by five days in the Illya Kuryakin teamed up weekly (Cold Srimanthudu (Not Rated) Century 16: 9:30 p.m. life of celebrated novelist David Foster War be damned) to save the world from The Stanford Prison Experiment (R) +++ Wallace and journalist David Lipsky. In a guest-star villains. Now we have a version Aquarius Theatre: 4:15 & 9:30 p.m. revelatory change-of-pace performance, directed by Guy Ritchie, starring Henry Cav- Straight Outta Compton (R) Century 16: 9 & 10:45 a.m., 12:30, actor-screenwriter Jason Segel plays the ill (Solo) and Armie Hammer (Kuryakin). QMOVIEREVIEWS 2:15, 4, 5:45, 7:30, 9:15 & 11 p.m., Fri 5 p.m., Fri & Sat 1:15 & 11:45 p.m., 34-year-old author at the tail end of his The film recounts the duo’s first meeting: Sat 10:10 p.m., Sun 4:40 & 8 p.m. Century 20: 11 a.m., 12:05, 2:20, 1996 book tour for “Infinite Jest.” As Wal- Whizzing around Checkpoint Charlie, 3:25, 5:40, 6:45, 9:05 & 10:10 p.m. In X-D at 1:10, 4:30 & 8 p.m. lace contends with anxiety issues, Lipsky the two compete for the prize of Gaby (Jesse Eisenberg), a novelist currently on Teller (Alicia Vikander), the daughter of a The Time Machine (1960) (Not Rated) assignment from “Rolling Stone,” shadows German rocket scientist. With his smirks Stanford Theatre: Sat & Sun 5:35 & 9:20 p.m. the literary star and plies him for anything and peacocking strut, Cavill overworks Trainwreck (R) Century 16: 7:35 & 10:30 p.m. Century 20: 11 he will reveal. Significant “others” pass it; Hammer succeeds in being a bit more a.m., 1:55, 4:50, 7:45 & 10:40 p.m. through (Anna Chlumsky as Lipsky’s girl- subtle in containing Illya’s anger issues. Vacation (R) Century 20: 10:15 p.m. friend, Ron Livingston as his editor and The jokey-serious tone errs on the side Joan Cusack, fine as Wallace’s temporary of fashion-conscious and smug, but the AQUARIUS: 430 Emerson St., Palo Alto (266-9260) handler), but the film shines when the two mostly-empty film has its moments: the CENTURY CINEMA 16: 1500 N. Shoreline Blvd., Mountain View (800-326-3264) are alone together, discussing everything teasing chemistry of Vikander and Hammer CENTURY 20 DOWNTOWN: 825 Middlefield Road, Redwood City (800-326-3264) from the sacred (writing) to the profane and bromantic episodes between Solo and CINEARTS AT PALO ALTO SQUARE: 3000 El Camino Real, Palo Alto (493-3456) MODERN MAN FILMS (getting laid). Rated R for language includ- Kuryakin. Rated PG-13 for action violence, STANFORD THEATRE: 221 University Ave., Palo Alto (324-3700) ing some sexual references. One hour, 46 Jason Segel in “The End of the some suggestive content and partial For show times, plot synopses and more information about any films playing at the minutes. — P.C. Tour.” nudity. One hour, 56 minutes. — P.C. Aquarius, visit www.LandmarkTheatres.com THE END OF THE TOUR THE MAN FROM U.N.C.L.E. 1/2 QMOVIECRITICS 0Skip it For show times, plot synopses, 000 001/2 00Some redeeming qualities trailers and more movie The mysteries of personality and the hall In the popular mid-’60s spy series “The S.T. - Susan Tavernetti, P.C. - Peter Canavese, 000A good bet info, visit www.mv-voice.com of mirrors of celebrity culture form the Man from U.N.C.L.E,” brash American T.H. - Tyler Hanley 0000Outstanding and click on movies. nebulous parameters of “The End of the Napoleon Solo and tightly-wound Russian August 21, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 21 VOICE MOUNTAINVIEW QHIGHLIGHT Rengstorff Arts Festival: Mister Barky The string trio Mister Barky will play a set of music fusing American old-time swing with folk music as part of the Rengstorff Arts Festival. Aug. 23, 2-3 p.m. Free. Rengstorff House, 3070 N. Shoreline Blvd., Mountain View. Call 650-903-6392. www.r-house.org
ART GALLERIES expect when buying from a dealer, repair costs speaker. Food from Armadillo Willy’s will be on ‘Metaphors and Memories’ The show on Sept. 15; see website for specific times. involved in buying a pre-owned car and what cars hand. Parking and seating are limited; those Community School of Music and Arts’ Mohr Tuesday-Sunday, Aug. 26-Sept. 20, 2, 7 or 8:30 ‘Iron Rose’ Joseph Najera, an artist working to avoid. Aug. 25, 7-8:30 p.m. Free. Mountain interested are encouraged to buy tickets early. Gallery has on display an exhibition of collage and p.m. $19-$74. Mountain View Center for the mostly in wrought iron to create wall pieces and View Public Library, 585 Franklin St., Mountain Aug. 23, 4-8 p.m. $25. Morgan Manor Estate, sculpture by Lisa Ramierz and Marianne Lettieri Performing Arts, 500 Castro St., Mountain View. candle holders, shares some of his artwork in an View. Call 650-526-7024. goo.gl/zAAK95 12335 Stonebrook Drive, Los Altos Hills. Call 650- called “Metaphors and Memories.” Aug. 14-Sept. Call 650-463-1960. www.theatreworks.org/ exhibit called “Iron Rose.” Aug. 4-30, Tuesday- Orchids class Honorary UC Master Gardener 917-9125. sparc1.org 27, Monday-Friday, 9 a.m.-7 p.m.; Saturday, 9 shows/1516-season/the-country-house Saturday, 11 a.m.-5 p.m.; Sunday, noon-4 p.m. David Giroux will give tips on maintaining healthy a.m.-3 p.m. Free. Community School of Music San Francisco Mime Troupe: Free. Gallery 9, 143 Main St., Los Altos. Call 650- and beautiful orchids in both home and garden COMMUNITY EVENTS and Arts, Mohr Gallery, 230 San Antonio Circle, ‘Freedomland’ The San Francisco Mime 941-7969. gallery9losaltos.com environments. Attendees are invited to bring Open House at CSMA The Community Mountain View. www.arts4all.org/attend/ Troupe will return to Palo Alto’s Mitchell Park mohrgallery.htm Rengstorff Arts Festival The Rengstorff problem orchids to the event for diagnosis and School of Music and Arts will hold its annual to perform “Freedomland,” a comedic musical House is hosting a month-long show with fine advice on. Aug. 26, 7:30-8:30 p.m. Free. Los open house, where visitors can see art and music ‘On You: A Story of Wearable production focusing on the serious topics of police art by local artists including works in watercolor, Altos Library, 13 S. San Antonio Road, Los Altos. demonstrations, participate in preschool activities, Computing’ The Computer History Museum brutality and growing up black in America. Music oil, glass and photography. Juried student art Call 408-282-3105. mastergardeners.org/scc.html and meet faculty and staff. Attendees can bring is hosting a traveling exhibition by the Georgia starts at 3:30 p.m. before the performance. Aug. from the Community School of Music and Arts a picnic lunch and enjoy music on the lawn. All Institute of Technology called “On You: A Story 23, 4 p.m. Free (donations accepted). Mitchell Art4Schools program is featured. Aug. 2-30, CLUBS/MEETINGS ages are welcome. Aug. 22, 11 a.m.-2 p.m. Free. of Wearable Computing,” which examines the Park, South Field, 600 E. Meadow Drive, Palo Tuesday and Wednesday, 11 a.m.-5 p.m.; Bootstrappers Breakfast The Silicon Valley Community School of Music and Arts, 230 San problems engineers needed to solve to make Alto. sfmt.org Sunday, 1-4 p.m. Free. Rengstorff House, 3070 wearable technology viable and user-friendly. chapter of Bootstrappers Breakfast will hold a Antonio Circle, Mountain View. www.arts4all. Storytelling for Adults and Teens N. Shoreline Blvd., Mountain View. Call 650-903- meeting in Mountain View where entrepreneurs org/openhouse Tuesday-Sunday, June 30-Sept. 20, 10 a.m.-5 6392. www.r-house.org p.m. Regular admission prices. Computer History Experienced local storytellers Joy Swift, Steve Abel can compare notes, brainstorm, exchange ideas Palo Alto Festival of the Arts The 34th and Gari Gene will perform an hour of traditional and learn from others’ mistakes. Aug. 28, 9-10:30 Museum, 1401 N. Shoreline Blvd., Mountain CLASSES/WORKSHOPS annual Palo Alto Festival of the Arts will boast View. www.computerhistory.org/events/ oral storytelling as part of a monthly program. a.m. $5 in advance; $10 at the door (plus cost of over 300 high-quality artists, Italian street Aug. 27, 7-8 p.m. Free. Los Altos Library, Orchard Adult School Fall Session registration breakfast and tip). Red Rock Coffee, 201 Castro upcoming/#you-story-wearable-computing painting, two stages of entertainment, California Room, 13 S. San Antonio Road, Los Altos. Call Registration for Mountain View-Los Altos Adult St., Mountain View. Call 408-252-9676. www. wines and microbrews, gourmet food and the FAMILY AND KIDS 650-948-5971. storyfriends.org School’s Fall Session is underway. The session will meetup.com/Bootstrappers-Breakfast-SV/ Kids’ Art Studio. Aug. 22 and 23, 10 a.m.-6 p.m. run from Sept. 1 to Dec. 18. Visit the website for Sing and Play Along Ukulele These Free admission and parking. Palo Alto Festival of Messy Art Playtime St. Timothy’s preschool LECTURES & TALKS specific class listings and more info. Aug. 14-Sept. monthly meetings at the Mountain View Public the Arts, University Avenue, Palo Alto. Call 831- will hold a Messy Art Playtime, inviting ‘Death & Life of an Object’ For this Los 1. Prices vary. Mountain View-Los Altos Adult Library will bring together beginning and more 438-4751. www.mlaproductions.com preschoolers and their parents and caregivers to School, 333 Moffett Blvd., Mountain View. Call advanced ukulele players to learn from each other. roll up their sleeves for some creative activities. Altos History Museum event, Marianne Lettieri 650-940-1333. www.mvlaae.net Attendees can bring their own instruments or play CONCERTS RSVP is requested. Aug. 21, 10-11 a.m. Free. St. will lead a discussion about the meanings Free Drought Education Classes Orchard Timothy’s Episcopal Church, 2094 Grant Road, embedded in historical and everyday materials one of the library’s. Registration is appreciated Pacific Crest Piano Quartet Pacific Crest Supply Hardware in Mountain View will give a but not required. Fourth Monday of the month, Mountain View. Call 650-967-4724. www. and how artists use them to express themselves Piano Quartet will perform works from a variety series of free 15-minute workshops presenting June 22-Aug. 24, 6:30-7:30 p.m. Free. Mountain sttimothyspreschool.org creatively. Aug. 27, 7-8 p.m. Free. Mountain View of genres, including classical, jazz and chamber simple ways to save water inside and outside View Public Library, 585 Franklin St., Mountain Public Library, 585 Franklin St., Mountain View. music. Seating will be limited to 200 guests. the home. Aug. 22, 10 a.m.-2 p.m. Free. Orchard View. Call 650-526-7020. www.mountainview. HEALTH Call 650-948-9427 ext. 14. losaltoshistory.org Aug. 30, 2-3 p.m. Free. Community School of Supply Hardware, 2555 Charleston Road, gov/library Music and Arts, Finn Center, 230 San Antonio Postpartum Wellness Class Conducted by a Author Anthony Francis on ‘Liquid Fire’ Mountain View. www.osh.com Sons in Retirement Monthly Meeting Circle, Mountain View. www.arts4all.org/attend/ licensed physical therapist and certified pelvic floor Local author Anthony Francis will visit Books specialist, this class will teach abdominal exercises Health care programs orientation The Sons in Retirement will come together for one concerts.htm Inc. in Mountain View to chat about his urban Mountain View-Los Altos Adult School will hold of its monthly meetings offering quality lunches to strengthen students’ cores and provide training fantasy novel, “Liquid Fire,” the action-filled and Pianist Richard Glazier with ‘Love a workshop for those interested in health care and interesting speakers. The August meeting in proper posture and body mechanics. Aug. 27, steamy latest installment of his Skindancer series. is Here to Stay’ At this Music at Noon careers, providing information on the certified will feature Charles House, who will discuss the 1-2 p.m. Free. El Camino Hospital, 2400 Grant Aug. 26, 7 p.m. Free. Books Inc., 301 Castro performance entitled “Love is Here to Stay: nursing assistant and medical assistant paths history of some Silicon Valley companies. The club Road, Mountain View. Call 650-940-7285. www. St., Mountain View. www.booksinc.net/event/ Homage to the Brothers Gerschwin,” pianist and and the programs offered by the school. Online for retired men also organizes other activities, elcaminohospital.org/stay-healthy/classes-and- anthony-francis-books-inc-mountain-view registration is requested. Aug. 26, 10 a.m.-noon. including golf, bocce ball, walking and trips George Gerscwhin expert Robert Glazier will events share the music of and stories about the famed Author John Markoff on ‘Machines of Free. Mountain View-Los Altos Adult School, 333 to sporting events. Aug. 26, 11:30 a.m.-1:30 Loving Grace’ Pulitzer Prize-winning reporter Moffett Blvd., Mountain View. Call 650-940- p.m. $22 lunch. Michaels at Shoreline, 2960 N. musical brothers. The event includes lunch. Sept. FOOD AND DRINK 1, noon-1:30 p.m. $20. Schultz Cultural Arts Hall, John Markoff will speak in conversation with 1333. www.mvlaae.net Shoreline Blvd., Mountain View. Call 650-299- 2nd Annual Tomato Tasting At this 3921 Fabian Way, Palo Alto. Call 650-223-8616. Computer History Museum CEO John Hollar 9479. sir5.org Mountain View Public Library event, urban farms Money Matters: Buying A Pre-owned paloaltojcc.org/music about the ideas and insights from Markoff’s Car In this Mountain View Public Library SPARC Picnic The South Peninsula Area and neighbors will provide tomatoes for visitors new book “Machines of Loving Grace: The workshop, Leane and Mike Reelfs of Helming’s Republican Coalition will hold its annual picnic at DANCE to taste and rate. Registration is appreciated but Quest for Common Ground Between Humans Auto Repair will discuss buying a pre-owned car, the historic Morgan Manor Estate, built in 1914. not required, and everyone is welcome. Those and Robots.” Online registration is requested. L’Ecole de Danse fall season Children ages looking at how to negotiate the best deal, fees to Legislator Catharine Baker will be the featured interested in contributing tomatoes should contact Aug. 27, 7-8:30 p.m. Free. Computer History 5 and up, teenagers and adults can sign up for fall Emily Weak by phone or email. Aug. 29, 11:30 Museum, 1401 N. Shoreline Blvd., Mountain classes at L’Ecole de Danse, a studio established a.m.-12:30 p.m. Free. Mountain View Public View. www.computerhistory.org/events/ by Christine Montessuit-Morgan in 1987 that Library, 585 Franklin St., Mountain View. Call upcoming/#machines-loving-grace-author-john teaches the Cecchetti style of ballet. Classes begin 650-526-7020. mountainview.gov/library REQUEST FOR QUALIFICATIONS on Sept. 8. See website for tuition prices. L’Ecole Author Noga Niv on ‘Inside the Bubble’ FOR ARCHITECTURAL SERVICES de Danse, 740 Sierra Vista, Unit G, Mountain LIVE MUSIC Author Noga Niv will appear at the Oshman GENERAL OBLIGATION BOND PROGRAM – View. Call 650-365-4596. lecolededanse.net Family JCC to discuss her new novel, “Inside the MEASURE G O’Craven at O’Malley’s The Celtic pirate rock Bubble,” which centers on high tech, the Israeli Raices de Mexico Raices de Mexico — a band O’Craven will strive to get people dancing community in Silicon Valley and female friendship. Palo Alto organization founded in East Palo Alto as they perform a set of rock music at O’Malley’s Aug. 23, 5-6:30 p.m. Free. Oshman Family JCC, in 1980 that promotes cultural diversity through Sports Pub. The event is only for ages 21 and The Mountain View Whisman School District invites Freidenrich Conference Center, 3921 Fabian Way, dance, music and art — will offer a performance older. Aug. 21, 8:30-11:30 p.m. Free. O’Malley’s Z[H[LTLU[Z VM X\HSPÄJH[PVUZ MYVT X\HSPÄLK ÄYTZ [V WYV]PKL Palo Alto. Call 650-233-8700. paloaltojcc.org/ of folklorico dance. Registration is appreciated Sports Pub, 2135 Old Middlefield Way, Mountain HYJOP[LJ[\YHS ZLY]PJLZ MVY 4LHZ\YL . )VUK 7YVNYHT MVY Ä]L but not required. Aug. 22, 11:30 a.m.-12:30 p.m. View. Call 650-387-4210. www.ocraven.com dialogues/inside-the-bubble-a-conversation-with- author-noga-niv VM[OL+PZ[YPJ[»ZLSLTLU[HY`ZJOVVSZHUKV[OLYWYVQLJ[Z[V Free. Mountain View Public Library, 585 Franklin Soul & Wine Lounge Night The Oshman ILKL[LYTPULK St., Mountain View. Call 650-903-6887. www. Family JCC will host a night of live music and wine VOLUNTEERS 0U[LYLZ[LKÄYTZZOV\SKZ\ITP[VUL\UIV\UKHUKÄ]L mountainview.gov/library tasting, featuring singer-songwriter Steely Nash Living Classroom information meetings IV\UKVYPNPUHSZVMYLX\LZ[LKTH[LYPHSZ[V! Scottish Country Dancing and Cannonball Wine Company. Aug. 29, 8:30-11 demonstration At this event, the Mountain p.m. $20 in advance; $25 at the door. Oshman Mountain View Whisman School District’s Living RFQ for Architectural Services View adult (www.mtview-rscds.org) and South Family JCC, Cafe on the Square, 3921 Fabian Way, Classroom program is looking for volunteers Mountain View Whisman School District Bay Youth Scottish Country Dance (southbay. Palo Alto. Call 650-223-8631. paloaltojcc.org/ to teach nature-based lessons to students in Attn: Dr. Robert Clark, CBO rscds-sf.org) classes will offer demonstrations of Events/soulwine kindergarten through fourth grade. No prior 750-A San Pierre Way Scottish Country Dance and invite the audience Summer Concert Series: Hookslide The teaching experience is necessary. These meetings Mountain View, CA 94043 to participate. Adults and children are welcome. San Francisco-based a cappella group Hookslide will provide information about the program, Sept. 1, 7-8 p.m. Free. Mountain View Public will combine vocal percussion and bass and four- gardens and lessons. Aug. 24 and 27, 9-10 a.m. (SSZ[H[LTLU[ZVMX\HSPÄJH[PVUZT\Z[ILYLJLP]LKVUVY Library, 585 Franklin St., Mountain View. Call Free. Mountain View Whisman School District 2:00 PM, September 8, 2015 part harmony in a kinetic performance as part ILMVYL! 650-526-7020. www.mtview-rscds.org of the Village at San Antonio Center’s Summer Office, Conference Room, 750-A San Pierre Way, -VY X\LZ[PVUZ YLNHYKPUN [OPZ 9-8 [V NL[ H TVYL KL[HPSLK Concert Series. Aug. 23, 4-6 p.m. Free. The Mountain View. living-classroom.org KLZJYPW[PVUVY[VHYYHUNLHZP[L]PZP[JVU[HJ[[OL+PZ[YPJ[»Z EXHIBITS Village at San Antonio Center, 685 San Antonio Reading Partners info session Gina )VUK7YVNYHT4HUHNLY! ‘47 Years’ reception This reception at Road, Mountain View. www.facebook.com/ from Reading Partners will visit the Mountain the Oshman Family JCC will celebrate the TheVillageSAC/events View Senior Center to talk about its volunteer
.YL`Z[VUL>LZ[*VTWHU`·([[U!;VKK3LL photographic work of Victoria Mara Heilweil, program, through which participants can help >:WHPU:[YLL[:VUVTH*( who explores the beauty of imperfection and ON STAGE improve children’s literacy skills by reading with 6ɉJL impermanence in the show “47 Years.” The ‘The Country House’ In a Northern California them. Reading Partners has a site just down the ;OPZPZUV[HMVYTHSYLX\LZ[MVYIPKZVYHUVɈLYI`[OL+PZ[YPJ[ exhibit is on display until Aug. 25 in the Goldman premiere, TheatreWorks will stage a production street from the senior center at Castro Elementary [VJVU[YHJ[^P[OHU`WHY[`YLZWVUKPUN[V[OPZYLX\LZ[;OL Sports & Wellness Complex. Aug. 23, 6:30-8:30 of “The Country House,” a recent Broadway hit School. Aug. 25, 1 p.m. Free. Mountain View p.m. Free. Schultz Cultural Arts Hall, 3921 Fabian by Donald Margulies about a stage and film star Senior Center, 266 Escuela Ave., Mountain View. +PZ[YPJ[YLZLY]LZ[OLYPNO[[VYLQLJ[HU`HUKHSSX\HSPÄJH[PVUZ Way, Palo Alto. Call 650-233-8700. paloaltojcc. who brings her show-biz family to the Berkshires Call 650-903-6330. www.mountainview.gov/ org/Events/47-years-by-victoria-mara-heilweil for a summer stock season. There will be no seniors 22 Q Mountain View Voice Q MountainViewOnline.com Q August 21, 2015 ®
We work, play & succeed together for you!
650.488.7325 | [email protected] | www.deleonrealty.com | CalBRE #01903224
August 21, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 23 fogster.com THE PENINSULA’S FREE CLASSIFIEDS WEBSITE Combining the reach of the Web with Marketplace print ads reaching over 150,000 readers! PLACEPLACE AN AADD fogster.com is a unique website offering FREE postings from communities throughout the Bay Area and an opportunity for your ad to appear in the Palo Alto Weekly, The Almanac and the Mountain View Voice. ONLINE
fogster.com DISH TV 152 Research Study Starting at $19.99/month (for 12 mos.) Bulletin Volunteers SAVE! Regular Price $34.99 Ask About Technology EE-MAIL-MAIL FREE SAME DAY Installation! CALL Now! Medallia, Inc. has the following Hot Flashes? 844-597-4481 (AAN CAN) positions open in Palo Alto, CA: Women 40-65 with frequent hot flashes, [email protected]@fogster.comm may qualify for the REPLENISH Trial - a DISH TV Manager, Text Analytics: Identify Board free medical research study for post- Starting at $19.99/month (for 12 mos.) Jobs and analyze customer behavior PHONE menopausal women. Call 855-781-1851. SAVE! Regular Price $34.99 Ask About trends in extensive qualitative data. (Cal-SCAN) FREE SAME DAY Installation! CALL Now! 650.326.8216 888-992-1957 (AAN CAN) 115 Announcements 500 Help Wanted Director, Product Management: Pregnant? Kill Bed Bugs! Lead a team of 6 product manag- Now you can log on to Thninking of adoption? Talk with car- Buy Harris Bed Bug Killers/ KIT. Available: Active Safety Embedded Software ers and a cross functional team of ing agency specializing in matching Hardware Stores, Buy Online/Store: Engineer designers and engineers to build fogster.comfogster.com, day or Birthmothers with Families Nationwide. homedepot.com Mountain View, California. Design, software products. night and get your ad LIVING EXPENSES PAID. Call 24/7 Abby’s (AAN CAN) develop, and test Collision Avoidance One True Gift Adoptions. 866-413-6293. For Sale Kill Roaches! and Detection Systems (CADS) To apply, please mail resumes to A. startedstarted immediately online. Void in Illinois/ New Mexico/Indiana Guaranteed! Buy Harris Roach Tablets. and Adaptive Cruise Control apps. Zwerling, Medallia, Inc. 395 Page Mill Most listings are free and (AAN CAN) No Mess, Odorless, Long Lasting. Design Radar and Vision based Crash Road, Suite 100, Palo Alto, CA 94306 Sensing systems, and implement Pregnant? 201 Autos/Trucks/ Available: ACE Hardware, The Home includeinclude a oone-linene-line frfreeee CADS support, Collision Mitigation Considering adoption? Call us first. Depot (AAN CANN) by Braking, Driver Alert, Lane printprint ad in our Peninsula Living expenses, housing, medical, and Parts 2002 Zuma sailboat & trailer - $1800 Departure Warning and Lane Keep 560 Employment continued support afterwards. Choose Mercedes 2002 E320 Assist features. Requires Master’s newspapersnewspapers with the adoptive family of your choice. Call 24/7. Mercedes E320 Station Wagon. 2002. Desktop TV 15” - $30 Information in Embedded System Design and optionoption of photosphotos and 1-877-879-4709 (CalSCAN) 92,555 miles. Excellent condition. USED BOOK SALE Drivers: $2K Loyalty Bonus Gold exterior/tan leather interior. two years of experience in analysis, “Bibliocraft” artist demo 8/22 design, development and testing on Health and Dental Insurance. We additional lines. ExemptExempt Third row seating. $5000. have the best rates from top companies! Contact [email protected] of CADS, Mobileye EyeQ, Adaptive are employment ads, Advanced iPad Classes! Kid’s Cruise Control applications, Rear Call Now! 888-989-4807. (CalSCAN) whichwhich inincludeclude a wwebeb Alzheimer’s book author speaks 202 Vehicles Wanted Side Detection System, Electronically Drivers: $2K Sign On Bonus Scanned Radar, VMP EyeC language, Recent Pay Increase! We Put Drivers listing charge. Home ASST SECTION MGRS FOR FOPAL Cash for Cars and Automotive SPICE and CMMI First. Family Company w/ 401k. Beautiful Any Car/Truck. Running or Not! Services and Mind & Body Chair Yoga Classes at Little Hou Stuff development process requirements. Trucks. CDL-A Req - (877) 258-8782 Top Dollar Paid. We Come To You! Apply to: Delphi Corporation, www.drive4melton.com (Cal-SCAN) Does dementia stress your family Call For Instant Offer: 1-888-420-3808 Services requirerequire contact Attn: Matt Vanbuhler, HR Business Earn $500 A Day www.cash4car.com (AAN CAN) Partner and Staffing Specialist, HUGE USED BOOK SALE/FREE BOOKS as Airbrush Makeup Artist withwith a CustomerCustomer SalesSales 330 Child Care 3000 University Drive, Auburn Hills, Donate Your Car, Truck, Boat For: Ads . TV . Film . Fashion. HD . Digital. MOCKINGBIRD REVISITED discussion Michigan, 48326. Ref. Job No. 5586. Representative.Representative. to Heritage for the Blind. FREE 3 Day Offered 35% OFF TUITION - One Week Course Push and Pull of Digital Health Vacation, Tax Deductible, Free Towing, Afternoon child care on Thursday Taught by top makeup artist and All Paperwork Taken Care of. photographer. So, the next time you have Your Infinite World Series! Cashier and Cook Call 800-731-5042 (Cal-SCAN) Train and Build Portfolio. Models For Oaxacan Kitchen Markets. P/T, an item to sell, barter, give Provided. Accredited. A+ Rated. 130 Classes & I buy old Porsche’s Mind weekends only @ PA Farmers’ Markets. AwardMakeupSchool.com away or buy, get the perfect 911, 356. 1948-1973 only. Any condition. Will train for cook position. (818) 980-2119 (AAN CAN) combination: print ads in Instruction Top $$ paid. Finders Fee. Apply 650/799-7292 or Call 707-965-9546 or email [email protected] MAKE $1000 Weekly!! Airline Careers [email protected] your local newspapers, begin here – Get started by training & Body Mailing Brochures From Home. Helping (Cal-SCAN reaching more than 150,000 as FAA certified Aviation Technician. Customer Service/Brain Games & home workers since 2001. Genuine Financial aid for qualified students. Job Older Car, Boat, RV? Educational Toys Opportunity. No Experience Required. readers, and unlimited free placement assistance. Call Aviation Do the humane thing. Donate it to the 417 Groups Gray Matters educational toy store in Start Immediately. Institute of Maintenance 800-725-1563 Humane Society. Call Palo Alto. Part time position. Ideal for www.theworkingcorner.com (AAN CAN) web postings reaching (AAN CAN) 1- 800-743-1482 (Cal-SCAN) DID YOU KNOW retiree, grandparent, parent, or adults 7 IN 10 Americans or 158 million U.S. interested in learning how to expand hundreds of thousands Airline Careers Adults read content from newspaper the mind in children & adults. email: Start Here – Get trained as FAA certi- 210 Garage/Estate Business additional people!! media each week? Discover the Power [email protected] fied Aviation Technician. Financial aid Sales of Newspaper Advertising. For a free for qualified students. Job placement Menlo Park, 11 Wood Lane, Saturday brochure call 916-288-6011 or email assistance. Call Aviation Institute of August 22, 8-12 [email protected] (Cal-SCAN) Services Maintenance 866-231-7177. (Cal-SCAN) Director of Analytics INDEX Household goods and clothing. 425 Health Services YouGov America, Inc. is hiring a MP: 1351 North Lemon, 8/22, 9-2 Director of Analytics for its Redwood Q BULLETIN BOARD 133 Music Lessons Got Knee Pain? Back Pain? Multiple family. City, CA office. Resp. incl: complex 619 Consultants 100-199 Christina Conti Private Piano Shoulder Pain? Get a pain- relieving survey weighting, sample and Instruction brace -little or NO cost to you. Medicare Every Business RWC: 1228 Douglas Ave. Fri. 8/21, research design, and conducting Lessons in your home. Bachelor of Patients Call Health Hotline Now! has a story to tell! Get your message out Q FOR SALE 11am-2pm; Sat. 8/22, 9am-1pm advanced analytics. Qualifications Music. 650/493-6950 1-800-796-5091 (Cal-SCAN) with California’s PRMedia Release – the BIG RUMMAGE SALE benefits Lucile incl: Master’s degree and 2yrs exp, 200-299 incl. exp w/weighting & data only Press Release Service operated by Hope Street Music Studios Packard Children’s Hospital, Stanford. Safe Step Walk-In Tub! the press to get press! For more info Alert for Seniors. Bathroom falls can be processing, and exp w/R, SQL, & Q KIDS STUFF Now on Old Middefield Way, MV. (Just south of Woodside Rd., bet. contact Cecelia @ 916-288-6011 or Most instruments, voice. Broadway and Bayshore Fwy.) CASH fatal. Approved by Arthritis Foundation. Python. E-mail resumes: [email protected]. http://prmediarelease.com/california 330-399 All ages and levels 650-961-2192 ONLY. (650)497-8332 or during sale Therapeutic Jets. Less Than 4 Inch Step- (Cal-SCAN) www.HopeStreetMusicStudios.com (650)568-9840 In. Wide Door. Anti-Slip Floors. American Q MIND & BODY Made. Installation Included. Call 800-799-4811 for $750 Off. (Cal-SCAN) Engineering 624 Financial 400-499 Pure Storage, Inc. has following job Reduce Your Past Tax Bill Struggling with Drugs 235 Wanted to Buy opps. in Mountain View, CA: by as much as 75 Percent. Stop Levies, or alcohol? Addicted to PILLS? Talk to QJOBS CASH FOR GUNS 650-969-GUNS Liens and Wage Garnishments. Call The someone who cares. Call The Addiction Software Engineer [Req. #ESZ88]. Tax DR Now to see if you Qualify 500-599 Hope & Help Line for a free assessment. Perform full cycle app. devel. for 1-800-498-1067. (Cal-SCAN) 240 Furnishings/ 800-978-6674 QBUSINESS systems level storage SW. Sell Your Structured Household items Piano Lessons 495 Yoga settlement or annuity payments for SERVICES Hacienca-style set end tables - $250.00 Software Engineer [Req. #PGU47]. CASH NOW. You don’t have to wait for Quality Piano Lessons in Menlo Park. DID YOU KNOW Perform full cycle app. devel. for 600-699 Call (650)838-9772 Alita Lake New Toto Toilet - $150 your future payments any longer! 144 million U.S. Adults read a Newspaper systems level storage SW. Call 1-800-673-5926 Whirlpool 10.7 cubic - $400.00/BO Q print copy each week? Discover the (Cal-SCAN) HOME Power of Newspaper Advertising. For a Mail resumes referencing Req. # to: SERVICES 145 Non-Profits 245 Miscellaneous free brochure call 916-288-6011 or email H. Thibeault, 401 Castro St, 3rd Flr, Social Security Disability [email protected] (Cal-SCAN) Mountain View, CA 94041. benefits. Unable to work? Denied ben- 700-799 Needs Cable TV, Internet, Phone efits? We Can Help! WIN or Pay Nothing! with FREE HD Equipment and install for Contact Bill Gordon & Associates at Q FOR RENT/ DONATE BOOKS TO SUPPORT LIBRARY under $3 a day! Call Now! 855-602-6424 1-800-966-1904 to start your application FOR SALE Scottish Dancers Wanted! DirecTV Fogster.com i today! (Cal-SCAN) Starting at $19.99/mo. FREE Installation. REAL ESTATE Stanford Museums Volunteer FREE 3 months of HBO SHOWTIME s a unique website offering No phone 636 Insurance 800-899 WISH LIST FRIENDS OF PA LIBRARY CINEMAX, STARZ. FREE HD/DVR number in the Auto Insurance Upgrade! 2015 NFL Sunday Ticket FREE postings from commu- starting at $25/month! Q Included (Select Packages) New ad? Call 855-977-9537 PUBLIC/LEGAL 150 Volunteers Customers Only. CALL 1-800-385-9017 nities throughout the Bay Area NOTICES ASSIST IN FRIENDS STORE MP LIB (CalSCAN) GO TO Lowest Prices and an opportunity for your ad on Health & Dental Insurance. We have Dish Network 995-997 CASHIER BOOKSTORE MITCHELL PARK FOGSTER.COM the best rates from top companies! Call Get MORE for LESS! Starting $19.99/ Does dementia stress your family to appear in The Almanac, Now! 888-989-4807. (CalSCAN) month (for 12 months.) PLUS Bundle for contact The publisher waives any and all claims or Friends of the Mtn View Library and SAVE (Fast Internet for $15 more/ the Palo Alto Weekly, and the information To place a Classified ad in The consequential damages due to errors. Embarcadero month.) CALL Now 1-800-357-0810 Mountain View Voice call 326-8216 Media cannot assume responsibility for the claims or FRIENDS OF THE PALO ALTO LIBRARY (Cal-SCAN) Mountain View Voice. performance of its advertisers. Embarcadero Media or visit us at fogster.com has the right to refuse, edit or reclassify any ad JOIN OUR ONLINE STOREFRONT TEAM solely at its discretion without prior notice. GO TO FOGSTER.COM TO RESPOND TO ADS WITHOUT PHONE NUMBERS 24 Q Mountain View Voice Q MountainViewOnline.com Q August 21, 2015 MARKETPLACE the printed version of THE PENINSULA’S FREE CLASSIFIEDS WEBSITE TO RESPOND TO ADS WITHOUT PHONE NUMBERS TM GO TO WWW.FOGSTER.COM fogster.com
640 Legal Services 748 Gardening/ 751 General 759 Hauling 830 Commercial/ DID YOU KNOW Landscaping Contracting J & G HAULING SERVICE Real Income Property Information is power and content is Misc. junk, office, gar., furn., King? Do you need timely access to A. Barrios Garden Maintenance mattresses, green waste, more. public notices and remain relevant in *Weekly or every other week A NOTICE TO READERS: Lic./ins. Free est. 650/743-8852 today’s hostile business climate? Gain *Irrigation systems It is illegal for an unlicensed person (see my Yelp reviews) Estate the edge with California Newspaper *Clean up and hauling to perform contracting work on any Publishers Association new innovative *Tree removal project valued at $500.00 or more in website capublicnotice.com and check *Refs. 650/771-0213; 392-9760 labor and materials. State law also 771 Painting/ out the FREE One-Month Trial Smart requires that contractors include 801 Apartments/ Search Feature. For more information their license numbers on all advertis- Wallpaper call Cecelia @ (916) 288-6011 or J. Garcia Garden Maintenance ing. Check your contractor’s status Glen Hodges Painting Condos/Studios www.capublicnotice.com (Cal-SCAN) Service at www.cslb.ca.gov or 800-321-CSLB Call me first! Senior discount. 45 yrs. Menlo Park, 3 BR/2.5 BA - $4750 Free est. 21 years exp. (2752). Unlicensed persons taking #351738. 650/322-8325 650/366-4301 or 650/346-6781 jobs that total less than $500.00 must state in their advertisements STYLE PAINTING 805 Homes for Rent Village Auto For Sale or Lease Home Full service painting. Insured. Lic. that they are not licensed by the Los Altos Hills - $4950 First Time on the Market in 20+ Years Contractors State License Board. 903303. 650/388-8577 Fantastic Downtown Location LANDA’S GARDENING & Menlo Park, 3 BR/2 BA - $6,000/mon • ± 3,200 SF Building LANDSCAPING 775 Asphalt/ • ± 4,200 SF Lot Services Menlo Park, 5+ BR/3 BA - $7900 *Yard Maint. *New Lawns. *Rototil Owners are Open to Converting the *Clean Ups *Tree Trim *Power Wash Concrete Building to Office or Retail for Long 757 Handyman/ Mountain View, 3 BR/1 BA - $7,000.00 *Irrigation timer programming. Mtn. View Asphalt Sealing Term Lease 715 Cleaning 19 yrs exp. Ramon, 650/576-6242 Repairs Driveway, parking lot seal coating. [email protected] AAA HANDYMAN & MORE Asphalt repair, striping, 30+ years. 809 Shared Housing/ 855 Real Estate Services Family owned. Free est. Lic. 507814. Since 1985 Rooms Services R.G. Landscape 650/967-1129 Repairs • Maintenance • Painting ALL AREAS ROOMMATES.COM DID YOU KNOW Drought tolerant native landscapes and Lonely? Bored? Broke? Find the perfect Carpentry • Plumbing • Electrical Roe General Engineering Information is power and content is succulent gardens. Demos, installations, roommate to complement your person- Asphalt, concrete, pavers, tiles, sealing, King? Do you need timely access to pub- maint. Free est. 650/468-8859 All Work Guaranteed ality and lifestyle at Roommates.com! artificial turf. 36 yrs exp. No job too lic notices and remain relevant in today’s (AAN CAN) (650) 453-3002 small. Lic #663703. 650/814-5572 highly competitive market? Gain an edge with California Newspaper Publishers Association new innovative website Attic Clean-Up & Rodent Removal Handyman Services 825 Homes/Condos To place a Classified ad in 779 Organizing capublicnotice.com and check out the Are there rodents living in your attic. Lic. 249558. Plumb, elect., masonry, car- Smart Search Feature. For more informa- Call today to learn more about our The Almanac, The Palo Alto pentry, landscape. 40+ years exp. Pete Services for Sale $89 Attic Cleanup Special Call Us tion call Cecelia @ (916) 288-6011 or Rumore, 650/823-0736; 650/851-3078 End the Clutter & Get Organized Mountain View, 3 BR/2.5 BA - $1,589,000 Today (866) 391-3308 (paste into your www.capublicnotice.com (Cal-SCAN) Weekly or The Mountain View Residential Organizing browser) AtticStar.com FOGSTER.COM by Debra Robinson To place a Classified ad in The Almanac, The Palo Alto Weekly Orkopina Housecleaning Voice call 326-8216 (650)390-0125 or The Mountain View Voice call 326-8216 or visit us at fogster.com Celebrating 30 years in business clean- ing homes in your area. 650/962-1536 or visit us at fogster.com Public Notices
The name and residence address of the 995 Fictitious Name owner(s)/registrant(s) is(are): Statement ANA L POWERS 1018 Madison Ave. COFFEE BREAK INK Redwood City, CA 94061 FICTITIOUS BUSINESS NAME STATEMENT PATRICK POWERS File No.: 606610 1018 Madison Ave. The following person (persons) is (are) Redwood City, CA 94061 doing business as: Registrant/Owner began transacting Coffee Break Ink, located at 1453 San business under the fictitious business Do You Know? Marcos Cir., Mountain View, CA 94043, name(s) listed above on 8/92. Santa Clara County. This statement was filed with the This business is owned by: A General County Clerk-Recorder of Santa Clara Partnership. County on August 4, 2015. The name and residence address of the (MVV Aug. 7, 14, 21, 28, 2015) owner(s)/registrant(s) is(are): ;OL4V\U[HPU=PL^=VPJLPZHKQ\KPJH[LK[V RACHEL GIUSTI LOREEN HEWITT/ARTIST 1056 Gardenia Way FICTITIOUS BUSINESS NAME STATEMENT Sunnyvale, CA 94086 File No.: 607132 W\ISPZOPU[OL*V\U[`VM:HU[H*SHYH KRISTINA HSIEH The following person (persons) is (are) 525 Loch Lomond Ct. doing business as: Sunnyvale, CA 94087 Loreen Hewitt/Artist, located at 1657-H AARON TOM Belleville Way, Sunnyvale, CA 94087, 6\YHKQ\KPJH[PVUPUJS\KLZ[OL4PK7LUPUZ\SH 1453 San Marcos Cir. Santa Clara County. Mtn. View, CA 94043 This business is owned by: An Individual. Registrant/Owner began transacting The name and residence address of the business under the fictitious business owner(s)/registrant(s) is(are): JVTT\UP[PLZVM7HSV(S[V:[HUMVYK3VZ(S[VZ name(s) listed above on N/A. LOREEN HEWITT This statement was filed with the 1657-H Belleville Way County Clerk-Recorder of Santa Clara Sunnyvale, CA 94087 HUK4V\U[HPU=PL^ County on July 1, 2015. Registrant/Owner began transacting (MVV July 31, Aug. 7, 14, 21, 2015) business under the fictitious business name(s) listed above on N/A. KEEFER FINE GARDENING This statement was filed with the FICTITIOUS BUSINESS NAME STATEMENT County Clerk-Recorder of Santa Clara ;OL4V\U[HPU=PL^=VPJLW\ISPZOLZL]LY`-YPKH` File No.: 607486 County on July 21, 2015. The following person (persons) is (are) (MVV Aug. 14, 21, 28, Sept. 4, 2015) doing business as: Keefer Fine Gardening, located at 163 STATEMENT OF ABANDONMENT OF USE Beemer Avenue, Sunnyvale CA, 94086, OF FICTITIOUS BUSINESS NAME +LHKSPUL!WT[OLWYL]PV\Z-YPKH` Santa Clara County. File No. 607904 This business is owned by: An Individual. The following person(s)/entity(ies) has/ The name and residence address of the have abandoned the use of the fictitious owner(s)/registrant(s) is(are): business name(s). The information given GILROY JOHN GOSLER KEEFER below is as it appeared on the fictitious 163 Beemer Avenue business statement that was filed at the ;VHZZPZ[`V\^P[O`V\YSLNHSHK]LY[PZPUNULLKZ Sunnyvale, CA 94086 County Clerk-Recorder’s Office. Registrant/Owner began transacting FICTITIOUS BUSINESS NAME(S): business under the fictitious business JALDA SOURCES name(s) listed above on N/A. 201 Cypress Point Drive This statement was filed with the Mountain View, CA 94043-4875 JHSS(SPJPH:HU[PSSHU County Clerk-Recorder of Santa Clara FILED IN SANTA CLARA COUNTY ON: County on July 29, 2015. 11/15/2010 UNDER FILE NO. 544672 (MVV Aug. 7, 14, 21, 28, 2015) REGISTRANT’S NAME(S)/ENTITY (IES): ,THPS!HZHU[PSSHU'WH^LLRS`JVT JON DAVID ARMANTROUT PLUMBING STUDIO BATH & KITCHEN 201 Cypress Point Drive SHOWROOM Mountain View, CA 94043-4875 FICTITIOUS BUSINESS NAME STATEMENT DEBRA JEAN ARMANTROUT File No.: 607714 201 Cypress Point Drive The following person (persons) is (are) Mountain View, CA 94043-4875 doing business as: THIS BUSINESS WAS CONDUCTED BY: Plumbing Studio Bath & Kitchen Married Couple. Showroom, located at 2265 Old This statement was filed with the Middlefield Wy., Mountain View, CA County Clerk Recorder of Santa Clara 94043, Santa Clara County. County on August 11, 2015. This business is owned by: Married (MVV Aug. 21, 28, Sept. 4, 11, 2015) Couple. August 21, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 25 OPEN HOUSE 330 Chatham Way, Mountain View Saturday 8/22 & Sunday 8/23
Spacious and well-maintained home in desirable Waverly Park! Top Mountain View Schools (Huff, Graham, Mountain View – Buyer to verify). Excellent floor plan with master bedroom on the ground floor, separate living room, family room, dining room, eat-in kitchen. New carpets and interior paint. Interior/quiet street, easy access to El Camino Hospital, Cuesta and Cooper Parks, commute routes, retail and shopping. · 4 bedrooms · 8556 sq. ft. lot (approx.) · 2.5 bathrooms · 2-car attached garage 291 Tyrella Avenue, Mountain View · 2202 sq. ft. living space (approx.) $1,948,000 Lovely inside & out! A rare opportunity awaits your imagination! Large studio is your blank canvas to convert to your own dreams! Home features 2200 sq.ft, large ZXM[SV[NVYNLV\ZOHYK^VVKÅVVYZ WSLU[`VMZ[VYHNL5LHY.VVNSL Symantec, restaurants & shops. THIS is the home you’ll want to make your own! Marlys Warner & Sandy Brem, Realtors CONDO TO CASTLE PROPERTIES, INC. Suzanne O’Brien Nancy Carlson (650) 947-4793 (650) 947-4707 408-807-3513 • 408-205-1185 [email protected] [email protected] CalBRE # 01181757 / 00902008 CalBRE# 01467942 CalBRE# 00906274
COMING SOON TO WAVERLY PARK IN MOUNTAIN VIEW… SPACIOUS EXECUTIVE HOME WITH LOS ALTOS SCHOOLS!
Very unique opportunity to purchase a 5 bedroom, 3 bathroom home in what has been long consid- ered Mountain Views executive neighborhood, served by Los Altos Schools.
3,067 square feet of living space on a 11,326 square foot beautifully landscaped lot featuring a 3 car attached garage, 5 upstairs bedrooms plus DGRZQVWDLUVDXSDUHVXLWHRUKRPHRI¿FHLQODZ quarters, formal entry with arched opening to the grand living room, formal dining area, updated granite kitchen with all-new quality stainless steel DSSOLDQFHVODUJHIDPLO\URRPWZR¿UHSODFHVJRU- JHRXVKDUGZRRGÀRRUVGXDO]RQHKHDWLQJV\VWHP entertainers backyard complete with spa, corner JD]HERDQGDSOHWKRUDRIKDQGVHOHFWHGIROLDJHE\ a true garden lover!
Whether you have a large family, want top-notch schools, are an advent gardener or love formal and informal entertaining this is the home for you!
Asking Price $2,598,000 Tori Ann Atwell T ORI ANN (650) 996-0123 BRE #00927794 Broker Associate ATWELL www.ToriSellsRealEstate.com Alain Pinel Realtors
26 Q Mountain View Voice Q MountainViewOnline.com Q August 21, 2015 List your home with DeLeon Realty
DeLeon Realty will cover all of the following at no additional charge: • Staging* • Property Inspection • Pest Inspection *Includes: Design, Installation, 1 Month of Furniture Rental and Removal
Our clients love the personal attention they receive from Michael Repka, from beginning to end. Additionally you will receive a suite of free services from the DeLeon Team, including interior design, construction consulting, handyman work, and dedicated marketing to local and foreign buyers.
®
650.488.7325 | www.deleonrealty.com | DeLeon Realty CalBRE #01903224
August 21, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 27 EXTENDED HOURS: FRIDAY, 208 BENTLEY SQUARE 9:30 AM–5:00 PM SATURDAY & SUNDAY, 1:00–5:00 PM MOUNTAIN VIEW www.208Bentley.com $1,698,000
3 BEDS 2 BATHS UPDATED ATRIUM COMMUNITY POOL & TENNIS COURTS CLOSE TO SHOPPING AND DINING
EXTENDED HOURS: FRIDAY, 1229 CUERNAVACA CIRCULO 9:30 AM–5:00 PM SATURDAY & SUNDAY, 1:00–5:00 PM MOUNTAIN VIEW www.1229Cuernavaca.com $1,498,000
3 BEDS 3 BATHS UPDATED COMMUNITY POOL, SPAS, TENNIS COURTS CLOSE TO SHOPPING AND DINING
Information deemed reliable, but not guaranteed.
650 • 440 • 5076 [email protected] davidtroyer.com A Berkshire Hathaway Affiliate
CalBRE# 01234450
28 Q Mountain View Voice Q MountainViewOnline.com Q August 21, 2015 115 Eleanor Drive, Woodside Offered at $5,988,000 Custom Estate Draped in Luxury Luxuriate in the quiet splendor of this exquisite 5 bedroom, 4.5 bath home of 3,935 sq. ft. (per county) with a 1,060 sq. ft. walk-out lower level (per plans) on a lot of 1.12 acres (per county).Recessed lighting, and French white oak fl oors enhance the interior. Th e two-story great room off ers a fi replace and a mezzanine with bookshelves. Th e breathtaking gourmet kitchen brandishes a massive island, marble countertops, two sinks, intricate cabinetry, and a walk-in pantry. Posh appliances consist of concealed Th ermador refrigerator and freezer units and a Wolf double- oven with a French top. Th e upstairs master suite off ers a private balcony, dramatic ceilings, and a sumptuous bathroom with a free- standing tub. Additional features include a home offi ce, a detached three-car garage, automatic gates, terraced gardens, and sensational bay views. Moments from Menlo Country Club and Woodside Plaza, the home is nearby Las Lomitas Elementary (API 943) and La Entrada Middle (API 963), and is walking distance from Woodside High. For video tour & more photos, please visit: www.115Eleanor.com
®
Ken DeLeon Michael Repka CalBRE #01342140 CalBRE #01854880
650.488.7325 | [email protected] | www.deleonrealty.com | CalBRE #01903224
August 21, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 29 WHERE GOOD FOOD AND COMMUNITY MEET
Ada’s Cafe is a 501(c)(3), social enterprise dedicated to hiring, training and employing adults with developmental disabilities in its food service businesses. Through its cafe at the Mitchell Park Community Center and a catering business that operates out of a commercial kitchen in Mountain View, Ada’s goal is to empower its Associates and employ them in a manner that accommodates their disability yet challenges them every day to expand their skill set. Ada’s also integrates high school interns and at-risk young adults into its daily cafe and catering operations. Ada’s organizes its activities around three C’s: Compassionate Employment, Community Engagement and Commercial Success. Ada’s founders believe that satisfying each of these is critical if Ada’s is to achieve its goal of fulfilling its mission as a self-sustaining social enterprise. Sereno Group is proud to support the commitment and services Ada’s Cafe provides to our community. For more information about their work or how you can get involved, please visit www.adascafe.org DURING THE MONTHS OF JULY THROUGH SEPTEMBER 2015, SERENO GROUP REAL ESTATE AND ITS PALO ALTO AGENTS WILL BE CONTRIBUTING 1% OF THEIR GROSS COMMISSIONS TO ADA’S CAFE. PALO ALTO
HERE FOR GOOD SERENOGROUP.COM/ONEPERCENT
30 Q Mountain View Voice Q MountainViewOnline.com Q August 21, 2015 ™
PAM BLACKMAN PAM Pam’s Amazing Makeovers CERTIFIED RESIDENTIAL SPECIALIST® ...and the art of Real Estate SENIORS REAL ESTATE SPECIALIST® Thinking about selling?
SOLD by With Pam, she’ll manage everything ™ 436 Sierra Vista Ave. #2 Pam Blackman for you. PAM – custom pre-marketing (partial list) Mountain View property preparation is the fi rst step. Call, text, or email Pam to learn more 2 bed / 2.5 bath / 1272 sq ft ™ SALE PENDING about PAM. Updated unit with 2 master VXLWHVUHPRGHOHGNLWFKHQ 650.823.0308 [email protected] inside laundry w/full size www.PamBlackman.com CalBRE# 00584333 KRRNXSV SULYDWHOXVKSDWLR
List Price $838,000
928 Wright Ave. #1101 WE MEASURE QUALITY BY RESULTS Mountain View Is Quality Important to You? 3 bed / 2 ba / 1414 sq ft Yvonne Heyl 5HPRGHOHGVWÀRRUHQGXQLW SOLDWITH FOR MULTIPLE $1,050,000 OFFERS Power of Two! Direct (650) 947-4694 condo on the water. Separate Cell (650) 302-4055 [email protected] dining room and garage. Near BRE# 01255661 downtown Mountain View. Jeff Gonzalez Direct (650) 947-4698 List Price $845,000 Cell (408) 888-7748 [email protected] BRE# 00978793 1983 San Luis Ave. Mountain View [email protected] 496 First St. Suite 200 www.yvonneandjeff.com Los Altos 94022 2 bed / 2.5 bath / 1171 sq ft COMING SOON Dual master suites, hardwood ÀRRUVRSHQNLWFKHQZEUHDNIDVW bar, living room w/ corner Are you staying current ¿UHSODFH GRRUWRDVXQQ\ with the changing real estate EDFN\DUGSOXVDWWDFKHGJDUDJH market conditions? List Price TBD 209 E. Red Oak Dr. :HRσHUWKHRQHRQOLQH destination that lets you Sunnyvale fully explore: OPEN HOUSE 2 bed / 1 bath / 926 sq ft • Interactive maps Completely remodeled single • Homes for sale SAT & SUN 1:30PM - 4:30PM • Open house dates and times story townhome in desirable • Virtual tours and photos complex with a large private • Prior sales info patio/yard. • Neighborhood guides • Area real estate links • and so much more. List Price $599,000
Our comprehensive online guide to the Midpeninsula real estate market has all As the top selling realtor for Condos the resources a home buyer, agent or local resident could and Townhouse since 1990, Royce is ever want and it’s all in one the condo specialist. easy-to-use, local site! Agents: You’ll want to explore our unique online advertising opportunities. &RQWDFW\RXUVDOHVUHSUHVHQWDWLYHRUFDOOWRGD\WRðQGRXWPRUH
Explore area real estate through your favorite local website: THE ROYCE GROUP TheAlmanacOnline.com Your Townhome & Condo Specialists MountainViewOnline.com PaloAltoOnline.com (650) 224-1711 And click on “real estate” in the navigation bar. [email protected]
BRE# 01062078 www.reroyce.com BRE# 01519580
SERENO GROUP believes this information to be correct but has not verified this information and assumes no legal responsibility orf its TheAlmanacOnline.com MountainViewOnline.com PaloAltoOnline.com accuracy. Buyers should investigate these issues to their own satisfaction.
August 21, 2015 Q Mountain View Voice Q MountainViewOnline.com Q 31 Coldwell Banker #1 IN CALIFORNIA
PALO ALTO Sat 1:30 - 5 $7,988,000 PALO ALTO Sat/Sun 1 - 4:30 $3,895,000 LOS ALTOS HILLS Sat/Sun 2 - 4 $2,988,000 2281 Byron St 5 BR 5.5 BA 6-year new in Old Palo Alto with 5 4264 Wilkie Way 5 BR 4.5 BA Newer home on lg lot. Upgraded 11622 Rebecca Ln 6 BR 3.5 BA Stunning Estate in Prestigious suites, office, bonus & media room, large lot gourmet kit, hardwood flrs & convenient upstairs laundry Neighborhood; Sunrise/Sunset, hills & city lights views Judy Shen CalBRE #01272874 650.325.6161 Gil Oraha CalBRE #01355157 650.325.6161 Ron & Nasrin DelanCalBRE #01360743, 01496730 650.941.7040
PALO ALTO Sat/Sun 1:30 - 5:30 $2,500,000 SOUTH PALO ALTO Sun 12 - 4 $2,200,000 FOSTER CITY Sat/Sun 1:30 - 4:30 $1,998,000 771 Encina Grande Dr 4 BR 2 BA Spacious remodeled home waiting 303 Creekside Dr 3 BR 2 BA Enjoy a relaxing California indoor/ 642 Greenwich Ln 4 BR 2.5 BA Live a life style you always dreamed to suit your needs in coveted Barron Park outdoor living at its best under the majestic oak tree of! Wide water location. 2 car garage Vivi Chan CalBRE #00964958 650.941.7040 Yuli Lyman CalBRE #01121833 650.941.7040 Tom Huff CalBRE #922877 650.325.6161
PALO ALTO Sat/Sun 1:30 - 4:30 $1,788,000 EAST PALO ALTO Sat/Sun 1:30 - 4:30 $1,777,860 MOUNTAIN VIEW Sat/Sun 1:30 - 4:30 $1,348,000 1235 Alma St 3 BR 2.5 BA 2240sf TH, courtyard w/stone patio. FP, 2206 Lincoln Street 7 BR 5 BA This spacious home has great 2347 Thompson Ct 3 BR 2 BA Light & bright on lg private lot, open recessed lighting, eat-in-kitchen, laundry inside potential to become a Homestay/bed and breakfast. flr pln, many upgrades, convenient local, bonus rm Emily Chiang CalBRE #01744416 650.325.6161 Jane Jones CalBRE #01847801 650.325.6161 Nancy Adele Stuhr CalBRE #00963170 650.941.7040
SAN JOSE (ALUM ROCK) Sat 1:30 - 4:30 $1,188,000 MOUNTAIN VIEW $900,000 SUNNYVALE Sat/Sun 1 - 4 $680,000 248 Eastside Dr Expanded & rebuilt duplex. 2-3BR/2.5BA units+1 car 3 BR 1 BA Newly remodeled bathroom, spacious family kitchen, fresh 903 Sunrose Ter 2 BR 2 BA Beautiful Condo w/approx.1200sf of garage close to shopping and more! new paint inside and out. living space. Super Location, close to new Apple Campus Jo Buchanan & Stuart BowenCalBRE #00468827 650.941.7040 Alan & Nicki Loveless Zahra Miller CalBRE #01235386 650.941.7040 CalBRE #00444835 & 00924021 650.325.6161
REDWOOD CITY Sun 1:30 - 4:30 $599,000 SAN JOSE Townhome w/Open Flr Plan $545,000 LOS ALTOS Sat/Sun 1:30 - 4:30 Price Upon Request 1240 Woodside Rd 21 2 BR 2 BA Complex has pool & sauna. 3 BR 2.5 BA Newer townhome w/open flr plan; kit w/granite counters 945 Yorkshire Dr 4 BR 3 BA Wonderful 1 level remod flr plan in Surround Sound! Great location close to shppng & transportation. opens to DR & LR. Private Mstr Ste desirable Highlands neighborhood. Newer kit & new Ba’s Tom Huff CalBRE #922877 650.325.6161 Teri Woolworth CalBRE #01311430 650.941.7040 Terri Couture CalBRE #01090940 650.941.7040
Los Altos | Palo Alto CaliforniaMoves.com |GFRSVGEP|GFQEVOIXMRK[IWX|GSPH[IPPFEROIV ©2015 Coldwell Banker Real Estate LLC. All Rights Reserved. Coldwell Banker® is a registered trademark licensed to Coldwell Banker Real Estate LLC. An Equal Opportunity Company. Equal Housing Opportunity. Each Coldwell Banker Residential Brokerage 3J½GI-W3[RIHF]E7YFWMHMEV]SJ26800'%PPVMKLXWVIWIVZIH8LMWMRJSVQEXMSR[EWWYTTPMIHF]7IPPIVERHSVSXLIVWSYVGIW&VSOIVFIPMIZIWXLMWMRJSVQEXMSRXSFIGSVVIGXFYXLEWRSXZIVM½IHXLMWMRJSVQEXMSRERHEWWYQIWRSPIKEPVIWTSRWMFMPMX]JSVMXWEGGYVEG] Buyers should investigate these issues to their own satisfaction. DRE License #01908304
32 Q Mountain View Voice Q MountainViewOnline.com Q August 21, 2015